+ USE_DATABASE_REPLICATED=0 + USE_SHARED_CATALOG=0 ++ rg -v '#' /usr/share/zoneinfo/zone.tab ++ awk '{print $3}' ++ shuf ++ head -n1 + TZ=Europe/Dublin + echo 'Chosen random timezone Europe/Dublin' + ln -snf /usr/share/zoneinfo/Europe/Dublin /etc/localtime Chosen random timezone Europe/Dublin + echo Europe/Dublin + dpkg -i package_folder/clickhouse-common-static_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48402 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-common-static (24.8.14.10503.altinitytest) ... Setting up clickhouse-common-static (24.8.14.10503.altinitytest) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48429 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10503.altinitytest) ... Setting up clickhouse-common-static-dbg (24.8.14.10503.altinitytest) ... + dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-odbc-bridge. (Reading database ... 48436 files and directories currently installed.) Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-odbc-bridge (24.8.14.10503.altinitytest) ... Setting up clickhouse-odbc-bridge (24.8.14.10503.altinitytest) ... + dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-library-bridge. (Reading database ... 48442 files and directories currently installed.) Preparing to unpack .../clickhouse-library-bridge_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-library-bridge (24.8.14.10503.altinitytest) ... Setting up clickhouse-library-bridge (24.8.14.10503.altinitytest) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48448 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-server (24.8.14.10503.altinitytest) ... Setting up clickhouse-server (24.8.14.10503.altinitytest) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' groupadd -r clickhouse-bridge useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge' chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10503.altinitytest_arm64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48465 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10503.altinitytest_arm64.deb ... Unpacking clickhouse-client (24.8.14.10503.altinitytest) ... Setting up clickhouse-client (24.8.14.10503.altinitytest) ... + echo '' + [[ -z '' ]] + ch --query 'SELECT 1' 1 + chl --query 'SELECT 1' 1 + chc --version ClickHouse client version 24.8.14.10503.altinitytest (altinity build). + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=29024256 + sed --follow-symlinks -i 's|[[:digit:]]\+|29024256|' /etc/clickhouse-server/config.d/keeper_port.xml + value=56952832 + sed --follow-symlinks -i 's|[[:digit:]]\+|56952832|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n '' ]] + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/arm64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + ./minio server --address :11111 ./minio_data + grep AccessDenied + curl --silent --verbose http://localhost:11111 trying to connect to minio + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. MinIO Object Storage Server Copyright: 2015-2025 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/arm64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:40645 http://127.0.0.1:40645 Docs: https://min.io/docs/minio/linux/index.html Azurite Blob service is starting on 0.0.0.0:10000 Azurite Blob service successfully listens on http://0.0.0.0:10000 + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./186B1B0A09EED17E7dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 295 root 8u IPv4 44899 0t0 TCP localhost:11111 (LISTEN) minio 295 root 9u IPv6 44900 0t0 TCP *:11111 (LISTEN) minio 295 root 10u IPv6 44901 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 138.91 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + ./setup_hdfs_minicluster.sh + ls -lha total 120M drwxr-xr-x 1 root root 4.0K Oct 3 23:16 . drwxr-xr-x 1 root root 4.0K Oct 3 23:16 .. -rw-rw-r-- 1 1000 1000 119 Oct 3 23:13 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1.3K Oct 3 23:16 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 3.9K Oct 3 23:16 __azurite_db_blob__.json -rw-r--r-- 1 root root 1.4K Oct 3 23:16 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4.0K Oct 3 23:16 __blobstorage__ drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 3 23:13 broken_tests.json drwxr-xr-x 14 root root 3.7K Oct 3 23:16 dev -rwxr-xr-x 1 root root 0 Oct 3 23:16 .dockerenv drwxr-xr-x 1 root root 4.0K Oct 3 23:16 etc drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1 drwxr-xr-x 2 root root 4.0K Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib -rwxr-xr-x 1 root root 25M Jan 31 2025 mc drwxr-xr-x 2 root root 4.0K Sep 11 2024 media -rwxr-xr-x 1 root root 95M Jan 31 2025 minio drwxr-xr-x 4 root root 4.0K Oct 3 23:16 minio_data drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4.0K Oct 3 23:16 package_folder dr-xr-xr-x 314 root root 0 Oct 3 23:16 proc -rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt drwx------ 1 root root 4.0K Oct 3 23:16 root drwxr-xr-x 1 root root 4.0K Oct 3 23:16 run -rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv -rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 3 23:16 sys drwxrwxr-x 2 1000 1000 4.0K Oct 3 23:16 test_output drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib drwxr-xr-x 1 root root 4.0K Sep 11 2024 var + cd hadoop-3.3.1 + export JAVA_HOME=/usr + JAVA_HOME=/usr + mkdir -p target/test/data + chown clickhouse ./target/test/data + nc -z localhost 12222 + sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + lsof -i :12222 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME java 428 clickhouse 322u IPv4 58714 0t0 TCP localhost:12222 (LISTEN) + sleep 5 + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + [[ -n '' ]] + export IS_FLAKY_CHECK=0 + IS_FLAKY_CHECK=0 + '[' 1 -gt 1 ']' + sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "PUT /devstoreaccount1/cont/eiokqxjzourolhvxyppcxjwcyhaumefm HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "GET /devstoreaccount1/cont/eiokqxjzourolhvxyppcxjwcyhaumefm HTTP/1.1" 206 4 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "GET /devstoreaccount1/cont/eiokqxjzourolhvxyppcxjwcyhaumefm HTTP/1.1" 206 2 127.0.0.1 - - [03/Oct/2025:22:17:04 +0000] "DELETE /devstoreaccount1/cont/eiokqxjzourolhvxyppcxjwcyhaumefm HTTP/1.1" 202 - + for _ in {1..100} + clickhouse-client --query 'SELECT 1' 1 + break + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ ahxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 633 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + true + set -e + return + clickhouse-client --query 'CREATE TABLE minio_audit_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + clickhouse-client --query 'CREATE TABLE minio_server_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + max_retries=100 + retry=1 + '[' 1 -le 100 ']' + echo 'clickminio restart attempt 1:' clickminio restart attempt 1: ++ ./mc admin service restart clickminio --wait --json ++ jq -r .status INFO: Restarting on service signal MinIO Object Storage Server Copyright: 2015-2025 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/arm64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:32911 http://127.0.0.1:32911 Docs: https://min.io/docs/minio/linux/index.html + output='success success' + echo 'Output of restart status: success success' + expected_output='success success' + '[' 'success success' = 'success success' ']' + echo 'Restarted clickminio successfully.' + break + '[' 1 -gt 100 ']' Output of restart status: success success Restarted clickminio successfully. + MC_ADMIN_PID=1519 + ./mc admin trace clickminio + export -f run_tests + '[' 1 -gt 1 ']' + run_tests + set -x + read -ra ADDITIONAL_OPTIONS + HIGH_LEVEL_COVERAGE=YES + '[' 1 -gt 1 ']' + [[ -n '' ]] + [[ -n '' ]] + [[ 0 -eq 1 ]] + [[ '' -eq 1 ]] + [[ 0 -eq 1 ]] ++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\''' + [[ 1 == 0 ]] + ADDITIONAL_OPTIONS+=('--jobs') + ADDITIONAL_OPTIONS+=('8') + [[ -n '' ]] + [[ -n '' ]] + [[ YES = \Y\E\S ]] + ADDITIONAL_OPTIONS+=('--report-coverage') + ADDITIONAL_OPTIONS+=('--report-logs-stats') + try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + local total_retries=10 + shift + fn_exists run_with_retry + declare -F run_with_retry + run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=10 + shift + local retry=0 + '[' 0 -ge 10 ']' + clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + true + set -e + return + set +e + TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}") + clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --report-coverage --report-logs-stats + ts '%Y-%m-%d %H:%M:%S' + tee -a test_output/test_result.txt 2025-10-03 23:17:10 Using queries from '/usr/share/clickhouse-test/queries' directory 2025-10-03 23:17:10 Connecting to ClickHouse server... OK 2025-10-03 23:17:10 Connected to server 24.8.14.10503.altinitytest @ e905d7433e089be5ae0e2e1a62b31c75230e5cf9 HEAD 2025-10-03 23:17:11 Found 6503 parallel tests and 571 sequential tests 2025-10-03 23:17:11 Running about 812 stateless tests (Process-7). 2025-10-03 23:17:11 03041_analyzer_gigachad_join: [ OK ] 0.17 sec. 2025-10-03 23:17:11 Running about 812 stateless tests (Process-9). 2025-10-03 23:17:11 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:17:11 Running about 812 stateless tests (Process-8). 2025-10-03 23:17:11 00499_json_enum_insert: [ OK ] 0.17 sec. 2025-10-03 23:17:11 Running about 812 stateless tests (Process-4). 2025-10-03 23:17:11 02451_variadic_null_garbage_data: [ OK ] 0.22 sec. 2025-10-03 23:17:11 Running about 812 stateless tests (Process-6). 2025-10-03 23:17:11 02271_fix_column_matcher_and_column_transformer: [ OK ] 0.22 sec. 2025-10-03 23:17:11 Running about 812 stateless tests (Process-5). 2025-10-03 23:17:11 02242_subcolumns_sizes: [ OK ] 0.27 sec. 2025-10-03 23:17:11 00445_join_nullable_keys: [ OK ] 0.12 sec. 2025-10-03 23:17:11 01486_json_array_output: [ OK ] 0.12 sec. 2025-10-03 23:17:12 Running about 812 stateless tests (Process-10). 2025-10-03 23:17:12 03222_datetime64_small_value_const: [ OK ] 0.42 sec. 2025-10-03 23:17:12 Running about 812 stateless tests (Process-3). 2025-10-03 23:17:12 01182_materialized_view_different_structure: [ OK ] 0.47 sec. 2025-10-03 23:17:12 02492_clickhouse_local_context_uaf: [ OK ] 0.37 sec. 2025-10-03 23:17:12 02160_h3_hex_area_Km2: [ OK ] 0.17 sec. 2025-10-03 23:17:12 01104_fixed_string_like: [ OK ] 0.22 sec. 2025-10-03 23:17:12 02769_compare_functions_nan: [ OK ] 0.32 sec. 2025-10-03 23:17:12 01710_minmax_count_projection: [ OK ] 0.42 sec. 2025-10-03 23:17:12 02812_large_varints: [ OK ] 0.12 sec. 2025-10-03 23:17:12 01079_bit_operations_using_bitset: [ OK ] 0.18 sec. 2025-10-03 23:17:12 00164_not_chain: [ OK ] 0.12 sec. 2025-10-03 23:17:12 01869_function_modulo_legacy: [ OK ] 0.12 sec. 2025-10-03 23:17:12 03164_analyzer_global_in_alias: [ OK ] 0.17 sec. 2025-10-03 23:17:12 01514_input_format_json_enum_as_number: [ OK ] 0.12 sec. 2025-10-03 23:17:12 02807_lower_utf8_msan: [ OK ] 0.12 sec. 2025-10-03 23:17:12 01872_functions_to_subcolumns_analyzer: [ OK ] 0.22 sec. 2025-10-03 23:17:12 02962_analyzer_resolve_group_by_on_shards: [ OK ] 0.17 sec. 2025-10-03 23:17:12 01952_optimize_distributed_group_by_sharding_key: [ OK ] 0.22 sec. 2025-10-03 23:17:12 01070_template_empty_file: [ OK ] 0.12 sec. 2025-10-03 23:17:12 00676_group_by_in: [ OK ] 0.12 sec. 2025-10-03 23:17:12 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:17:12 00713_collapsing_merge_tree: [ OK ] 0.17 sec. 2025-10-03 23:17:12 02869_insert_filenames_collisions: [ OK ] 0.22 sec. 2025-10-03 23:17:12 00331_final_and_prewhere_condition_ver_column: [ OK ] 0.17 sec. 2025-10-03 23:17:13 00990_hasToken: [ OK ] 1.27 sec. 2025-10-03 23:17:13 01923_ttl_with_modify_column: [ OK ] 0.22 sec. 2025-10-03 23:17:13 02376_analyzer_in_function_subquery: [ OK ] 0.22 sec. 2025-10-03 23:17:13 01825_new_type_json_in_other_types: [ OK ] 1.27 sec. 2025-10-03 23:17:13 02165_h3_exact_edge_length_Km: [ OK ] 0.17 sec. 2025-10-03 23:17:13 01277_alter_rename_column_constraint_zookeeper_long: [ OK ] 0.42 sec. 2025-10-03 23:17:13 01592_long_window_functions1: [ OK ] 0.62 sec. 2025-10-03 23:17:13 01783_http_chunk_size: [ OK ] 0.37 sec. 2025-10-03 23:17:13 02165_h3_edge_length_km: [ OK ] 0.17 sec. 2025-10-03 23:17:13 02205_ephemeral_1: [ OK ] 0.22 sec. 2025-10-03 23:17:13 00576_nested_and_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:17:13 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.22 sec. 2025-10-03 23:17:14 03132_jit_sort_description_crash_fix: [ OK ] 0.27 sec. 2025-10-03 23:17:14 03012_parser_backtracking: [ OK ] 1.62 sec. 2025-10-03 23:17:14 02354_vector_search_bugs: [ OK ] 0.37 sec. 2025-10-03 23:17:14 00418_input_format_allow_errors: [ OK ] 1.52 sec. 2025-10-03 23:17:14 00549_join_use_nulls: [ OK ] 0.17 sec. 2025-10-03 23:17:14 01137_order_by_func: [ OK ] 1.17 sec. 2025-10-03 23:17:14 02814_order_by_tuple_window_function: [ OK ] 0.12 sec. 2025-10-03 23:17:14 01926_json_as_string_array: [ OK ] 0.57 sec. 2025-10-03 23:17:15 03006_async_insert_deadlock_log: [ OK ] 0.72 sec. 2025-10-03 23:17:15 01067_window_view_event_tumble_to_asc_lateness: [ OK ] 0.97 sec. 2025-10-03 23:17:15 02732_rename_after_processing: [ OK ] 1.22 sec. 2025-10-03 23:17:15 02956_clickhouse_local_system_parts: [ OK ] 0.52 sec. 2025-10-03 23:17:15 02552_client_format_settings: [ OK ] 0.12 sec. 2025-10-03 23:17:15 02475_precise_decimal_arithmetics: [ OK ] 0.27 sec. 2025-10-03 23:17:15 00558_parse_floats: [ OK ] 0.12 sec. 2025-10-03 23:17:15 01716_array_difference_overflow: [ OK ] 0.12 sec. 2025-10-03 23:17:15 00010_big_array_join: [ OK ] 0.12 sec. 2025-10-03 23:17:15 01655_window_functions_bug: [ OK ] 0.17 sec. 2025-10-03 23:17:15 01753_mutate_table_predicated_with_table: [ OK ] 0.17 sec. 2025-10-03 23:17:15 00636_partition_key_parts_pruning: [ OK ] 2.53 sec. 2025-10-03 23:17:15 02995_new_settings_history: [ SKIPPED ] 0.00 sec. 2025-10-03 23:17:15 Reason: not running for current build 2025-10-03 23:17:15 02254_projection_broken_part: [ OK ] 1.83 sec. 2025-10-03 23:17:15 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.17 sec. 2025-10-03 23:17:16 02122_parallel_formatting_CSV: [ OK ] 0.92 sec. 2025-10-03 23:17:16 01518_nullable_aggregate_states1: [ OK ] 0.17 sec. 2025-10-03 23:17:16 03068_analyzer_distributed_join: [ OK ] 0.27 sec. 2025-10-03 23:17:16 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.17 sec. 2025-10-03 23:17:16 02769_parallel_replicas_unavailable_shards: [ OK ] 0.37 sec. 2025-10-03 23:17:16 02918_wrong_dictionary_source: [ OK ] 0.17 sec. 2025-10-03 23:17:16 01837_cast_to_array_from_empty_array: [ OK ] 0.17 sec. 2025-10-03 23:17:16 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 4.88 sec. 2025-10-03 23:17:16 00997_set_index_array: [ OK ] 0.62 sec. 2025-10-03 23:17:16 01780_dict_get_or_null: [ OK ] 0.37 sec. 2025-10-03 23:17:16 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.17 sec. 2025-10-03 23:17:16 02888_integer_type_inference_in_if_function: [ OK ] 0.17 sec. 2025-10-03 23:17:16 01560_cancel_agg_func_combinator_native_name_constraint: [ OK ] 0.12 sec. 2025-10-03 23:17:17 02245_make_datetime64: [ OK ] 0.47 sec. 2025-10-03 23:17:17 00552_or_nullable: [ OK ] 0.17 sec. 2025-10-03 23:17:17 02789_describe_table_settings: [ OK ] 0.12 sec. 2025-10-03 23:17:17 01266_default_prewhere_reqq: [ OK ] 0.17 sec. 2025-10-03 23:17:17 01381_for_each_with_states: [ OK ] 0.17 sec. 2025-10-03 23:17:17 03038_move_partition_to_oneself_deadlock: [ OK ] 0.17 sec. 2025-10-03 23:17:17 01914_ubsan_quantile_timing: [ OK ] 0.12 sec. 2025-10-03 23:17:17 02009_body_query_params: [ OK ] 0.32 sec. 2025-10-03 23:17:17 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 1.07 sec. 2025-10-03 23:17:17 02891_alter_update_adaptive_granularity: [ OK ] 0.17 sec. 2025-10-03 23:17:17 01440_big_int_exotic_casts: [ OK ] 0.27 sec. 2025-10-03 23:17:18 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.17 sec. 2025-10-03 23:17:18 02366_kql_extend: [ OK ] 0.22 sec. 2025-10-03 23:17:18 02124_empty_uuid: [ OK ] 0.12 sec. 2025-10-03 23:17:18 00180_attach_materialized_view: [ OK ] 0.17 sec. 2025-10-03 23:17:18 00933_alter_ttl: [ OK ] 0.27 sec. 2025-10-03 23:17:18 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.17 sec. 2025-10-03 23:17:18 02962_arrow_dictionary_indexes_types: [ OK ] 1.47 sec. 2025-10-03 23:17:19 02183_array_tuple_literals_remote: [ OK ] 0.28 sec. 2025-10-03 23:17:19 01514_empty_buffer_different_types: [ OK ] 0.17 sec. 2025-10-03 23:17:19 00471_sql_style_quoting: [ OK ] 0.12 sec. 2025-10-03 23:17:19 02815_alias_to_length: [ OK ] 0.17 sec. 2025-10-03 23:17:19 01932_global_in_function: [ OK ] 0.12 sec. 2025-10-03 23:17:19 02366_explain_query_tree: [ OK ] 0.17 sec. 2025-10-03 23:17:19 01913_fix_column_transformer_replace_format: [ OK ] 0.12 sec. 2025-10-03 23:17:19 02817_structure_to_schema: [ OK ] 5.63 sec. 2025-10-03 23:17:19 02899_distributed_limit_by: [ OK ] 0.37 sec. 2025-10-03 23:17:20 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.37 sec. 2025-10-03 23:17:20 01415_table_function_view: [ OK ] 0.12 sec. 2025-10-03 23:17:20 02131_used_row_policies_in_query_log: [ OK ] 0.52 sec. 2025-10-03 23:17:20 01710_projection_detach_part: [ OK ] 0.17 sec. 2025-10-03 23:17:20 03221_merge_profile_events: [ OK ] 0.77 sec. 2025-10-03 23:17:20 01602_temporary_table_in_system_tables: [ OK ] 0.17 sec. 2025-10-03 23:17:20 02875_json_array_as_string: [ OK ] 0.12 sec. 2025-10-03 23:17:20 02842_table_function_file_filter_by_virtual_columns: [ OK ] 0.47 sec. 2025-10-03 23:17:20 02675_is_ipv6_function_fix: [ OK ] 0.12 sec. 2025-10-03 23:17:20 02682_quantiles_too_large_size: [ OK ] 0.12 sec. 2025-10-03 23:17:20 00534_functions_bad_arguments7: [ OK ] 4.43 sec. 2025-10-03 23:17:20 01924_argmax_bitmap_state: [ OK ] 0.12 sec. 2025-10-03 23:17:20 02124_comparison_betwwen_decimal_and_float: [ OK ] 0.22 sec. 2025-10-03 23:17:21 03003_enum_and_string_compatible: [ OK ] 0.12 sec. 2025-10-03 23:17:21 00652_mergetree_mutations: [ OK ] 4.13 sec. 2025-10-03 23:17:21 02495_parser_string_binary_literal: [ OK ] 0.77 sec. 2025-10-03 23:17:21 00307_format_xml: [ OK ] 0.12 sec. 2025-10-03 23:17:21 00908_long_http_insert: [ OK ] 0.77 sec. 2025-10-03 23:17:21 00653_monotonic_integer_cast: [ OK ] 0.12 sec. 2025-10-03 23:17:21 02302_lc_nullable_string_insert_as_number: [ OK ] 0.17 sec. 2025-10-03 23:17:22 02710_date_diff_aliases: [ OK ] 0.18 sec. 2025-10-03 23:17:22 02900_buffer_table_alter_race: [ OK ] 6.28 sec. 2025-10-03 23:17:22 03011_adaptative_timeout_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:17:22 02534_keyed_siphash: [ OK ] 1.32 sec. 2025-10-03 23:17:22 02206_format_override: [ OK ] 0.77 sec. 2025-10-03 23:17:22 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.22 sec. 2025-10-03 23:17:22 00530_arrays_of_nothing: [ OK ] 0.17 sec. 2025-10-03 23:17:22 01455_optimize_trivial_insert_select: [ OK ] 0.22 sec. 2025-10-03 23:17:22 01339_client_unrecognized_option: [ OK ] 0.52 sec. 2025-10-03 23:17:22 02787_transform_null: [ OK ] 0.17 sec. 2025-10-03 23:17:23 02724_jit_logical_functions: [ OK ] 0.17 sec. 2025-10-03 23:17:23 03034_recursive_cte_tree_merge_tree: [ OK ] 0.32 sec. 2025-10-03 23:17:23 03036_dynamic_read_shared_subcolumns_wide_merge_tree: [ OK ] 4.95 sec. 2025-10-03 23:17:23 02344_describe_cache: [ OK ] 0.67 sec. 2025-10-03 23:17:24 01640_distributed_async_insert_compression: [ OK ] 1.27 sec. 2025-10-03 23:17:24 01560_ttl_remove_empty_parts: [ OK ] 3.78 sec. 2025-10-03 23:17:24 00717_default_join_type: [ OK ] 0.17 sec. 2025-10-03 23:17:25 02907_backup_restore_flatten_nested: [ OK ] 2.52 sec. 2025-10-03 23:17:25 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.17 sec. 2025-10-03 23:17:25 03018_analyzer_greater_null: [ OK ] 0.12 sec. 2025-10-03 23:17:25 00845_join_on_aliases: [ OK ] 0.18 sec. 2025-10-03 23:17:25 00615_nullable_alter_optimize: [ OK ] 0.22 sec. 2025-10-03 23:17:26 01505_pipeline_executor_UAF: [ OK ] 4.73 sec. 2025-10-03 23:17:26 00107_totals_after_having: [ OK ] 1.07 sec. 2025-10-03 23:17:26 01634_summap_nullable: [ OK ] 0.17 sec. 2025-10-03 23:17:26 01374_if_nullable_filimonov: [ OK ] 0.17 sec. 2025-10-03 23:17:26 01939_network_receive_bytes_metrics: [ OK ] 0.97 sec. 2025-10-03 23:17:26 00700_decimal_formats: [ OK ] 0.33 sec. 2025-10-03 23:17:26 01509_parallel_quorum_and_merge_long: [ OK ] 3.28 sec. 2025-10-03 23:17:26 02981_translate_fixedstring: [ OK ] 0.18 sec. 2025-10-03 23:17:26 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.23 sec. 2025-10-03 23:17:26 01891_partition_hash: [ OK ] 0.22 sec. 2025-10-03 23:17:27 01710_projection_group_by_order_by: [ OK ] 0.12 sec. 2025-10-03 23:17:27 01074_partial_revokes: [ OK ] 0.37 sec. 2025-10-03 23:17:27 01652_ttl_old_syntax: [ OK ] 0.18 sec. 2025-10-03 23:17:27 03061_analyzer_alias_as_right_key_in_join: [ OK ] 0.19 sec. 2025-10-03 23:17:28 03131_hilbert_coding: [ OK ] 1.63 sec. 2025-10-03 23:17:28 00535_parse_float_scientific: [ OK ] 1.58 sec. 2025-10-03 23:17:28 02911_backup_restore_keeper_map: [ OK ] 6.79 sec. 2025-10-03 23:17:29 00903_array_with_constant_function: [ OK ] 0.17 sec. 2025-10-03 23:17:29 03164_analyzer_rewrite_aggregate_function_with_if: [ OK ] 0.22 sec. 2025-10-03 23:17:29 00516_modulo: [ OK ] 0.27 sec. 2025-10-03 23:17:29 00900_orc_arrow_parquet_maps: [ OK ] 2.13 sec. 2025-10-03 23:17:29 00586_removing_unused_columns_from_subquery: [ OK ] 0.22 sec. 2025-10-03 23:17:29 02890_named_tuple_functions: [ OK ] 0.32 sec. 2025-10-03 23:17:29 02377_modify_column_from_nested: [ OK ] 0.22 sec. 2025-10-03 23:17:29 01506_buffer_table_alter_block_structure: [ OK ] 0.22 sec. 2025-10-03 23:17:29 02007_test_any_all_operators: [ OK ] 0.33 sec. 2025-10-03 23:17:29 02883_read_in_reverse_order_virtual_column: [ OK ] 0.42 sec. 2025-10-03 23:17:29 00225_join_duplicate_columns: [ OK ] 0.17 sec. 2025-10-03 23:17:29 02740_hashed_dictionary_load_factor_smoke: [ OK ] 0.43 sec. 2025-10-03 23:17:30 00039_inserts_through_http: [ OK ] 0.83 sec. 2025-10-03 23:17:30 01644_distributed_async_insert_fsync_smoke: [ OK ] 0.32 sec. 2025-10-03 23:17:30 02246_flatten_tuple: [ OK ] 0.23 sec. 2025-10-03 23:17:30 02576_predicate_push_down_sorting_fix: [ OK ] 0.13 sec. 2025-10-03 23:17:30 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.37 sec. 2025-10-03 23:17:30 01112_check_table_with_index: [ OK ] 0.18 sec. 2025-10-03 23:17:30 01658_test_base64Encode_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:17:30 01424_parse_date_time_bad_date: [ OK ] 0.17 sec. 2025-10-03 23:17:30 01116_cross_count_asterisks: [ OK ] 0.14 sec. 2025-10-03 23:17:30 01161_information_schema: [ OK ] 0.42 sec. 2025-10-03 23:17:30 02384_decrypt_bad_arguments: [ OK ] 0.17 sec. 2025-10-03 23:17:31 01172_transaction_counters: [ OK ] 0.62 sec. 2025-10-03 23:17:31 02963_remote_read_small_buffer_size_bug: [ OK ] 4.85 sec. 2025-10-03 23:17:31 01773_datetime64_add_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:17:31 02896_cyclic_aliases_crash: [ OK ] 0.22 sec. 2025-10-03 23:17:31 01051_scalar_optimization: [ OK ] 0.17 sec. 2025-10-03 23:17:32 01080_engine_merge_prewhere_tupleelement_error: [ OK ] 0.17 sec. 2025-10-03 23:17:32 00966_invalid_json_must_not_parse: [ OK ] 0.22 sec. 2025-10-03 23:17:32 01825_new_type_json_12: [ OK ] 1.53 sec. 2025-10-03 23:17:32 02124_uncompressed_cache: [ OK ] 0.17 sec. 2025-10-03 23:17:32 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 1.73 sec. 2025-10-03 23:17:32 01840_tupleElement_formatting_fuzzer: [ OK ] 0.17 sec. 2025-10-03 23:17:32 00158_buffer_and_nonexistent_table: [ OK ] 0.17 sec. 2025-10-03 23:17:32 02357_file_default_value: [ OK ] 0.17 sec. 2025-10-03 23:17:32 01691_DateTime64_clamp: [ OK ] 0.22 sec. 2025-10-03 23:17:32 02844_distributed_virtual_columns: [ OK ] 0.23 sec. 2025-10-03 23:17:32 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.22 sec. 2025-10-03 23:17:32 02480_tlp_nan: [ OK ] 0.17 sec. 2025-10-03 23:17:33 03001_insert_threads_deduplication: [ OK ] 0.27 sec. 2025-10-03 23:17:33 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 0.42 sec. 2025-10-03 23:17:33 03170_float_schema_inference_small_block: [ OK ] 1.18 sec. 2025-10-03 23:17:33 02981_variant_type_function: [ OK ] 0.28 sec. 2025-10-03 23:17:33 01456_low_cardinality_sorting_bugfix: [ OK ] 0.28 sec. 2025-10-03 23:17:33 02226_in_untuple_issue_34810: [ OK ] 0.23 sec. 2025-10-03 23:17:33 02560_vertical_merge_memory_usage: [ OK ] 1.44 sec. 2025-10-03 23:17:34 02021_exponential_sum_shard: [ OK ] 1.02 sec. 2025-10-03 23:17:34 00444_join_use_nulls: [ OK ] 0.23 sec. 2025-10-03 23:17:34 02872_gcd_codec: [ OK ] 0.53 sec. 2025-10-03 23:17:34 02833_starts_ends_with_utf8: [ OK ] 0.22 sec. 2025-10-03 23:17:34 02889_print_pretty_type_names: [ OK ] 0.22 sec. 2025-10-03 23:17:34 00337_shard_any_heavy: [ OK ] 0.17 sec. 2025-10-03 23:17:34 02764_csv_trim_whitespaces: [ OK ] 11.17 sec. 2025-10-03 23:17:34 01281_alter_rename_and_other_renames: [ OK ] 0.32 sec. 2025-10-03 23:17:34 00202_cross_join: [ OK ] 0.17 sec. 2025-10-03 23:17:34 00647_histogram_negative: [ OK ] 0.17 sec. 2025-10-03 23:17:34 01273_lc_fixed_string_field: [ OK ] 0.17 sec. 2025-10-03 23:17:35 02842_capn_proto_outfile_without_schema: [ OK ] 0.43 sec. 2025-10-03 23:17:35 03042_not_found_column_c1: [ OK ] 0.18 sec. 2025-10-03 23:17:35 01428_h3_range_check: [ OK ] 0.17 sec. 2025-10-03 23:17:35 02366_direct_dictionary_dict_has: [ OK ] 0.22 sec. 2025-10-03 23:17:35 01447_json_strings: [ OK ] 0.18 sec. 2025-10-03 23:17:35 00137_in_constants: [ OK ] 0.32 sec. 2025-10-03 23:17:36 01318_alter_add_constraint_format: [ OK ] 0.42 sec. 2025-10-03 23:17:36 01019_alter_materialized_view_query: [ OK ] 0.23 sec. 2025-10-03 23:17:36 01133_begin_commit_race: [ OK ] 20.59 sec. 2025-10-03 23:17:37 00900_orc_nested_arrays_load: [ OK ] 1.02 sec. 2025-10-03 23:17:37 01746_long_zstd_http_compression_json_format: [ OK ] 2.08 sec. 2025-10-03 23:17:38 02989_variant_comparison: [ OK ] 0.37 sec. 2025-10-03 23:17:38 01278_random_string_utf8: [ OK ] 0.17 sec. 2025-10-03 23:17:38 03168_read_in_order_buffering_1: [ OK ] 0.27 sec. 2025-10-03 23:17:38 02446_parent_zero_copy_locks: [ OK ] 4.89 sec. 2025-10-03 23:17:39 00837_minmax_index_replicated_zookeeper_long: [ OK ] 0.62 sec. 2025-10-03 23:17:39 02113_untuple_func_alias: [ OK ] 0.12 sec. 2025-10-03 23:17:39 02375_stack_trace_no_addresses: [ OK ] 0.73 sec. 2025-10-03 23:17:39 01051_aggregate_function_crash: [ OK ] 0.12 sec. 2025-10-03 23:17:40 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 2.83 sec. 2025-10-03 23:17:40 02903_empty_order_by_throws_error: [ OK ] 0.57 sec. 2025-10-03 23:17:40 01773_min_max_time_system_parts_datetime64: [ OK ] 0.17 sec. 2025-10-03 23:17:42 00385_storage_file_and_clickhouse-local_app_long: [ OK ] 6.35 sec. 2025-10-03 23:17:43 03008_deduplication_wrong_mv: [ OK ] 0.22 sec. 2025-10-03 23:17:43 00068_empty_tiny_log: [ OK ] 0.12 sec. 2025-10-03 23:17:43 02711_server_uuid_macro: [ OK ] 0.23 sec. 2025-10-03 23:17:43 02915_analyzer_fuzz_1: [ OK ] 0.12 sec. 2025-10-03 23:17:43 00539_functions_for_working_with_json: [ OK ] 0.17 sec. 2025-10-03 23:17:43 01459_decimal_casts: [ OK ] 0.22 sec. 2025-10-03 23:17:44 03169_optimize_injective_functions_inside_uniq_crash: [ OK ] 0.17 sec. 2025-10-03 23:17:45 00980_alter_settings_race: [ OK ] 4.84 sec. 2025-10-03 23:17:45 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 1.28 sec. 2025-10-03 23:17:45 00015_totals_having_constants: [ OK ] 0.17 sec. 2025-10-03 23:17:45 01054_cache_dictionary_bunch_update: [ OK ] 10.88 sec. 2025-10-03 23:17:45 01315_count_distinct_return_not_nullable: [ OK ] 0.22 sec. 2025-10-03 23:17:46 02699_polygons_sym_difference_total: [ OK ] 0.18 sec. 2025-10-03 23:17:46 02680_lc_null_as_default: [ OK ] 0.18 sec. 2025-10-03 23:17:46 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.17 sec. 2025-10-03 23:17:46 02841_parallel_replicas_summary: [ OK ] 1.08 sec. 2025-10-03 23:17:46 00915_simple_aggregate_function: [ OK ] 0.32 sec. 2025-10-03 23:17:46 03172_dynamic_binary_serialization: [ OK ] 7.11 sec. 2025-10-03 23:17:46 01811_filter_by_null: [ OK ] 0.17 sec. 2025-10-03 23:17:46 01300_wkt: [ OK ] 0.27 sec. 2025-10-03 23:17:46 02477_fuse_quantiles: [ OK ] 0.17 sec. 2025-10-03 23:17:46 01705_normalize_case_insensitive_function_names: [ OK ] 0.12 sec. 2025-10-03 23:17:46 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:17:47 00952_part_frozen_info: [ OK ] 0.22 sec. 2025-10-03 23:17:47 01505_trivial_count_with_partition_predicate: [ OK ] 0.27 sec. 2025-10-03 23:17:47 01761_alter_decimal_zookeeper_long: [ OK ] 0.27 sec. 2025-10-03 23:17:47 01655_plan_optimizations_merge_filters: [ OK ] 0.17 sec. 2025-10-03 23:17:47 00529_orantius: [ OK ] 0.23 sec. 2025-10-03 23:17:47 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.27 sec. 2025-10-03 23:17:47 01431_utf8_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:17:47 02785_left_anti_join_bug: [ OK ] 0.17 sec. 2025-10-03 23:17:47 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.17 sec. 2025-10-03 23:17:48 00607_index_in_in: [ OK ] 0.17 sec. 2025-10-03 23:17:48 01010_pm_join_all_join_bug: [ OK ] 0.22 sec. 2025-10-03 23:17:48 02968_url_args: [ OK ] 0.17 sec. 2025-10-03 23:17:48 02128_hex_bin_on_uuid: [ OK ] 0.17 sec. 2025-10-03 23:17:48 02131_skip_index_not_materialized: [ OK ] 0.17 sec. 2025-10-03 23:17:48 02245_s3_support_read_nested_column: [ OK ] 0.37 sec. 2025-10-03 23:17:48 02500_prevent_drop_nested_if_empty_part: [ OK ] 0.22 sec. 2025-10-03 23:17:49 00963_startsWith_force_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:17:49 00660_optimize_final_without_partition: [ OK ] 0.17 sec. 2025-10-03 23:17:49 01579_date_datetime_index_comparison: [ OK ] 0.17 sec. 2025-10-03 23:17:49 02183_dictionary_date_types: [ OK ] 0.47 sec. 2025-10-03 23:17:49 03008_deduplication_random_setttings: [ OK ] 1.33 sec. 2025-10-03 23:17:50 02705_projection_and_ast_optimizations_bug: [ OK ] 0.17 sec. 2025-10-03 23:17:50 01710_query_log_with_projection_info: [ OK ] 0.62 sec. 2025-10-03 23:17:50 02001_select_with_filter: [ OK ] 0.17 sec. 2025-10-03 23:17:50 01663_quantile_weighted_overflow: [ OK ] 0.12 sec. 2025-10-03 23:17:51 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 1.12 sec. 2025-10-03 23:17:52 03142_untuple_crash: [ OK ] 0.12 sec. 2025-10-03 23:17:52 02134_async_inserts_formats: [ OK ] 5.84 sec. 2025-10-03 23:17:52 02457_datediff_via_unix_epoch: [ OK ] 0.17 sec. 2025-10-03 23:17:52 02833_std_alias: [ OK ] 0.18 sec. 2025-10-03 23:17:54 02967_parallel_replicas_join_algo_and_analyzer_3: [ OK ] 4.20 sec. 2025-10-03 23:17:54 02553_type_json_attach_partition: [ OK ] 0.17 sec. 2025-10-03 23:17:54 01050_engine_join_crash: [ OK ] 0.27 sec. 2025-10-03 23:17:54 02047_log_family_complex_structs_data_file_dumps: [ OK ] 2.59 sec. 2025-10-03 23:17:55 02514_tsv_zero_started_number: [ OK ] 0.12 sec. 2025-10-03 23:17:55 02690_subquery_identifiers: [ OK ] 0.17 sec. 2025-10-03 23:17:55 00626_replace_partition_from_table_zookeeper: [ OK ] 14.47 sec. 2025-10-03 23:17:55 01056_negative_with_bloom_filter: [ OK ] 0.17 sec. 2025-10-03 23:17:55 02886_missed_json_subcolumns: [ OK ] 0.22 sec. 2025-10-03 23:17:55 02416_grouping_function_compatibility: [ OK ] 0.17 sec. 2025-10-03 23:17:55 03165_storage_merge_view_prewhere: [ OK ] 0.17 sec. 2025-10-03 23:17:56 01854_s2_cap_contains: [ OK ] 0.17 sec. 2025-10-03 23:17:56 01825_new_type_json_nbagames: [ OK ] 3.74 sec. 2025-10-03 23:17:56 01560_monotonicity_check_multiple_args_bug: [ OK ] 0.12 sec. 2025-10-03 23:17:56 00712_prewhere_with_final: [ OK ] 0.17 sec. 2025-10-03 23:17:56 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.12 sec. 2025-10-03 23:17:56 01825_new_type_json_parallel_insert: [ OK ] 0.27 sec. 2025-10-03 23:17:56 03456_match_index_prefix_extraction: [ OK ] 0.42 sec. 2025-10-03 23:17:56 01698_fix_toMinute: [ OK ] 0.22 sec. 2025-10-03 23:17:56 01832_memory_write_suffix: [ OK ] 0.12 sec. 2025-10-03 23:17:57 02133_issue_32458: [ OK ] 0.17 sec. 2025-10-03 23:17:57 03215_parsing_archive_name_s3: [ OK ] 0.22 sec. 2025-10-03 23:17:57 02206_minimum_sample_size: [ OK ] 0.22 sec. 2025-10-03 23:17:57 02935_ipv6_bit_operations: [ OK ] 0.12 sec. 2025-10-03 23:17:57 02513_validate_data_types: [ OK ] 0.22 sec. 2025-10-03 23:17:57 01010_partial_merge_join_const_and_lc: [ OK ] 0.17 sec. 2025-10-03 23:17:57 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.17 sec. 2025-10-03 23:17:57 02343_group_by_use_nulls_distributed: [ OK ] 0.27 sec. 2025-10-03 23:17:58 02029_test_implemented_methods: [ OK ] 0.32 sec. 2025-10-03 23:17:58 01446_json_strings_each_row: [ OK ] 3.08 sec. 2025-10-03 23:17:58 03217_json_merge_patch_stack_overflow: [ OK ] 0.22 sec. 2025-10-03 23:17:58 01451_replicated_detach_drop_part_long: [ OK ] 0.32 sec. 2025-10-03 23:17:58 02935_format_with_arbitrary_types: [ OK ] 0.37 sec. 2025-10-03 23:17:59 01064_window_view_event_hop_to_bounded: [ OK ] 1.03 sec. 2025-10-03 23:17:59 03101_analyzer_identifiers_2: [ OK ] 0.27 sec. 2025-10-03 23:17:59 00373_group_by_tuple: [ OK ] 0.12 sec. 2025-10-03 23:17:59 02552_inner_join_with_where_true: [ OK ] 0.17 sec. 2025-10-03 23:17:59 02832_transform_fixed_string_no_default: [ OK ] 0.17 sec. 2025-10-03 23:17:59 01413_truncate_without_table_keyword: [ OK ] 0.17 sec. 2025-10-03 23:17:59 00584_view_union_all: [ OK ] 0.17 sec. 2025-10-03 23:17:59 02902_topKGeneric_deserialization_memory: [ OK ] 0.17 sec. 2025-10-03 23:17:59 02516_join_with_totals_and_subquery_bug: [ OK ] 0.22 sec. 2025-10-03 23:17:59 00317_in_tuples_and_out_of_range_values: [ OK ] 0.12 sec. 2025-10-03 23:18:00 00557_alter_null_storage_tables: [ OK ] 0.12 sec. 2025-10-03 23:18:00 02047_log_family_data_file_sizes: [ OK ] 2.43 sec. 2025-10-03 23:18:00 01291_aggregation_in_order: [ OK ] 0.27 sec. 2025-10-03 23:18:00 01945_show_debug_warning: [ OK ] 0.82 sec. 2025-10-03 23:18:00 01758_optimize_skip_unused_shards_once: [ OK ] 0.52 sec. 2025-10-03 23:18:01 02212_h3_get_pentagon_indexes: [ OK ] 0.22 sec. 2025-10-03 23:18:01 01340_datetime64_fpe: [ OK ] 0.37 sec. 2025-10-03 23:18:01 02737_session_timezone: [ OK ] 0.27 sec. 2025-10-03 23:18:01 02428_batch_nullable_assert: [ OK ] 0.12 sec. 2025-10-03 23:18:01 02419_keeper_map_primary_key: [ OK ] 0.77 sec. 2025-10-03 23:18:01 02155_dictionary_comment: [ OK ] 0.22 sec. 2025-10-03 23:18:02 03093_with_fill_support_constant_expression: [ OK ] 0.12 sec. 2025-10-03 23:18:02 00820_multiple_joins: [ OK ] 0.27 sec. 2025-10-03 23:18:02 00847_multiple_join_same_column: [ OK ] 0.22 sec. 2025-10-03 23:18:02 00600_create_temporary_table_if_not_exists: [ OK ] 0.12 sec. 2025-10-03 23:18:02 02984_topk_empty_merge: [ OK ] 0.17 sec. 2025-10-03 23:18:02 02287_legacy_column_name_of_tuple_literal_over_distributed: [ OK ] 0.12 sec. 2025-10-03 23:18:02 01456_modify_column_type_via_add_drop_update: [ OK ] 0.47 sec. 2025-10-03 23:18:02 02388_conversion_from_string_with_datetime64_to_date_and_date32: [ OK ] 0.22 sec. 2025-10-03 23:18:02 02311_normalize_utf8_constant: [ OK ] 0.12 sec. 2025-10-03 23:18:02 01881_aggregate_functions_versioning: [ OK ] 0.12 sec. 2025-10-03 23:18:03 02559_nested_multiple_levels_default: [ OK ] 0.17 sec. 2025-10-03 23:18:03 01925_map_populate_series_on_map: [ OK ] 0.27 sec. 2025-10-03 23:18:03 02932_idna: [ OK ] 0.62 sec. 2025-10-03 23:18:03 02048_alter_command_format: [ OK ] 0.32 sec. 2025-10-03 23:18:03 02498_random_string_in_json_schema_inference: [ OK ] 0.42 sec. 2025-10-03 23:18:04 01564_test_hint_woes: [ OK ] 0.22 sec. 2025-10-03 23:18:04 02020_alter_table_modify_comment: [ OK ] 9.10 sec. 2025-10-03 23:18:04 01818_move_partition_simple: [ OK ] 0.22 sec. 2025-10-03 23:18:04 03196_max_intersections_arena_crash: [ OK ] 0.12 sec. 2025-10-03 23:18:04 03213_rand_dos: [ OK ] 0.17 sec. 2025-10-03 23:18:04 02126_alter_table_alter_column: [ OK ] 0.12 sec. 2025-10-03 23:18:04 01561_clickhouse_client_stage: [ OK ] 0.82 sec. 2025-10-03 23:18:04 01299_alter_merge_tree: [ OK ] 0.17 sec. 2025-10-03 23:18:04 02285_hex_bin_support_more_types: [ OK ] 0.22 sec. 2025-10-03 23:18:04 01593_insert_settings: [ OK ] 0.22 sec. 2025-10-03 23:18:05 02834_sparse_columns_sort_with_limit: [ OK ] 0.17 sec. 2025-10-03 23:18:05 02477_age_date32: [ OK ] 0.37 sec. 2025-10-03 23:18:05 01316_create_user_syntax_hilite: [ OK ] 0.32 sec. 2025-10-03 23:18:05 03001_data_version_column: [ OK ] 0.17 sec. 2025-10-03 23:18:05 02096_sample_by_tuple: [ OK ] 0.12 sec. 2025-10-03 23:18:05 00834_kill_mutation_replicated_zookeeper: [ OK ] 35.13 sec. 2025-10-03 23:18:05 03033_cte_numbers_memory: [ OK ] 0.12 sec. 2025-10-03 23:18:05 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.12 sec. 2025-10-03 23:18:05 00622_select_in_parens: [ OK ] 0.12 sec. 2025-10-03 23:18:05 02264_format_insert_compression: [ OK ] 0.12 sec. 2025-10-03 23:18:06 01883_subcolumns_distributed: [ OK ] 0.22 sec. 2025-10-03 23:18:06 02752_is_null_priority: [ OK ] 0.12 sec. 2025-10-03 23:18:06 02675_sparse_columns_clear_column: [ OK ] 0.57 sec. 2025-10-03 23:18:06 03039_unknown_identifier_window_function: [ OK ] 0.12 sec. 2025-10-03 23:18:07 00310_tskv: [ OK ] 0.72 sec. 2025-10-03 23:18:07 02255_broken_parts_chain_on_start: [ OK ] 2.07 sec. 2025-10-03 23:18:07 00814_replicated_minimalistic_part_header_zookeeper: [ OK ] 2.12 sec. 2025-10-03 23:18:07 01034_unknown_qualified_column_in_join: [ OK ] 0.17 sec. 2025-10-03 23:18:07 00007_array: [ OK ] 0.12 sec. 2025-10-03 23:18:07 02506_date_time64_floating_point_negative_value: [ OK ] 0.12 sec. 2025-10-03 23:18:07 00779_all_right_join_max_block_size: [ OK ] 0.12 sec. 2025-10-03 23:18:07 03153_dynamic_type_empty: [ OK ] 0.17 sec. 2025-10-03 23:18:07 02698_marked_dropped_tables: [ OK ] 0.17 sec. 2025-10-03 23:18:08 02933_group_by_memory_usage: [ OK ] 0.97 sec. 2025-10-03 23:18:08 01406_carriage_return_in_tsv_csv: [ OK ] 0.97 sec. 2025-10-03 23:18:08 02538_alter_rename_sequence: [ OK ] 0.37 sec. 2025-10-03 23:18:09 02581_width_bucket: [ OK ] 0.37 sec. 2025-10-03 23:18:09 01087_window_view_alter_query: [ OK ] 1.47 sec. 2025-10-03 23:18:09 02394_every_profile_event_must_have_documentation: [ OK ] 0.12 sec. 2025-10-03 23:18:09 01699_timezoneOffset: [ OK ] 0.27 sec. 2025-10-03 23:18:09 02354_read_in_order_prewhere: [ OK ] 0.52 sec. 2025-10-03 23:18:09 02867_null_lc_in_bug: [ OK ] 0.22 sec. 2025-10-03 23:18:10 02899_indexing_by_space_filling_curves: [ OK ] 0.37 sec. 2025-10-03 23:18:10 02136_scalar_read_rows_json: [ OK ] 0.52 sec. 2025-10-03 23:18:10 03250_avoid_prefetch_empty_parts: [ OK ] 0.22 sec. 2025-10-03 23:18:10 01550_type_map_formats: [ OK ] 0.22 sec. 2025-10-03 23:18:10 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.12 sec. 2025-10-03 23:18:10 03232_pr_not_ready_set: [ OK ] 0.17 sec. 2025-10-03 23:18:11 03290_dictionary_assert_on_function: [ OK ] 0.12 sec. 2025-10-03 23:18:11 01634_sum_map_nulls: [ OK ] 0.17 sec. 2025-10-03 23:18:11 01622_defaults_for_url_engine: [ OK ] 0.42 sec. 2025-10-03 23:18:11 02184_nested_tuple: [ OK ] 0.17 sec. 2025-10-03 23:18:12 00029_test_zookeeper_optimize_exception: [ OK ] 1.67 sec. 2025-10-03 23:18:12 03049_analyzer_group_by_alias: [ OK ] 0.12 sec. 2025-10-03 23:18:12 02844_tsv_carriage_return_parallel_parsing: [ OK ] 0.52 sec. 2025-10-03 23:18:12 02515_aggregate_functions_statistics: [ OK ] 0.27 sec. 2025-10-03 23:18:12 00065_shard_float_literals_formatting: [ OK ] 0.12 sec. 2025-10-03 23:18:12 02114_offset_fetch_without_order_by: [ OK ] 0.32 sec. 2025-10-03 23:18:13 02751_text_formats_bad_nullable_parsing: [ OK ] 1.07 sec. 2025-10-03 23:18:13 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.12 sec. 2025-10-03 23:18:14 02296_nullable_arguments_in_array_filter: [ OK ] 0.12 sec. 2025-10-03 23:18:14 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.12 sec. 2025-10-03 23:18:14 00020_sorting_arrays: [ OK ] 0.12 sec. 2025-10-03 23:18:14 02538_nullable_array_tuple_timeseries: [ OK ] 0.12 sec. 2025-10-03 23:18:14 00204_extract_url_parameter: [ OK ] 0.12 sec. 2025-10-03 23:18:14 02041_conversion_between_date32_and_datetime64: [ OK ] 0.12 sec. 2025-10-03 23:18:14 03006_buffer_overflow_join: [ OK ] 0.17 sec. 2025-10-03 23:18:15 02922_deduplication_with_zero_copy: [ OK ] 40.77 sec. 2025-10-03 23:18:15 01603_decimal_mult_float: [ OK ] 0.22 sec. 2025-10-03 23:18:15 02811_parallel_replicas_prewhere_count: [ OK ] 0.17 sec. 2025-10-03 23:18:15 01511_alter_version_versioned_collapsing_merge_tree_zookeeper: [ OK ] 0.37 sec. 2025-10-03 23:18:15 02116_clickhouse_stderr: [ OK ] 0.72 sec. 2025-10-03 23:18:16 02165_auto_format_by_file_extension: [ OK ] 3.33 sec. 2025-10-03 23:18:16 00257_shard_no_aggregates_and_constant_keys: [ OK ] 0.27 sec. 2025-10-03 23:18:16 00849_multiple_comma_join_2: [ OK ] 0.42 sec. 2025-10-03 23:18:16 02269_insert_select_with_format_without_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:18:16 01557_max_parallel_replicas_no_sample: [ OK ] 0.22 sec. 2025-10-03 23:18:16 01419_materialize_null: [ OK ] 0.12 sec. 2025-10-03 23:18:16 02315_pmj_union_ubsan_35857: [ OK ] 0.12 sec. 2025-10-03 23:18:16 00957_neighbor: [ OK ] 0.27 sec. 2025-10-03 23:18:16 01526_alter_add_and_modify_order_zookeeper: [ OK ] 0.27 sec. 2025-10-03 23:18:16 00370_duplicate_columns_in_subqueries: [ OK ] 0.17 sec. 2025-10-03 23:18:16 03127_argMin_combinator_state: [ OK ] 0.17 sec. 2025-10-03 23:18:16 03032_scalars_create_as_select: [ OK ] 0.12 sec. 2025-10-03 23:18:16 02766_bitshift_with_const_arguments: [ OK ] 0.22 sec. 2025-10-03 23:18:17 03278_revoke_implicit_grants: [ OK ] 0.67 sec. 2025-10-03 23:18:18 00976_system_stop_ttl_merges: [ OK ] 1.17 sec. 2025-10-03 23:18:18 00965_shard_unresolvable_addresses: [ OK ] 32.15 sec. 2025-10-03 23:18:18 02710_protobuf_ipv4_date32: [ OK ] 0.52 sec. 2025-10-03 23:18:18 01341_datetime64_wrong_supertype: [ OK ] 0.12 sec. 2025-10-03 23:18:18 03229_empty_tuple_in_array: [ OK ] 0.12 sec. 2025-10-03 23:18:19 00531_aggregate_over_nullable: [ OK ] 0.17 sec. 2025-10-03 23:18:19 02096_date_time_1970_saturation2: [ OK ] 0.27 sec. 2025-10-03 23:18:19 02237_lzma_bug: [ OK ] 1.97 sec. 2025-10-03 23:18:19 00961_checksums_in_system_parts_columns_table: [ OK ] 0.12 sec. 2025-10-03 23:18:19 01080_window_view_inner_table_memory_hop: [ OK ] 0.97 sec. 2025-10-03 23:18:19 03039_recursive_cte_postgres_5: [ OK ] 0.22 sec. 2025-10-03 23:18:20 02765_queries_with_subqueries_profile_events: [ OK ] 3.48 sec. 2025-10-03 23:18:20 02481_parquet_int_list_multiple_chunks: [ OK ] 0.87 sec. 2025-10-03 23:18:20 02122_parallel_formatting_RowBinaryWithNamesAndTypes: [ OK ] 0.97 sec. 2025-10-03 23:18:20 01825_type_json_in_array: [ OK ] 0.27 sec. 2025-10-03 23:18:20 03155_analyzer_interpolate: [ OK ] 0.17 sec. 2025-10-03 23:18:21 02994_inconsistent_formatting: [ OK ] 0.17 sec. 2025-10-03 23:18:21 00446_clear_column_in_partition_zookeeper_long: [ OK ] 1.68 sec. 2025-10-03 23:18:21 01881_union_header_mismatch_bug: [ OK ] 0.12 sec. 2025-10-03 23:18:21 02771_semi_join_use_nulls: [ OK ] 1.48 sec. 2025-10-03 23:18:21 01471_top_k_range_check: [ OK ] 0.12 sec. 2025-10-03 23:18:21 03165_distinct_with_window_func_crash: [ OK ] 0.17 sec. 2025-10-03 23:18:21 02883_named_collections_override: [ OK ] 0.77 sec. 2025-10-03 23:18:21 02552_check_referential_table_dependencies: [ OK ] 0.17 sec. 2025-10-03 23:18:22 00472_create_view_if_not_exists: [ OK ] 0.12 sec. 2025-10-03 23:18:22 03199_merge_filters_bug: [ OK ] 0.22 sec. 2025-10-03 23:18:22 01715_table_function_view_fix: [ OK ] 0.12 sec. 2025-10-03 23:18:22 00741_client_comment_multiline: [ OK ] 0.12 sec. 2025-10-03 23:18:22 02725_object_column_alter: [ OK ] 0.17 sec. 2025-10-03 23:18:22 02375_double_escaping_json: [ OK ] 0.12 sec. 2025-10-03 23:18:22 02504_explain_ast_insert: [ OK ] 0.18 sec. 2025-10-03 23:18:22 02906_flatten_only_true_nested: [ OK ] 0.17 sec. 2025-10-03 23:18:22 00309_formats: [ OK ] 0.17 sec. 2025-10-03 23:18:22 02875_fix_column_decimal_serialization: [ OK ] 0.17 sec. 2025-10-03 23:18:22 02374_in_tuple_index: [ OK ] 0.17 sec. 2025-10-03 23:18:23 01038_array_of_unnamed_tuples: [ OK ] 0.17 sec. 2025-10-03 23:18:23 02381_arrow_dict_to_lc: [ OK ] 0.42 sec. 2025-10-03 23:18:23 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.17 sec. 2025-10-03 23:18:23 02188_table_function_format: [ OK ] 0.17 sec. 2025-10-03 23:18:23 02734_sparse_columns_mutation: [ OK ] 0.27 sec. 2025-10-03 23:18:23 02481_parquet_list_monotonically_increasing_offsets: [ OK ] 23.53 sec. 2025-10-03 23:18:23 01514_input_format_csv_enum_as_number_setting: [ OK ] 0.17 sec. 2025-10-03 23:18:24 01304_polygons_sym_difference: [ OK ] 0.17 sec. 2025-10-03 23:18:24 02112_with_fill_interval: [ OK ] 0.32 sec. 2025-10-03 23:18:24 02156_async_insert_query_log: [ OK ] 1.12 sec. 2025-10-03 23:18:24 02245_format_string_stack_overflow: [ OK ] 0.17 sec. 2025-10-03 23:18:24 01270_optimize_skip_unused_shards_low_cardinality: [ OK ] 0.17 sec. 2025-10-03 23:18:24 02016_summing_mt_aggregating_column: [ OK ] 0.17 sec. 2025-10-03 23:18:24 02751_multiquery_with_argument: [ OK ] 1.22 sec. 2025-10-03 23:18:25 02534_join_prewhere_bug: [ OK ] 0.22 sec. 2025-10-03 23:18:25 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.32 sec. 2025-10-03 23:18:26 02263_format_insert_settings: [ OK ] 1.52 sec. 2025-10-03 23:18:27 00699_materialized_view_mutations: [ OK ] 0.87 sec. 2025-10-03 23:18:27 02151_lc_prefetch: [ OK ] 2.27 sec. 2025-10-03 23:18:27 01909_mbtolou: [ OK ] 0.23 sec. 2025-10-03 23:18:29 01273_arrow_dictionaries_load: [ OK ] 2.42 sec. 2025-10-03 23:18:29 03006_analyzer_executable_table_function: [ OK ] 0.12 sec. 2025-10-03 23:18:30 02004_intersect_except_const_column: [ OK ] 0.17 sec. 2025-10-03 23:18:31 01825_new_type_json_8: [ OK ] 1.27 sec. 2025-10-03 23:18:31 02354_array_lowcardinality: [ OK ] 0.17 sec. 2025-10-03 23:18:31 01774_ip_address_in_range: [ OK ] 0.32 sec. 2025-10-03 23:18:32 02513_analyzer_sort_msan: [ OK ] 0.12 sec. 2025-10-03 23:18:32 01732_explain_syntax_union_query: [ OK ] 0.17 sec. 2025-10-03 23:18:32 00975_move_partition_merge_tree: [ OK ] 0.47 sec. 2025-10-03 23:18:33 00186_very_long_arrays: [ OK ] 1.12 sec. 2025-10-03 23:18:34 00234_disjunctive_equality_chains_optimization: [ OK ] 0.17 sec. 2025-10-03 23:18:34 02941_variant_type_4: [ OK ] 6.84 sec. 2025-10-03 23:18:34 02799_transform_empty_arrays: [ OK ] 0.12 sec. 2025-10-03 23:18:34 02711_trim_aliases: [ OK ] 0.12 sec. 2025-10-03 23:18:34 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.27 sec. 2025-10-03 23:18:34 02834_formats_with_variable_number_of_columns: [ OK ] 0.17 sec. 2025-10-03 23:18:35 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 1.12 sec. 2025-10-03 23:18:36 00534_filimonov: [ OK ] 1.27 sec. 2025-10-03 23:18:36 01780_column_sparse_alter: [ OK ] 0.22 sec. 2025-10-03 23:18:36 02813_seriesOutliersDetectTukey: [ SKIPPED ] 0.00 sec. 2025-10-03 23:18:36 Reason: not running for current build 2025-10-03 23:18:36 01654_test_writer_block_sequence: [ OK ] 15.06 sec. 2025-10-03 23:18:37 02346_fulltext_index_bug47393: [ OK ] 0.17 sec. 2025-10-03 23:18:37 02445_replicated_db_alter_partition: [ OK ] 31.00 sec. 2025-10-03 23:18:37 00634_logging_shard: [ OK ] 1.02 sec. 2025-10-03 23:18:38 02353_explain_ast_optimize: [ OK ] 0.12 sec. 2025-10-03 23:18:39 02903_rmt_retriable_merge_exception: [ OK ] 1.23 sec. 2025-10-03 23:18:39 03004_force_null_for_omitted: [ OK ] 0.27 sec. 2025-10-03 23:18:39 01513_defaults_on_defaults_no_column: [ OK ] 0.22 sec. 2025-10-03 23:18:40 00933_ttl_simple: [ OK ] 2.68 sec. 2025-10-03 23:18:40 00917_least_sqr: [ OK ] 0.17 sec. 2025-10-03 23:18:40 01580_column_const_comparision: [ OK ] 0.12 sec. 2025-10-03 23:18:40 01825_type_json_insert_select: [ OK ] 0.37 sec. 2025-10-03 23:18:40 02097_initializeAggregationNullable: [ OK ] 0.17 sec. 2025-10-03 23:18:40 02346_to_hour_monotonicity_fix: [ OK ] 0.17 sec. 2025-10-03 23:18:41 03274_udf_in_join: [ OK ] 0.47 sec. 2025-10-03 23:18:41 02021_create_database_with_comment: [ OK ] 1.22 sec. 2025-10-03 23:18:41 02165_h3_exact_edge_length_rads: [ OK ] 0.17 sec. 2025-10-03 23:18:41 01621_sort_after_join_pipeline_stuck: [ OK ] 0.17 sec. 2025-10-03 23:18:41 01252_weird_time_zone: [ OK ] 0.42 sec. 2025-10-03 23:18:42 03291_json_big_structure_deserialization: [ OK ] 7.24 sec. 2025-10-03 23:18:42 00910_crash_when_distributed_modify_order_by: [ OK ] 0.37 sec. 2025-10-03 23:18:42 02407_array_element_from_map_wrong_type: [ OK ] 0.12 sec. 2025-10-03 23:18:42 01070_string_to_h3: [ OK ] 0.12 sec. 2025-10-03 23:18:42 02564_date_format: [ OK ] 0.17 sec. 2025-10-03 23:18:42 03112_analyzer_not_found_column_in_block: [ OK ] 0.17 sec. 2025-10-03 23:18:42 02205_map_populate_series_non_const: [ OK ] 0.47 sec. 2025-10-03 23:18:42 01852_hints_enum_name: [ OK ] 0.47 sec. 2025-10-03 23:18:42 02985_parser_check_stack_size: [ OK ] 0.52 sec. 2025-10-03 23:18:42 01013_repeat_function: [ OK ] 0.17 sec. 2025-10-03 23:18:42 03247_materialized_view_select_intersect: [ OK ] 0.13 sec. 2025-10-03 23:18:42 02179_map_cast_to_array: [ OK ] 0.17 sec. 2025-10-03 23:18:42 00277_array_filter: [ OK ] 0.12 sec. 2025-10-03 23:18:43 01763_filter_push_down_bugs: [ OK ] 0.27 sec. 2025-10-03 23:18:43 02514_if_with_lazy_low_cardinality: [ OK ] 0.12 sec. 2025-10-03 23:18:43 01954_clickhouse_benchmark_multiple_long: [ OK ] 6.38 sec. 2025-10-03 23:18:43 00718_format_datetime_1: [ OK ] 0.12 sec. 2025-10-03 23:18:43 01087_index_set_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:18:43 01872_initial_query_start_time: [ OK ] 0.92 sec. 2025-10-03 23:18:44 02963_single_value_destructor: [ OK ] 0.22 sec. 2025-10-03 23:18:44 01602_insert_into_table_function_cluster: [ OK ] 0.22 sec. 2025-10-03 23:18:44 02210_processors_profile_log: [ OK ] 1.32 sec. 2025-10-03 23:18:44 01068_window_view_event_tumble_to_bounded_lateness: [ OK ] 1.02 sec. 2025-10-03 23:18:44 01389_filter_by_virtual_columns: [ OK ] 0.12 sec. 2025-10-03 23:18:44 00502_custom_partitioning_local: [ OK ] 0.52 sec. 2025-10-03 23:18:44 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.12 sec. 2025-10-03 23:18:44 02703_max_local_read_bandwidth: [ OK ] 23.93 sec. 2025-10-03 23:18:44 02494_array_function_range: [ OK ] 0.17 sec. 2025-10-03 23:18:44 00152_totals_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:18:44 01735_join_get_low_card_fix: [ OK ] 0.17 sec. 2025-10-03 23:18:44 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.22 sec. 2025-10-03 23:18:44 02797_range_nullable: [ OK ] 0.22 sec. 2025-10-03 23:18:44 03131_deprecated_functions: [ OK ] 0.17 sec. 2025-10-03 23:18:44 02345_filesystem_local: [ OK ] 0.37 sec. 2025-10-03 23:18:44 01138_join_on_distributed_and_tmp: [ OK ] 0.17 sec. 2025-10-03 23:18:45 02244_ip_address_invalid_insert: [ OK ] 0.32 sec. 2025-10-03 23:18:45 01786_group_by_pk_many_streams: [ OK ] 0.27 sec. 2025-10-03 23:18:45 02815_range_dict_no_direct_join: [ OK ] 0.22 sec. 2025-10-03 23:18:45 02982_dont_infer_exponent_floats: [ OK ] 0.12 sec. 2025-10-03 23:18:45 01507_transform_null_in: [ OK ] 0.17 sec. 2025-10-03 23:18:45 01324_insert_tsv_raw: [ OK ] 0.17 sec. 2025-10-03 23:18:45 02521_analyzer_aggregation_without_column: [ OK ] 0.12 sec. 2025-10-03 23:18:45 01115_prewhere_array_join: [ OK ] 0.52 sec. 2025-10-03 23:18:45 03312_issue_74299: [ OK ] 0.17 sec. 2025-10-03 23:18:45 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.27 sec. 2025-10-03 23:18:45 00518_extract_all_and_empty_matches: [ OK ] 0.12 sec. 2025-10-03 23:18:45 01361_buffer_table_flush_with_materialized_view: [ OK ] 0.22 sec. 2025-10-03 23:18:46 02990_format_lambdas: [ OK ] 0.57 sec. 2025-10-03 23:18:46 01318_map_populate_series: [ OK ] 0.27 sec. 2025-10-03 23:18:46 01947_multiple_pipe_read: [ OK ] 0.82 sec. 2025-10-03 23:18:46 03070_analyzer_CTE_scalar_as_numbers: [ OK ] 0.12 sec. 2025-10-03 23:18:46 02403_ttl_column_multiple_times: [ OK ] 0.17 sec. 2025-10-03 23:18:46 00938_ipv6_cidr_range: [ OK ] 0.22 sec. 2025-10-03 23:18:46 00647_select_numbers_with_offset: [ OK ] 0.12 sec. 2025-10-03 23:18:47 02695_storage_join_insert_select_deadlock: [ OK ] 0.17 sec. 2025-10-03 23:18:47 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.17 sec. 2025-10-03 23:18:47 00396_uuid: [ OK ] 0.17 sec. 2025-10-03 23:18:47 00906_low_cardinality_cache: [ OK ] 2.38 sec. 2025-10-03 23:18:47 01621_bar_nan_arguments: [ OK ] 0.12 sec. 2025-10-03 23:18:47 00520_http_nullable: [ OK ] 0.37 sec. 2025-10-03 23:18:48 02265_per_table_ttl_mutation_on_change: [ OK ] 0.27 sec. 2025-10-03 23:18:48 02900_issue_55858: [ OK ] 0.22 sec. 2025-10-03 23:18:48 01307_bloom_filter_index_string_multi_granulas: [ OK ] 0.17 sec. 2025-10-03 23:18:48 03159_dynamic_type_all_types: [ OK ] 0.32 sec. 2025-10-03 23:18:48 03129_cte_with_final: [ OK ] 0.17 sec. 2025-10-03 23:18:48 02141_clickhouse_local_interactive_table: [ OK ] 0.47 sec. 2025-10-03 23:18:50 00090_union_race_conditions_1: [ OK ] 5.83 sec. 2025-10-03 23:18:50 03156_analyzer_array_join_distributed: [ OK ] 0.22 sec. 2025-10-03 23:18:51 01509_check_many_parallel_quorum_inserts_long: [ OK ] 2.63 sec. 2025-10-03 23:18:51 03036_dynamic_read_shared_subcolumns_small: [ OK ] 0.87 sec. 2025-10-03 23:18:51 02994_sanity_check_settings: [ OK ] 0.17 sec. 2025-10-03 23:18:51 03210_empty_tuple_lhs_of_in: [ OK ] 0.12 sec. 2025-10-03 23:18:51 01277_unixTimestamp64_compatibility: [ OK ] 0.17 sec. 2025-10-03 23:18:51 02962_analyzer_const_in_count_distinct: [ OK ] 0.12 sec. 2025-10-03 23:18:51 01303_polygons_equals: [ OK ] 0.12 sec. 2025-10-03 23:18:51 01812_has_generic: [ OK ] 0.12 sec. 2025-10-03 23:18:52 01271_http_code_parse_error: [ OK ] 0.57 sec. 2025-10-03 23:18:52 01801_nullable_low_cardinality_tsv: [ OK ] 0.62 sec. 2025-10-03 23:18:52 00143_number_classification_functions: [ OK ] 0.22 sec. 2025-10-03 23:18:52 01171_mv_select_insert_isolation_long: [ OK ] 87.87 sec. 2025-10-03 23:18:52 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.17 sec. 2025-10-03 23:18:52 02167_columns_with_dots_default_values: [ OK ] 0.17 sec. 2025-10-03 23:18:52 01936_three_parts_identifiers_in_wrong_places: [ OK ] 0.17 sec. 2025-10-03 23:18:53 01280_opencl_bitonic_order_by: [ OK ] 0.17 sec. 2025-10-03 23:18:53 02699_polygons_sym_difference_total_analyzer: [ OK ] 0.12 sec. 2025-10-03 23:18:53 02884_duplicate_index_name: [ OK ] 0.12 sec. 2025-10-03 23:18:53 02703_jit_external_aggregation: [ OK ] 7.74 sec. 2025-10-03 23:18:53 00752_low_cardinality_left_array_join: [ OK ] 0.17 sec. 2025-10-03 23:18:53 01763_support_map_lowcardinality_type: [ OK ] 0.17 sec. 2025-10-03 23:18:53 02395_every_merge_tree_setting_must_have_documentation: [ OK ] 0.12 sec. 2025-10-03 23:18:53 01090_fixed_string_bit_ops: [ OK ] 0.12 sec. 2025-10-03 23:18:53 02816_s2_invalid_point: [ OK ] 0.12 sec. 2025-10-03 23:18:53 02167_format_from_file_extension: [ OK ] 4.68 sec. 2025-10-03 23:18:53 00914_join_bgranvea: [ OK ] 0.17 sec. 2025-10-03 23:18:53 02889_parts_columns_filenames: [ OK ] 0.17 sec. 2025-10-03 23:18:53 01664_array_slice_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:18:53 03010_file_log_large_poll_batch_size: [ OK ] 0.12 sec. 2025-10-03 23:18:53 01213_alter_rename_compact_part: [ OK ] 0.22 sec. 2025-10-03 23:18:54 00105_shard_collations: [ OK ] 0.27 sec. 2025-10-03 23:18:54 02135_local_create_db: [ OK ] 0.47 sec. 2025-10-03 23:18:54 01030_final_mark_empty_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:18:54 02703_max_local_write_bandwidth: [ OK ] 7.69 sec. 2025-10-03 23:18:54 02961_read_bool_as_string_json: [ OK ] 0.17 sec. 2025-10-03 23:18:54 02542_case_no_else: [ OK ] 0.12 sec. 2025-10-03 23:18:54 00502_custom_partitioning_replicated_zookeeper_long: [ OK ] 1.12 sec. 2025-10-03 23:18:54 01803_const_nullable_map: [ OK ] 0.17 sec. 2025-10-03 23:18:54 01720_type_map_and_casts: [ OK ] 0.37 sec. 2025-10-03 23:18:54 00314_sample_factor_virtual_column: [ OK ] 0.72 sec. 2025-10-03 23:18:55 03199_queries_with_new_analyzer: [ OK ] 0.47 sec. 2025-10-03 23:18:55 02160_client_autocomplete_parse_query: [ OK ] 1.57 sec. 2025-10-03 23:18:55 03221_mutate_profile_events: [ OK ] 0.47 sec. 2025-10-03 23:18:55 02030_tuple_filter: [ OK ] 0.52 sec. 2025-10-03 23:18:55 00955_test_final_mark: [ OK ] 0.77 sec. 2025-10-03 23:18:55 00122_join_with_subquery_with_subquery: [ OK ] 0.12 sec. 2025-10-03 23:18:55 01773_case_sensitive_version: [ OK ] 0.12 sec. 2025-10-03 23:18:55 01269_alias_type_differs: [ OK ] 0.17 sec. 2025-10-03 23:18:55 02871_join_on_system_errors: [ OK ] 0.12 sec. 2025-10-03 23:18:55 01268_DateTime64_in_WHERE: [ OK ] 0.27 sec. 2025-10-03 23:18:55 01475_read_subcolumns_storages: [ OK ] 3.03 sec. 2025-10-03 23:18:55 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.12 sec. 2025-10-03 23:18:55 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.12 sec. 2025-10-03 23:18:55 02242_throw_if_constant_argument: [ OK ] 0.12 sec. 2025-10-03 23:18:55 00464_array_element_out_of_range: [ OK ] 0.12 sec. 2025-10-03 23:18:55 02353_isnullable: [ OK ] 0.17 sec. 2025-10-03 23:18:56 03213_denseRank_percentRank_alias: [ OK ] 0.17 sec. 2025-10-03 23:18:56 03289_tuple_element_to_subcolumn: [ OK ] 0.17 sec. 2025-10-03 23:18:56 01031_pmj_new_any_semi_join: [ OK ] 0.22 sec. 2025-10-03 23:18:56 03033_analyzer_query_parameters: [ OK ] 0.42 sec. 2025-10-03 23:18:56 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.17 sec. 2025-10-03 23:18:56 00564_temporary_table_management: [ OK ] 0.12 sec. 2025-10-03 23:18:56 01836_date_time_keep_default_timezone_on_operations_den_crane: [ OK ] 0.17 sec. 2025-10-03 23:18:56 00490_with_select: [ OK ] 0.17 sec. 2025-10-03 23:18:56 01559_aggregate_null_for_empty_fix: [ OK ] 0.17 sec. 2025-10-03 23:18:56 02499_quantile_nan_ubsan_msan: [ OK ] 0.17 sec. 2025-10-03 23:18:56 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.87 sec. 2025-10-03 23:18:56 03167_transactions_are_really_disabled: [ OK ] 0.17 sec. 2025-10-03 23:18:56 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.47 sec. 2025-10-03 23:18:57 00404_null_literal: [ OK ] 0.17 sec. 2025-10-03 23:18:57 01187_set_profile_as_setting: [ OK ] 0.62 sec. 2025-10-03 23:18:57 01548_create_table_compound_column_format: [ OK ] 0.37 sec. 2025-10-03 23:18:57 02317_like_with_trailing_escape: [ OK ] 0.17 sec. 2025-10-03 23:18:57 02366_union_decimal_conversion: [ OK ] 0.12 sec. 2025-10-03 23:18:57 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.12 sec. 2025-10-03 23:18:57 02225_hints_for_indeices: [ OK ] 0.87 sec. 2025-10-03 23:18:57 03210_fix_single_value_data_assertion: [ OK ] 0.22 sec. 2025-10-03 23:18:57 01358_lc_parquet: [ OK ] 2.23 sec. 2025-10-03 23:18:57 01013_totals_without_aggregation: [ OK ] 0.17 sec. 2025-10-03 23:18:57 02932_materialized_view_with_dropped_target_table_no_exception: [ OK ] 0.22 sec. 2025-10-03 23:18:57 01391_join_on_dict_crash: [ OK ] 0.17 sec. 2025-10-03 23:18:57 02313_test_fpc_codec: [ OK ] 0.27 sec. 2025-10-03 23:18:57 02498_analyzer_settings_push_down: [ OK ] 0.22 sec. 2025-10-03 23:18:57 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.17 sec. 2025-10-03 23:18:57 01685_json_extract_double_as_float: [ OK ] 0.17 sec. 2025-10-03 23:18:58 02902_json_skip_null_values: [ OK ] 0.17 sec. 2025-10-03 23:18:58 00435_coalesce: [ OK ] 0.17 sec. 2025-10-03 23:18:58 00848_join_use_nulls_segfault: [ OK ] 0.32 sec. 2025-10-03 23:18:58 02242_make_date_mysql: [ OK ] 0.27 sec. 2025-10-03 23:18:58 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.17 sec. 2025-10-03 23:18:58 03149_asof_join_ddb_timestamps: [ OK ] 0.22 sec. 2025-10-03 23:18:58 02811_csv_input_field_type_mismatch: [ OK ] 0.77 sec. 2025-10-03 23:18:58 02270_errors_in_files: [ OK ] 1.37 sec. 2025-10-03 23:18:58 00715_bounding_ratio: [ OK ] 0.22 sec. 2025-10-03 23:18:58 00537_quarters: [ OK ] 0.12 sec. 2025-10-03 23:18:58 00476_pretty_formats_and_widths: [ OK ] 0.17 sec. 2025-10-03 23:18:58 02895_peak_memory_usage_http_headers_regression: [ OK ] 0.47 sec. 2025-10-03 23:18:59 03248_with_fill_string_crash: [ OK ] 0.17 sec. 2025-10-03 23:18:59 03093_reading_bug_with_parallel_replicas: [ OK ] 0.27 sec. 2025-10-03 23:18:59 02534_parquet_fixed_binary_array: [ OK ] 1.22 sec. 2025-10-03 23:18:59 02242_join_rocksdb: [ OK ] 0.37 sec. 2025-10-03 23:18:59 02346_inverted_index_experimental_flag: [ OK ] 0.27 sec. 2025-10-03 23:18:59 03081_analyzer_agg_func_CTE: [ OK ] 0.17 sec. 2025-10-03 23:18:59 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.12 sec. 2025-10-03 23:18:59 02933_compare_with_bool_as_string: [ OK ] 0.12 sec. 2025-10-03 23:18:59 03008_deduplication_remote_insert_select: [ OK ] 0.27 sec. 2025-10-03 23:18:59 00604_shard_remote_and_columns_with_defaults: [ OK ] 0.37 sec. 2025-10-03 23:18:59 00688_low_cardinality_syntax: [ OK ] 0.32 sec. 2025-10-03 23:18:59 00521_multidimensional: [ OK ] 0.32 sec. 2025-10-03 23:18:59 00513_fractional_time_zones: [ OK ] 0.17 sec. 2025-10-03 23:19:00 01118_is_constant: [ OK ] 0.17 sec. 2025-10-03 23:19:00 02165_replicated_grouping_sets: [ OK ] 0.47 sec. 2025-10-03 23:19:00 02890_describe_table_options: [ OK ] 0.22 sec. 2025-10-03 23:19:00 00709_virtual_column_partition_id: [ OK ] 0.17 sec. 2025-10-03 23:19:00 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.17 sec. 2025-10-03 23:19:00 01375_storage_file_write_prefix_tsv_with_names: [ OK ] 0.17 sec. 2025-10-03 23:19:00 01880_materialized_view_to_table_type_check: [ OK ] 0.22 sec. 2025-10-03 23:19:00 02347_rank_corr_nan: [ OK ] 0.12 sec. 2025-10-03 23:19:00 03074_analyzer_alias_column_in_view: [ OK ] 0.12 sec. 2025-10-03 23:19:00 01906_h3_to_geo: [ OK ] 0.22 sec. 2025-10-03 23:19:00 03091_analyzer_same_table_name_in_different_databases: [ OK ] 0.17 sec. 2025-10-03 23:19:00 00940_order_by_read_in_order: [ OK ] 0.42 sec. 2025-10-03 23:19:00 00037_totals_limit: [ OK ] 0.12 sec. 2025-10-03 23:19:01 02903_client_insert_in_background: [ OK ] 0.62 sec. 2025-10-03 23:19:01 00804_test_deflate_qpl_codec_compression: [ SKIPPED ] 0.00 sec. 2025-10-03 23:19:01 Reason: not running for current build 2025-10-03 23:19:01 03038_nested_dynamic_merges_small: [ OK ] 1.07 sec. 2025-10-03 23:19:01 02036_jit_short_circuit: [ OK ] 0.17 sec. 2025-10-03 23:19:01 02662_sparse_columns_mutations_3: [ OK ] 0.37 sec. 2025-10-03 23:19:01 00527_totals_having_nullable: [ OK ] 0.12 sec. 2025-10-03 23:19:01 01319_mv_constants_bug: [ OK ] 0.22 sec. 2025-10-03 23:19:01 00564_versioned_collapsing_merge_tree: [ OK ] 2.83 sec. 2025-10-03 23:19:01 02567_native_type_conversions: [ OK ] 0.72 sec. 2025-10-03 23:19:01 02707_analyzer_nested_lambdas_types: [ OK ] 0.17 sec. 2025-10-03 23:19:02 01601_accurate_cast: [ OK ] 0.82 sec. 2025-10-03 23:19:02 01312_comparison_with_constant_string_in_index_analysis: [ OK ] 0.27 sec. 2025-10-03 23:19:02 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.17 sec. 2025-10-03 23:19:02 01223_dist_on_dist: [ OK ] 0.68 sec. 2025-10-03 23:19:02 03197_fix_parse_mysql_iso_date: [ OK ] 0.12 sec. 2025-10-03 23:19:02 02480_parse_date_time_best_effort_math_overflow: [ OK ] 0.12 sec. 2025-10-03 23:19:02 01893_jit_aggregation_function_min_long: [ OK ] 0.62 sec. 2025-10-03 23:19:02 01825_type_json_14: [ OK ] 0.17 sec. 2025-10-03 23:19:02 03093_bug37909_query_does_not_finish: [ OK ] 0.32 sec. 2025-10-03 23:19:02 00098_e_union_all: [ OK ] 0.17 sec. 2025-10-03 23:19:02 01906_partition_by_multiply_by_zero: [ OK ] 0.17 sec. 2025-10-03 23:19:03 02319_sql_standard_create_drop_index: [ OK ] 0.32 sec. 2025-10-03 23:19:03 00937_test_use_header_tsv: [ OK ] 1.97 sec. 2025-10-03 23:19:03 02906_interval_comparison: [ OK ] 0.17 sec. 2025-10-03 23:19:03 03166_skip_indexes_vertical_merge_2: [ OK ] 0.67 sec. 2025-10-03 23:19:03 01540_verbatim_partition_pruning: [ OK ] 0.27 sec. 2025-10-03 23:19:03 02250_lots_of_columns_in_csv_with_names: [ OK ] 0.97 sec. 2025-10-03 23:19:03 01100_split_by_string: [ OK ] 0.17 sec. 2025-10-03 23:19:03 02001_hostname_test: [ OK ] 0.17 sec. 2025-10-03 23:19:03 02162_range_hashed_dictionary_ddl_expression: [ OK ] 0.17 sec. 2025-10-03 23:19:03 00593_union_all_assert_columns_removed: [ OK ] 0.12 sec. 2025-10-03 23:19:03 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 0.82 sec. 2025-10-03 23:19:03 00098_4_union_all: [ OK ] 0.17 sec. 2025-10-03 23:19:03 01122_totals_rollup_having_block_header: [ OK ] 0.17 sec. 2025-10-03 23:19:03 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.12 sec. 2025-10-03 23:19:03 01373_is_zero_or_null: [ OK ] 0.17 sec. 2025-10-03 23:19:04 00950_test_double_delta_codec: [ OK ] 0.27 sec. 2025-10-03 23:19:04 02406_minmax_behaviour: [ OK ] 0.62 sec. 2025-10-03 23:19:04 02366_kql_func_datetime: [ OK ] 0.37 sec. 2025-10-03 23:19:04 02493_analyzer_table_functions_untuple: [ OK ] 0.22 sec. 2025-10-03 23:19:04 01710_projection_analysis_reuse_partition: [ OK ] 0.92 sec. 2025-10-03 23:19:04 00898_parsing_bad_diagnostic_message: [ OK ] 0.47 sec. 2025-10-03 23:19:04 02892_rocksdb_trivial_count: [ OK ] 0.22 sec. 2025-10-03 23:19:04 02290_client_insert_cancel: [ OK ] 0.52 sec. 2025-10-03 23:19:05 01033_storage_odbc_parsing_exception_check: [ OK ] 0.17 sec. 2025-10-03 23:19:05 01521_alter_enum_and_reverse_read: [ OK ] 0.17 sec. 2025-10-03 23:19:05 03127_system_unload_primary_key_table: [ OK ] 1.78 sec. 2025-10-03 23:19:05 02832_integer_type_inference: [ OK ] 0.29 sec. 2025-10-03 23:19:05 00632_get_sample_block_cache: [ OK ] 1.08 sec. 2025-10-03 23:19:05 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.17 sec. 2025-10-03 23:19:05 01408_range_overflow: [ OK ] 0.17 sec. 2025-10-03 23:19:05 02370_extractAll_regress: [ OK ] 0.12 sec. 2025-10-03 23:19:05 01925_test_group_by_const_consistency: [ OK ] 0.12 sec. 2025-10-03 23:19:05 02125_query_views_log_window_function: [ OK ] 0.32 sec. 2025-10-03 23:19:06 00976_asof_join_on: [ OK ] 0.47 sec. 2025-10-03 23:19:06 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.47 sec. 2025-10-03 23:19:07 01916_lowcard_dict_type: [ OK ] 0.17 sec. 2025-10-03 23:19:07 00515_enhanced_time_zones: [ OK ] 0.47 sec. 2025-10-03 23:19:07 00834_hints_for_type_function_typos: [ OK ] 2.73 sec. 2025-10-03 23:19:07 02364_multiSearch_function_family: [ OK ] 1.88 sec. 2025-10-03 23:19:07 02573_quantile_fuse_msan: [ OK ] 0.17 sec. 2025-10-03 23:19:08 00808_not_optimize_predicate: [ OK ] 0.27 sec. 2025-10-03 23:19:08 02100_multiple_hosts_command_line_set: [ OK ] 59.64 sec. 2025-10-03 23:19:08 01274_alter_rename_column_distributed: [ OK ] 0.17 sec. 2025-10-03 23:19:08 01096_block_serialized_state: [ OK ] 0.12 sec. 2025-10-03 23:19:08 00528_const_of_nullable: [ OK ] 0.17 sec. 2025-10-03 23:19:08 02668_column_block_number_vertical_merge: [ OK ] 0.22 sec. 2025-10-03 23:19:08 02915_analyzer_fuzz_2: [ OK ] 0.17 sec. 2025-10-03 23:19:08 00645_date_time_input_format: [ OK ] 0.12 sec. 2025-10-03 23:19:08 01434_netloc_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:19:08 03032_rmt_create_columns_from_replica: [ OK ] 0.17 sec. 2025-10-03 23:19:08 01798_uniq_theta_union_intersect_not: [ OK ] 0.32 sec. 2025-10-03 23:19:09 02267_special_operator_parse_alias_check: [ OK ] 0.32 sec. 2025-10-03 23:19:09 01291_geo_types: [ OK ] 0.17 sec. 2025-10-03 23:19:09 02311_range_hashed_dictionary_range_cast: [ OK ] 0.17 sec. 2025-10-03 23:19:09 00035_function_array_return_type: [ OK ] 0.12 sec. 2025-10-03 23:19:09 01570_aggregator_combinator_simple_state: [ OK ] 0.22 sec. 2025-10-03 23:19:09 01053_drop_database_mat_view: [ OK ] 0.22 sec. 2025-10-03 23:19:09 01780_range_msan: [ OK ] 0.12 sec. 2025-10-03 23:19:09 01273_h3EdgeAngle_range_check: [ OK ] 0.12 sec. 2025-10-03 23:19:10 01710_projections_and_duplicate_columms: [ OK ] 0.17 sec. 2025-10-03 23:19:10 02418_aggregate_combinators: [ OK ] 0.22 sec. 2025-10-03 23:19:11 02114_hdfs_bad_url: [ OK ] 2.18 sec. 2025-10-03 23:19:11 01078_merge_tree_read_one_thread: [ OK ] 1.22 sec. 2025-10-03 23:19:11 00441_nulls_in: [ OK ] 0.22 sec. 2025-10-03 23:19:11 02384_nullable_low_cardinality_as_dict_in_arrow: [ OK ] 0.17 sec. 2025-10-03 23:19:11 02923_explain_expired_context: [ OK ] 0.12 sec. 2025-10-03 23:19:11 00842_array_with_constant_overflow: [ OK ] 0.12 sec. 2025-10-03 23:19:12 02813_seriesDecomposeSTL: [ OK ] 0.22 sec. 2025-10-03 23:19:12 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.17 sec. 2025-10-03 23:19:12 01942_snowflakeIDToDateTime: [ OK ] 0.32 sec. 2025-10-03 23:19:12 01683_intdiv_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:19:12 03142_window_function_limit_by: [ OK ] 0.17 sec. 2025-10-03 23:19:12 00498_bitwise_aggregate_functions: [ OK ] 0.17 sec. 2025-10-03 23:19:14 01514_parallel_formatting: [ OK ] 2.18 sec. 2025-10-03 23:19:14 01278_alter_rename_combination: [ OK ] 0.22 sec. 2025-10-03 23:19:15 02030_capnp_format: [ OK ] 7.74 sec. 2025-10-03 23:19:15 01661_week_functions_string_args: [ OK ] 0.32 sec. 2025-10-03 23:19:16 01721_join_implicit_cast_long: [ OK ] 3.33 sec. 2025-10-03 23:19:16 01897_jit_aggregation_function_avg_weighted_long: [ OK ] 0.62 sec. 2025-10-03 23:19:16 00751_hashing_ints: [ OK ] 0.17 sec. 2025-10-03 23:19:16 02503_mysql_compat_utc_timestamp: [ OK ] 0.12 sec. 2025-10-03 23:19:16 01089_alter_settings_old_format: [ OK ] 0.17 sec. 2025-10-03 23:19:16 00612_union_query_with_subquery: [ OK ] 0.17 sec. 2025-10-03 23:19:16 02534_s3_cluster_insert_select_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:19:16 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.17 sec. 2025-10-03 23:19:16 02863_decode_html_component: [ OK ] 0.17 sec. 2025-10-03 23:19:17 02952_conjunction_optimization: [ OK ] 0.17 sec. 2025-10-03 23:19:17 00006_extremes_and_subquery_from: [ OK ] 0.12 sec. 2025-10-03 23:19:17 02454_compressed_marks_in_compact_part: [ OK ] 0.12 sec. 2025-10-03 23:19:17 01188_attach_table_from_path: [ OK ] 0.22 sec. 2025-10-03 23:19:17 01774_bar_with_illegal_value: [ OK ] 0.12 sec. 2025-10-03 23:19:17 01057_http_compression_prefer_brotli: [ OK ] 0.62 sec. 2025-10-03 23:19:17 02125_lz4_compression_bug_TSKV: [ OK ] 3.23 sec. 2025-10-03 23:19:18 01457_order_by_limit: [ OK ] 0.22 sec. 2025-10-03 23:19:18 03144_compress_stdout: [ OK ] 0.47 sec. 2025-10-03 23:19:18 02808_aliases_inside_case: [ OK ] 0.12 sec. 2025-10-03 23:19:18 03262_column_sizes_with_dynamic_structure: [ OK ] 1.12 sec. 2025-10-03 23:19:18 00411_merge_tree_where_const_in_set: [ OK ] 0.17 sec. 2025-10-03 23:19:18 03023_group_by_use_nulls_analyzer_crashes: [ OK ] 0.27 sec. 2025-10-03 23:19:19 01737_move_order_key_to_prewhere_select_final: [ OK ] 0.22 sec. 2025-10-03 23:19:19 01882_total_rows_approx: [ OK ] 1.08 sec. 2025-10-03 23:19:19 01169_alter_partition_isolation_stress: [ OK ] 11.57 sec. 2025-10-03 23:19:19 02998_analyzer_prewhere_report: [ OK ] 0.17 sec. 2025-10-03 23:19:20 03153_format_regexp_usability: [ OK ] 0.68 sec. 2025-10-03 23:19:21 02149_schema_inference_create_table_syntax: [ OK ] 2.34 sec. 2025-10-03 23:19:21 02540_duplicate_primary_key: [ OK ] 0.13 sec. 2025-10-03 23:19:21 01558_transform_null_in: [ OK ] 0.28 sec. 2025-10-03 23:19:21 00411_long_accurate_number_comparison_float: [ OK ] 2.04 sec. 2025-10-03 23:19:22 03035_morton_encode_no_rows: [ OK ] 0.19 sec. 2025-10-03 23:19:22 00335_bom: [ OK ] 0.47 sec. 2025-10-03 23:19:22 02555_davengers_rename_chain: [ OK ] 2.13 sec. 2025-10-03 23:19:22 03053_analyzer_join_alias: [ OK ] 0.22 sec. 2025-10-03 23:19:22 02709_storage_memory_compressed: [ OK ] 0.23 sec. 2025-10-03 23:19:23 03090_analyzer_multiple_using_statements: [ OK ] 0.14 sec. 2025-10-03 23:19:23 03164_adapting_parquet_reader_output_size: [ OK ] 1.22 sec. 2025-10-03 23:19:23 02183_combinator_if: [ OK ] 0.43 sec. 2025-10-03 23:19:23 00919_sum_aggregate_states_constants: [ OK ] 0.22 sec. 2025-10-03 23:19:23 00824_filesystem: [ OK ] 0.12 sec. 2025-10-03 23:19:23 01622_constraints_simple_optimization: [ OK ] 0.64 sec. 2025-10-03 23:19:23 01710_projection_in_index: [ OK ] 0.17 sec. 2025-10-03 23:19:23 03211_nested_json_merges: [ OK ] 19.70 sec. 2025-10-03 23:19:24 00187_like_regexp_prefix: [ OK ] 0.12 sec. 2025-10-03 23:19:24 03018_external_with_complex_data_types: [ OK ] 0.52 sec. 2025-10-03 23:19:24 02576_rewrite_array_exists_to_has: [ OK ] 0.18 sec. 2025-10-03 23:19:24 01461_query_start_time_microseconds: [ OK ] 0.64 sec. 2025-10-03 23:19:24 01213_point_in_Myanmar: [ OK ] 0.18 sec. 2025-10-03 23:19:24 01470_columns_transformers2: [ OK ] 0.17 sec. 2025-10-03 23:19:24 02943_variant_element: [ OK ] 0.18 sec. 2025-10-03 23:19:24 01622_multiple_ttls: [ OK ] 0.23 sec. 2025-10-03 23:19:25 03001_backup_matview_after_modify_query: [ OK ] 1.35 sec. 2025-10-03 23:19:25 03021_get_client_http_header: [ OK ] 0.84 sec. 2025-10-03 23:19:26 01071_force_optimize_skip_unused_shards: [ OK ] 0.38 sec. 2025-10-03 23:19:26 00974_low_cardinality_cast: [ OK ] 0.22 sec. 2025-10-03 23:19:26 02149_schema_inference_formats_with_schema_3: [ OK ] 1.83 sec. 2025-10-03 23:19:26 00144_empty_regexp: [ OK ] 0.12 sec. 2025-10-03 23:19:26 00804_test_delta_codec_no_type_alter: [ OK ] 0.22 sec. 2025-10-03 23:19:27 02577_analyzer_array_join_calc_twice: [ OK ] 0.17 sec. 2025-10-03 23:19:27 01344_min_bytes_to_use_mmap_io_index: [ OK ] 0.37 sec. 2025-10-03 23:19:27 01407_lambda_arrayJoin: [ OK ] 0.17 sec. 2025-10-03 23:19:27 01602_modified_julian_day_msan: [ OK ] 0.17 sec. 2025-10-03 23:19:27 00355_array_of_non_const_convertible_types: [ OK ] 0.17 sec. 2025-10-03 23:19:27 02025_storage_filelog_virtual_col: [ OK ] 3.40 sec. 2025-10-03 23:19:27 00453_top_k: [ OK ] 0.17 sec. 2025-10-03 23:19:27 03030_system_flush_distributed_settings: [ OK ] 0.79 sec. 2025-10-03 23:19:27 02785_global_join_too_many_columns: [ OK ] 0.17 sec. 2025-10-03 23:19:28 02560_with_fill_int256_int: [ OK ] 0.17 sec. 2025-10-03 23:19:28 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.43 sec. 2025-10-03 23:19:28 01940_totimezone_operator_monotonicity: [ OK ] 0.17 sec. 2025-10-03 23:19:28 01636_nullable_fuzz2: [ OK ] 0.27 sec. 2025-10-03 23:19:28 00178_query_datetime64_index: [ OK ] 0.18 sec. 2025-10-03 23:19:28 02551_ipv4_implicit_uint64: [ OK ] 0.17 sec. 2025-10-03 23:19:28 01801_s3_cluster_count: [ OK ] 0.23 sec. 2025-10-03 23:19:28 02014_map_different_keys: [ OK ] 0.22 sec. 2025-10-03 23:19:28 01846_null_as_default_for_insert_select: [ OK ] 0.22 sec. 2025-10-03 23:19:28 02124_buffer_with_type_map_long: [ OK ] 10.61 sec. 2025-10-03 23:19:28 02781_data_skipping_index_merge_tree_min_for_seek: [ OK ] 0.27 sec. 2025-10-03 23:19:29 01379_with_fill_several_columns: [ OK ] 0.13 sec. 2025-10-03 23:19:29 00910_buffer_prewhere: [ OK ] 0.17 sec. 2025-10-03 23:19:29 03228_variant_permutation_issue: [ OK ] 0.22 sec. 2025-10-03 23:19:29 02916_addcolumn_nested: [ OK ] 0.17 sec. 2025-10-03 23:19:29 02017_columns_with_dot_2: [ OK ] 0.17 sec. 2025-10-03 23:19:29 02421_new_type_json_async_insert: [ OK ] 1.23 sec. 2025-10-03 23:19:29 01905_to_json_string: [ OK ] 0.17 sec. 2025-10-03 23:19:29 00449_filter_array_nullable_tuple: [ OK ] 0.17 sec. 2025-10-03 23:19:29 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.37 sec. 2025-10-03 23:19:30 00458_merge_type_cast: [ OK ] 0.47 sec. 2025-10-03 23:19:30 02163_operators: [ OK ] 0.12 sec. 2025-10-03 23:19:30 00979_quantileExcatExclusive_and_Inclusive: [ OK ] 0.17 sec. 2025-10-03 23:19:30 03039_dynamic_summing_merge_tree: [ OK ] 5.50 sec. 2025-10-03 23:19:30 00724_insert_values_datetime_conversion: [ OK ] 0.12 sec. 2025-10-03 23:19:30 01646_rewrite_sum_if_bug: [ OK ] 0.22 sec. 2025-10-03 23:19:30 03126_column_not_under_group_by: [ OK ] 0.12 sec. 2025-10-03 23:19:30 00961_visit_param_buffer_underflow: [ OK ] 0.12 sec. 2025-10-03 23:19:30 03001_consider_lwd_when_merge: [ OK ] 0.22 sec. 2025-10-03 23:19:30 01247_optimize_distributed_group_by_sharding_key_dist_on_dist: [ OK ] 0.27 sec. 2025-10-03 23:19:30 02184_default_table_engine: [ OK ] 0.72 sec. 2025-10-03 23:19:31 02098_with_types_use_header: [ OK ] 1.92 sec. 2025-10-03 23:19:31 02242_case_insensitive_column_matching: [ OK ] 1.62 sec. 2025-10-03 23:19:31 03149_analyzer_window_redefinition: [ OK ] 0.17 sec. 2025-10-03 23:19:31 00634_rename_view: [ OK ] 0.17 sec. 2025-10-03 23:19:31 02681_undrop_query: [ OK ] 0.97 sec. 2025-10-03 23:19:32 02677_get_subcolumn_array_of_tuples: [ OK ] 0.17 sec. 2025-10-03 23:19:33 00646_url_engine: [ OK ] 1.07 sec. 2025-10-03 23:19:33 02834_remote_session_log: [ OK ] 2.53 sec. 2025-10-03 23:19:34 00710_array_enumerate_dense: [ OK ] 0.22 sec. 2025-10-03 23:19:34 02772_jit_date_time_add: [ OK ] 0.17 sec. 2025-10-03 23:19:34 01825_type_json_4: [ OK ] 1.17 sec. 2025-10-03 23:19:34 00688_low_cardinality_alter_add_column: [ OK ] 0.17 sec. 2025-10-03 23:19:34 02000_join_on_const: [ OK ] 0.52 sec. 2025-10-03 23:19:35 00799_function_dry_run: [ OK ] 0.17 sec. 2025-10-03 23:19:35 02876_formats_with_names_dont_use_header: [ OK ] 0.37 sec. 2025-10-03 23:19:35 03227_test_sample_n: [ OK ] 0.22 sec. 2025-10-03 23:19:35 01151_storage_merge_filter_tables_by_virtual_column: [ OK ] 0.27 sec. 2025-10-03 23:19:35 02500_remove_redundant_distinct: [ OK ] 4.33 sec. 2025-10-03 23:19:35 00383_utf8_validation: [ OK ] 0.12 sec. 2025-10-03 23:19:35 01710_minmax_count_projection_count_nullable: [ OK ] 0.17 sec. 2025-10-03 23:19:35 02890_partition_prune_in_extra_columns: [ OK ] 0.17 sec. 2025-10-03 23:19:36 02512_array_join_name_resolution: [ OK ] 0.17 sec. 2025-10-03 23:19:36 02271_replace_partition_many_tables: [ OK ] 30.45 sec. 2025-10-03 23:19:36 00990_request_splitting: [ OK ] 0.12 sec. 2025-10-03 23:19:36 02941_variant_type_1: [ OK ] 5.48 sec. 2025-10-03 23:19:36 02245_join_with_nullable_lowcardinality_crash: [ OK ] 0.17 sec. 2025-10-03 23:19:36 00129_quantile_timing_weighted: [ OK ] 0.12 sec. 2025-10-03 23:19:36 03290_final_collapsing: [ OK ] 0.22 sec. 2025-10-03 23:19:36 02731_nothing_deserialization: [ OK ] 0.12 sec. 2025-10-03 23:19:36 00700_decimal_with_default_precision_and_scale: [ OK ] 0.17 sec. 2025-10-03 23:19:36 00016_totals_having_constants: [ OK ] 0.12 sec. 2025-10-03 23:19:37 01426_geohash_constants: [ OK ] 0.17 sec. 2025-10-03 23:19:37 01825_type_json_btc: [ OK ] 1.17 sec. 2025-10-03 23:19:37 01475_read_subcolumns_2: [ OK ] 0.27 sec. 2025-10-03 23:19:37 00900_orc_nullable_arrays_load: [ OK ] 0.98 sec. 2025-10-03 23:19:37 01097_pre_limit: [ OK ] 0.12 sec. 2025-10-03 23:19:37 01380_coded_delta_exception_code: [ OK ] 0.17 sec. 2025-10-03 23:19:38 00846_join_using_tuple_crash: [ OK ] 0.17 sec. 2025-10-03 23:19:38 02718_cli_dashed_options_parsing: [ OK ] 1.02 sec. 2025-10-03 23:19:38 00667_compare_arrays_of_different_types: [ OK ] 0.12 sec. 2025-10-03 23:19:38 01889_sql_json_functions: [ OK ] 0.42 sec. 2025-10-03 23:19:38 02813_func_now_and_alias: [ OK ] 0.12 sec. 2025-10-03 23:19:38 02691_multiple_joins_backtick_identifiers: [ OK ] 0.22 sec. 2025-10-03 23:19:38 02571_local_desc_abort_on_twitter_json: [ OK ] 0.47 sec. 2025-10-03 23:19:38 01933_client_replxx_convert_history: [ OK ] 0.47 sec. 2025-10-03 23:19:38 00251_has_types: [ OK ] 0.17 sec. 2025-10-03 23:19:39 03086_analyzer_window_func_part_of_group_by: [ OK ] 0.12 sec. 2025-10-03 23:19:39 02460_projections_and_aggregate_null_if_empty: [ OK ] 0.47 sec. 2025-10-03 23:19:39 02723_jit_aggregation_bug_48120: [ OK ] 0.22 sec. 2025-10-03 23:19:39 01070_h3_indexes_are_neighbors: [ OK ] 0.12 sec. 2025-10-03 23:19:39 02122_parallel_formatting_Values: [ OK ] 1.07 sec. 2025-10-03 23:19:40 00743_limit_by_not_found_column: [ OK ] 0.17 sec. 2025-10-03 23:19:40 01169_old_alter_partition_isolation_stress: [ OK ] 4.48 sec. 2025-10-03 23:19:40 01132_max_rows_to_read: [ OK ] 0.17 sec. 2025-10-03 23:19:40 02994_libarchive_compression: [ OK ] 2.17 sec. 2025-10-03 23:19:40 00442_filter_by_nullable: [ OK ] 0.17 sec. 2025-10-03 23:19:40 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.62 sec. 2025-10-03 23:19:40 01080_join_get_null: [ OK ] 0.17 sec. 2025-10-03 23:19:40 00022_func_higher_order_and_constants: [ OK ] 0.12 sec. 2025-10-03 23:19:40 02153_clickhouse_local_profile_info: [ OK ] 0.37 sec. 2025-10-03 23:19:40 00167_settings_inside_query: [ OK ] 0.12 sec. 2025-10-03 23:19:40 01160_table_dependencies: [ OK ] 5.89 sec. 2025-10-03 23:19:40 01710_projection_external_aggregate: [ OK ] 0.27 sec. 2025-10-03 23:19:41 01015_empty_in_inner_right_join: [ OK ] 0.37 sec. 2025-10-03 23:19:41 02479_analyzer_aggregation_crash: [ OK ] 0.17 sec. 2025-10-03 23:19:41 00475_in_join_db_table: [ OK ] 0.22 sec. 2025-10-03 23:19:41 00623_in_partition_key: [ OK ] 0.37 sec. 2025-10-03 23:19:41 02990_optimize_uniq_to_count_alias: [ OK ] 0.17 sec. 2025-10-03 23:19:41 02499_analyzer_aggregate_function_lambda_crash_fix: [ OK ] 0.12 sec. 2025-10-03 23:19:41 01660_join_or_inner: [ OK ] 0.22 sec. 2025-10-03 23:19:41 01731_async_task_queue_wait: [ OK ] 1.32 sec. 2025-10-03 23:19:41 02100_now64_types_bug: [ OK ] 0.12 sec. 2025-10-03 23:19:41 03158_dynamic_type_from_variant: [ OK ] 0.17 sec. 2025-10-03 23:19:41 02392_every_setting_must_have_documentation: [ OK ] 0.12 sec. 2025-10-03 23:19:42 02301_harmful_reexec: [ OK ] 0.47 sec. 2025-10-03 23:19:42 02293_h3_hex_ring: [ OK ] 0.27 sec. 2025-10-03 23:19:42 02502_analyzer_insert_select_crash_fix: [ OK ] 0.17 sec. 2025-10-03 23:19:42 02497_storage_file_reader_selection: [ OK ] 0.72 sec. 2025-10-03 23:19:42 02514_database_replicated_no_arguments_for_rmt: [ OK ] 1.17 sec. 2025-10-03 23:19:42 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.27 sec. 2025-10-03 23:19:42 01107_tuples_arrays_parsing_exceptions: [ OK ] 0.47 sec. 2025-10-03 23:19:42 01890_jit_aggregation_function_sum_long: [ OK ] 0.62 sec. 2025-10-03 23:19:42 03208_groupArrayIntersect_serialization: [ OK ] 0.32 sec. 2025-10-03 23:19:42 02498_analyzer_aggregate_functions_arithmetic_operations_pass_fix: [ OK ] 0.22 sec. 2025-10-03 23:19:43 00097_long_storage_buffer_race_condition_mt: [ OK ] 12.46 sec. 2025-10-03 23:19:43 03132_rewrite_aggregate_function_with_if_implicit_cast: [ OK ] 0.17 sec. 2025-10-03 23:19:43 03023_remove_unused_column_distinct: [ OK ] 0.12 sec. 2025-10-03 23:19:43 02782_values_null_to_lc_nullable: [ OK ] 0.12 sec. 2025-10-03 23:19:43 02381_compress_marks_and_primary_key: [ OK ] 0.97 sec. 2025-10-03 23:19:43 01825_type_json_5: [ OK ] 0.22 sec. 2025-10-03 23:19:43 02366_kql_operator_in_sql: [ OK ] 0.27 sec. 2025-10-03 23:19:43 02722_matcher_join_use_nulls: [ OK ] 0.47 sec. 2025-10-03 23:19:43 00543_null_and_prewhere: [ OK ] 0.17 sec. 2025-10-03 23:19:43 02023_storage_filelog: [ OK ] 2.48 sec. 2025-10-03 23:19:43 03107_ill_formed_select_in_materialized_view: [ OK ] 0.17 sec. 2025-10-03 23:19:43 01265_datetime_string_comparison_felix_mueller: [ OK ] 0.17 sec. 2025-10-03 23:19:43 02943_create_query_interpreter_sample_block_fix: [ OK ] 0.27 sec. 2025-10-03 23:19:43 01305_polygons_union: [ OK ] 0.22 sec. 2025-10-03 23:19:43 03115_alias_exists_column: [ OK ] 0.12 sec. 2025-10-03 23:19:43 01720_join_implicit_cast: [ OK ] 0.72 sec. 2025-10-03 23:19:44 02477_invalid_reads: [ OK ] 0.42 sec. 2025-10-03 23:19:44 03117_analyzer_same_column_name_as_func: [ OK ] 0.17 sec. 2025-10-03 23:19:44 00780_unaligned_array_join: [ OK ] 0.12 sec. 2025-10-03 23:19:44 01359_codeql: [ OK ] 0.13 sec. 2025-10-03 23:19:44 01385_not_function: [ OK ] 0.18 sec. 2025-10-03 23:19:44 01650_drop_part_and_deduplication_zookeeper_long: [ OK ] 0.33 sec. 2025-10-03 23:19:44 00430_https_server: [ OK ] 0.37 sec. 2025-10-03 23:19:44 02104_clickhouse_local_columns_description: [ OK ] 0.47 sec. 2025-10-03 23:19:44 00051_any_inner_join: [ OK ] 0.17 sec. 2025-10-03 23:19:45 02730_dictionary_hashed_load_factor_element_count: [ OK ] 0.57 sec. 2025-10-03 23:19:45 03258_old_analyzer_const_expr_bug: [ OK ] 0.17 sec. 2025-10-03 23:19:45 02676_trailing_commas: [ OK ] 0.17 sec. 2025-10-03 23:19:45 00875_join_right_nulls_ors: [ OK ] 0.32 sec. 2025-10-03 23:19:46 02898_parallel_replicas_progress_bar: [ OK ] 1.19 sec. 2025-10-03 23:19:46 02024_create_dictionary_with_comment: [ OK ] 0.12 sec. 2025-10-03 23:19:46 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.22 sec. 2025-10-03 23:19:46 01498_alter_column_storage_memory: [ OK ] 0.17 sec. 2025-10-03 23:19:46 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 2.43 sec. 2025-10-03 23:19:46 02355_control_block_size_in_array_join: [ OK ] 0.22 sec. 2025-10-03 23:19:46 01713_table_ttl_old_syntax_zookeeper: [ OK ] 0.24 sec. 2025-10-03 23:19:46 00232_format_readable_decimal_size: [ OK ] 0.12 sec. 2025-10-03 23:19:47 00872_t64_bit_codec: [ OK ] 0.82 sec. 2025-10-03 23:19:47 00700_decimal_casts: [ OK ] 0.88 sec. 2025-10-03 23:19:47 02987_logical_optimizer_pass_lowcardinality: [ OK ] 0.17 sec. 2025-10-03 23:19:47 01590_countSubstrings: [ OK ] 0.43 sec. 2025-10-03 23:19:48 00014_select_from_table_with_nested: [ OK ] 0.17 sec. 2025-10-03 23:19:48 00348_tuples: [ OK ] 0.17 sec. 2025-10-03 23:19:49 00652_mutations_alter_update: [ OK ] 4.49 sec. 2025-10-03 23:19:49 02021_exponential_sum: [ OK ] 2.59 sec. 2025-10-03 23:19:50 02165_insert_from_infile: [ OK ] 0.12 sec. 2025-10-03 23:19:50 03230_json_alias_new_old_types: [ OK ] 0.17 sec. 2025-10-03 23:19:50 01375_storage_file_write_prefix_csv_with_names: [ OK ] 0.17 sec. 2025-10-03 23:19:50 01353_neighbor_overflow: [ OK ] 0.17 sec. 2025-10-03 23:19:50 03040_array_sum_and_join: [ OK ] 0.12 sec. 2025-10-03 23:19:50 01503_fixed_string_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:19:51 02430_bitmap_transform_exception_code: [ OK ] 0.12 sec. 2025-10-03 23:19:51 01822_async_read_from_socket_crash: [ OK ] 4.34 sec. 2025-10-03 23:19:51 01795_TinyLog_rwlock_ub: [ OK ] 0.17 sec. 2025-10-03 23:19:51 02404_lightweight_delete_vertical_merge: [ OK ] 0.42 sec. 2025-10-03 23:19:52 02004_intersect_except_operators: [ OK ] 0.47 sec. 2025-10-03 23:19:52 03134_positional_arguments: [ OK ] 1.43 sec. 2025-10-03 23:19:52 02381_arrow_dict_of_nullable_string_to_lc: [ OK ] 0.47 sec. 2025-10-03 23:19:52 01236_graphite_mt: [ OK ] 0.17 sec. 2025-10-03 23:19:52 00534_functions_bad_arguments5: [ OK ] 4.68 sec. 2025-10-03 23:19:53 00517_date_parsing: [ OK ] 0.27 sec. 2025-10-03 23:19:54 02124_buffer_insert_select_race: [ OK ] 10.74 sec. 2025-10-03 23:19:54 00841_temporary_table_database: [ OK ] 0.17 sec. 2025-10-03 23:19:54 01478_not_equi-join_on: [ OK ] 0.12 sec. 2025-10-03 23:19:55 01273_arrow_stream: [ OK ] 6.65 sec. 2025-10-03 23:19:55 01604_explain_ast_of_nonselect_query: [ OK ] 0.12 sec. 2025-10-03 23:19:56 00712_nan_comparison: [ OK ] 0.22 sec. 2025-10-03 23:19:56 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.12 sec. 2025-10-03 23:19:56 02896_dwarf_format: [ OK ] 3.69 sec. 2025-10-03 23:19:56 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 2.18 sec. 2025-10-03 23:19:56 01647_clickhouse_local_hung: [ OK ] 12.94 sec. 2025-10-03 23:19:56 01073_crlf_end_of_line: [ OK ] 0.17 sec. 2025-10-03 23:19:56 02944_variant_as_common_type_analyzer: [ OK ] 0.32 sec. 2025-10-03 23:19:56 03246_json_tuple_decompress_race: [ OK ] 0.27 sec. 2025-10-03 23:19:56 02311_create_table_with_unknown_format: [ OK ] 0.17 sec. 2025-10-03 23:19:57 02841_check_table_progress: [ OK ] 0.77 sec. 2025-10-03 23:19:57 02934_merge_tree_max_projections: [ OK ] 0.27 sec. 2025-10-03 23:19:57 02476_query_parameters_without_serialisation: [ OK ] 0.17 sec. 2025-10-03 23:19:57 01622_codec_zstd_long: [ OK ] 0.27 sec. 2025-10-03 23:19:57 02481_async_insert_dedup_token: [ OK ] 92.21 sec. 2025-10-03 23:19:57 03214_json_typed_dynamic_path: [ OK ] 0.53 sec. 2025-10-03 23:19:57 00617_array_in: [ OK ] 0.17 sec. 2025-10-03 23:19:57 01622_byte_size: [ OK ] 0.77 sec. 2025-10-03 23:19:58 00904_array_with_constant_2: [ OK ] 0.17 sec. 2025-10-03 23:19:58 03075_analyzer_subquery_alias: [ OK ] 0.12 sec. 2025-10-03 23:19:58 02096_bad_options_in_client_and_local: [ OK ] 0.62 sec. 2025-10-03 23:19:59 03174_split_parts_ranges_into_intersecting_and_non_intersecting_final_and_read-in-order_bug: [ OK ] 2.02 sec. 2025-10-03 23:19:59 02281_limit_by_distributed: [ OK ] 0.17 sec. 2025-10-03 23:19:59 02274_full_sort_join_nodistinct: [ OK ] 2.58 sec. 2025-10-03 23:20:01 01035_avg: [ OK ] 2.33 sec. 2025-10-03 23:20:01 02096_totals_global_in_bug: [ OK ] 0.17 sec. 2025-10-03 23:20:01 01630_simple_aggregate_all_functions_in_aggregating_merge_tree: [ OK ] 3.53 sec. 2025-10-03 23:20:01 01733_transform_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:20:01 02165_h3_num_hexagons: [ OK ] 0.22 sec. 2025-10-03 23:20:01 00744_join_not_found_column: [ OK ] 0.17 sec. 2025-10-03 23:20:01 03037_s3_write_to_globbed_partitioned_path: [ OK ] 0.12 sec. 2025-10-03 23:20:01 02903_parameterized_view_explain_ast: [ OK ] 0.12 sec. 2025-10-03 23:20:02 00978_sum_map_bugfix: [ OK ] 0.18 sec. 2025-10-03 23:20:03 03246_json_simd_rapid_parsers: [ OK ] 0.77 sec. 2025-10-03 23:20:03 02193_async_insert_tcp_client_1: [ OK ] 10.37 sec. 2025-10-03 23:20:03 01603_remove_column_ttl: [ OK ] 0.22 sec. 2025-10-03 23:20:03 00304_http_external_data: [ OK ] 0.53 sec. 2025-10-03 23:20:03 02023_transform_or_to_in: [ OK ] 0.18 sec. 2025-10-03 23:20:04 01632_group_array_msan: [ OK ] 0.17 sec. 2025-10-03 23:20:04 00905_compile_expressions_compare_big_dates: [ OK ] 0.17 sec. 2025-10-03 23:20:04 02008_tuple_to_name_value_pairs: [ OK ] 0.22 sec. 2025-10-03 23:20:04 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 2.68 sec. 2025-10-03 23:20:04 02165_h3_exact_edge_length_m: [ OK ] 0.17 sec. 2025-10-03 23:20:04 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.17 sec. 2025-10-03 23:20:05 03167_base64_url_functions: [ OK ] 0.22 sec. 2025-10-03 23:20:05 00553_buff_exists_materlized_column: [ OK ] 0.22 sec. 2025-10-03 23:20:05 02833_url_without_path_encoding: [ OK ] 0.67 sec. 2025-10-03 23:20:05 01015_random_constant: [ OK ] 0.17 sec. 2025-10-03 23:20:06 03036_recursive_cte_postgres_2: [ OK ] 0.87 sec. 2025-10-03 23:20:06 02125_lz4_compression_bug_JSONEachRow: [ OK ] 3.39 sec. 2025-10-03 23:20:06 02265_cross_join_empty_list: [ OK ] 0.23 sec. 2025-10-03 23:20:07 01175_distributed_ddl_output_mode_long: [ OK ] 7.74 sec. 2025-10-03 23:20:07 02174_cte_scalar_cache: [ OK ] 0.47 sec. 2025-10-03 23:20:07 01798_having_push_down: [ OK ] 0.23 sec. 2025-10-03 23:20:07 01600_min_max_compress_block_size: [ OK ] 0.18 sec. 2025-10-03 23:20:07 01250_fixed_string_comparison: [ OK ] 0.12 sec. 2025-10-03 23:20:07 01852_cast_operator_4: [ OK ] 0.22 sec. 2025-10-03 23:20:07 00969_columns_clause: [ OK ] 0.22 sec. 2025-10-03 23:20:08 00596_limit_on_expanded_ast: [ OK ] 0.47 sec. 2025-10-03 23:20:09 03274_dynamic_column_sizes_vertical_merge: [ OK ] 0.77 sec. 2025-10-03 23:20:09 02001_dist_on_dist_WithMergeableStateAfterAggregation: [ OK ] 0.23 sec. 2025-10-03 23:20:09 00363_defaults: [ OK ] 0.22 sec. 2025-10-03 23:20:10 02481_async_insert_race_long: [ OK ] 10.63 sec. 2025-10-03 23:20:10 00429_point_in_ellipses: [ OK ] 0.12 sec. 2025-10-03 23:20:10 01287_max_execution_speed: [ OK ] 4.24 sec. 2025-10-03 23:20:10 03014_analyzer_group_by_use_nulls: [ OK ] 0.12 sec. 2025-10-03 23:20:10 00805_round_down: [ OK ] 0.22 sec. 2025-10-03 23:20:10 02245_weird_partitions_pruning: [ OK ] 0.22 sec. 2025-10-03 23:20:11 02918_optimize_count_for_merge_tables: [ OK ] 0.22 sec. 2025-10-03 23:20:11 01532_min_max_with_modifiers: [ OK ] 0.17 sec. 2025-10-03 23:20:11 02112_delayed_clickhouse_local: [ OK ] 0.43 sec. 2025-10-03 23:20:11 02922_respect_nulls_states: [ OK ] 0.27 sec. 2025-10-03 23:20:11 03036_parquet_arrow_nullable: [ OK ] 3.99 sec. 2025-10-03 23:20:12 00431_if_nulls: [ OK ] 0.52 sec. 2025-10-03 23:20:12 02718_parquet_metadata_format: [ OK ] 0.92 sec. 2025-10-03 23:20:12 00048_b_stored_aggregates_merge: [ OK ] 0.17 sec. 2025-10-03 23:20:12 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.12 sec. 2025-10-03 23:20:12 01642_if_nullable_regression: [ OK ] 0.17 sec. 2025-10-03 23:20:12 01273_arrow: [ OK ] 7.20 sec. 2025-10-03 23:20:12 00573_shard_aggregation_by_empty_set: [ OK ] 0.27 sec. 2025-10-03 23:20:12 01010_pmj_on_disk: [ OK ] 0.17 sec. 2025-10-03 23:20:13 01785_pmj_lc_bug: [ OK ] 0.17 sec. 2025-10-03 23:20:13 01676_round_int_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:20:13 02523_array_shuffle: [ OK ] 0.42 sec. 2025-10-03 23:20:13 02412_nlp: [ OK ] 0.17 sec. 2025-10-03 23:20:13 01710_projection_drop_if_exists: [ OK ] 0.17 sec. 2025-10-03 23:20:13 02343_aggregation_pipeline: [ OK ] 0.27 sec. 2025-10-03 23:20:13 01255_geo_types_livace: [ OK ] 0.17 sec. 2025-10-03 23:20:14 02372_analyzer_join: [ OK ] 2.18 sec. 2025-10-03 23:20:14 01685_ssd_cache_dictionary_complex_key: [ OK ] 0.62 sec. 2025-10-03 23:20:14 00308_write_buffer_valid_utf8: [ OK ] 0.12 sec. 2025-10-03 23:20:14 01009_global_array_join_names: [ OK ] 0.17 sec. 2025-10-03 23:20:14 01096_array_reduce_in_ranges: [ OK ] 0.17 sec. 2025-10-03 23:20:14 02910_nullable_enum_cast: [ OK ] 0.12 sec. 2025-10-03 23:20:14 01883_with_grouping_sets: [ OK ] 0.27 sec. 2025-10-03 23:20:14 01015_database_bad_tables: [ OK ] 2.68 sec. 2025-10-03 23:20:15 02375_analyzer_union: [ OK ] 0.39 sec. 2025-10-03 23:20:15 02122_parallel_formatting_CSVWithNamesAndTypes: [ OK ] 1.02 sec. 2025-10-03 23:20:15 02340_union_header: [ OK ] 0.22 sec. 2025-10-03 23:20:15 00800_function_java_hash_with_unsigined_types: [ OK ] 0.87 sec. 2025-10-03 23:20:15 01601_proxy_protocol: [ OK ] 0.32 sec. 2025-10-03 23:20:15 03067_analyzer_complex_alias_join: [ OK ] 0.12 sec. 2025-10-03 23:20:15 00700_decimal_gathers: [ OK ] 0.17 sec. 2025-10-03 23:20:15 01450_set_null_const: [ OK ] 0.18 sec. 2025-10-03 23:20:16 00907_set_index_with_nullable_and_low_cardinality_bug: [ OK ] 0.22 sec. 2025-10-03 23:20:16 02048_parallel_reading_from_infile: [ OK ] 0.72 sec. 2025-10-03 23:20:16 02364_setting_cross_to_inner_rewrite: [ OK ] 0.17 sec. 2025-10-03 23:20:16 01788_update_nested_type_subcolumn_check: [ OK ] 1.02 sec. 2025-10-03 23:20:17 02675_grant_query_formatting: [ OK ] 0.32 sec. 2025-10-03 23:20:17 03143_group_by_constant_secondary: [ OK ] 0.17 sec. 2025-10-03 23:20:17 03013_ignore_drop_queries_probability: [ OK ] 0.17 sec. 2025-10-03 23:20:17 01386_negative_float_constant_key_condition: [ OK ] 0.17 sec. 2025-10-03 23:20:17 02932_analyzer_rewrite_sum_column_and_constant: [ OK ] 0.87 sec. 2025-10-03 23:20:17 02971_functions_to_subcolumns_variant: [ OK ] 0.17 sec. 2025-10-03 23:20:18 00907_set_index_with_nullable_and_low_cardinality: [ OK ] 0.42 sec. 2025-10-03 23:20:18 02817_group_array_moving_zero_window_size: [ OK ] 0.12 sec. 2025-10-03 23:20:18 02681_group_array_too_large_size: [ OK ] 0.12 sec. 2025-10-03 23:20:18 01088_array_slice_of_aggregate_functions: [ OK ] 0.12 sec. 2025-10-03 23:20:18 00927_disable_hyperscan: [ OK ] 0.22 sec. 2025-10-03 23:20:18 00652_replicated_mutations_zookeeper: [ OK ] 5.04 sec. 2025-10-03 23:20:19 01526_initial_query_id: [ OK ] 0.77 sec. 2025-10-03 23:20:19 02158_contingency: [ OK ] 0.17 sec. 2025-10-03 23:20:19 02900_date_time_check_overflow: [ OK ] 0.27 sec. 2025-10-03 23:20:19 03055_analyzer_subquery_group_array: [ OK ] 0.12 sec. 2025-10-03 23:20:19 02962_join_using_bug_57894: [ OK ] 0.17 sec. 2025-10-03 23:20:19 01294_lazy_database_concurrent_recreate_reattach_and_show_tables_long: [ OK ] 22.19 sec. 2025-10-03 23:20:20 02121_pager: [ OK ] 0.52 sec. 2025-10-03 23:20:20 00081_int_div_or_zero: [ OK ] 0.12 sec. 2025-10-03 23:20:20 02200_use_skip_indexes: [ OK ] 0.17 sec. 2025-10-03 23:20:20 02521_tsv_csv_custom_header_detection: [ OK ] 4.63 sec. 2025-10-03 23:20:21 02413_replace_partition_zero_copy: [ OK ] 0.62 sec. 2025-10-03 23:20:21 01536_fuzz_cast: [ OK ] 0.12 sec. 2025-10-03 23:20:21 00825_protobuf_format_splitted_nested: [ OK ] 1.12 sec. 2025-10-03 23:20:21 00938_basename: [ OK ] 0.17 sec. 2025-10-03 23:20:21 03035_argMinMax_numeric_non_extreme_bug: [ OK ] 0.17 sec. 2025-10-03 23:20:22 00290_shard_aggregation_memory_efficient: [ OK ] 0.52 sec. 2025-10-03 23:20:22 02226_parallel_reading_from_replicas_benchmark: [ OK ] 0.67 sec. 2025-10-03 23:20:22 02481_array_join_with_map: [ OK ] 0.17 sec. 2025-10-03 23:20:22 00275_shard_quantiles_weighted: [ OK ] 0.32 sec. 2025-10-03 23:20:22 02841_join_filter_set_sparse: [ OK ] 0.27 sec. 2025-10-03 23:20:23 02162_array_first_last_index: [ OK ] 0.17 sec. 2025-10-03 23:20:23 00996_limit_with_ties: [ OK ] 0.27 sec. 2025-10-03 23:20:23 03174_merge_join_bug: [ OK ] 0.12 sec. 2025-10-03 23:20:23 01675_distributed_bytes_to_delay_insert: [ OK ] 4.78 sec. 2025-10-03 23:20:23 01278_min_insert_block_size_rows_for_materialized_views: [ OK ] 3.33 sec. 2025-10-03 23:20:23 00666_uniq_complex_types: [ OK ] 0.27 sec. 2025-10-03 23:20:23 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 0.42 sec. 2025-10-03 23:20:23 02242_make_date: [ OK ] 0.42 sec. 2025-10-03 23:20:23 01430_modify_sample_by_zookeeper_long: [ OK ] 0.47 sec. 2025-10-03 23:20:23 01667_aes_args_check: [ OK ] 0.12 sec. 2025-10-03 23:20:23 01480_binary_operator_monotonicity: [ OK ] 0.37 sec. 2025-10-03 23:20:23 01506_buffer_table_alter_block_structure_2: [ OK ] 0.12 sec. 2025-10-03 23:20:24 02009_array_join_partition: [ OK ] 0.12 sec. 2025-10-03 23:20:24 02030_client_unknown_database: [ OK ] 0.37 sec. 2025-10-03 23:20:24 02475_bad_cast_low_cardinality_to_string_bug: [ OK ] 0.13 sec. 2025-10-03 23:20:24 00980_crash_nullable_decimal: [ OK ] 0.17 sec. 2025-10-03 23:20:24 03272_partition_pruning_monotonic_func_bug: [ OK ] 0.17 sec. 2025-10-03 23:20:24 02882_clickhouse_keeper_client_no_confirmation: [ OK ] 0.42 sec. 2025-10-03 23:20:24 01817_storage_buffer_parameters: [ OK ] 0.17 sec. 2025-10-03 23:20:24 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.17 sec. 2025-10-03 23:20:24 00082_append_trailing_char_if_absent: [ OK ] 0.12 sec. 2025-10-03 23:20:24 00578_merge_table_and_table_virtual_column: [ OK ] 0.32 sec. 2025-10-03 23:20:24 01410_nullable_key_and_index: [ OK ] 0.42 sec. 2025-10-03 23:20:24 03062_analyzer_join_engine_missing_column: [ OK ] 0.17 sec. 2025-10-03 23:20:25 02012_compress_lz4: [ OK ] 0.53 sec. 2025-10-03 23:20:25 01781_merge_tree_deduplication: [ OK ] 0.72 sec. 2025-10-03 23:20:25 00927_asof_join_other_types: [ OK ] 0.67 sec. 2025-10-03 23:20:25 01116_asof_join_dolbyzerr: [ OK ] 0.17 sec. 2025-10-03 23:20:25 03313_case_insensitive_json_type_declaration: [ OK ] 0.12 sec. 2025-10-03 23:20:25 02286_convert_decimal_type: [ OK ] 0.17 sec. 2025-10-03 23:20:25 00612_count: [ OK ] 0.27 sec. 2025-10-03 23:20:25 02920_capnp_protobuf_auto_schema_nested: [ OK ] 0.62 sec. 2025-10-03 23:20:26 01221_system_settings: [ OK ] 0.17 sec. 2025-10-03 23:20:26 00194_identity: [ OK ] 0.12 sec. 2025-10-03 23:20:26 00073_merge_sorting_empty_array_joined: [ OK ] 0.12 sec. 2025-10-03 23:20:26 01825_new_type_json_6: [ OK ] 1.17 sec. 2025-10-03 23:20:26 01669_join_or_duplicates: [ OK ] 0.22 sec. 2025-10-03 23:20:26 01825_new_type_json_in_array: [ OK ] 0.27 sec. 2025-10-03 23:20:26 02972_parallel_replicas_cte: [ OK ] 0.27 sec. 2025-10-03 23:20:27 03210_json_type_alter_add_column: [ OK ] 0.42 sec. 2025-10-03 23:20:27 01545_url_file_format_settings: [ OK ] 0.17 sec. 2025-10-03 23:20:27 02573_insert_null_as_default_null_as_empty_nested: [ OK ] 0.27 sec. 2025-10-03 23:20:27 02363_mapupdate_improve: [ OK ] 0.22 sec. 2025-10-03 23:20:27 02917_transform_tsan: [ OK ] 0.12 sec. 2025-10-03 23:20:27 02456_alter-nullable-column-bag-2: [ OK ] 0.22 sec. 2025-10-03 23:20:27 02125_transform_decimal_bug: [ OK ] 0.17 sec. 2025-10-03 23:20:27 02373_datetime64_monotonicity: [ OK ] 2.02 sec. 2025-10-03 23:20:28 02428_parameterized_view: [ OK ] 9.05 sec. 2025-10-03 23:20:28 00115_shard_in_incomplete_result: [ OK ] 3.43 sec. 2025-10-03 23:20:28 01825_type_json_sparse: [ OK ] 0.22 sec. 2025-10-03 23:20:28 01263_type_conversion_nvartolomei: [ OK ] 0.22 sec. 2025-10-03 23:20:28 03254_parquet_bool_native_reader: [ OK ] 0.62 sec. 2025-10-03 23:20:29 00388_enum_with_totals: [ OK ] 0.12 sec. 2025-10-03 23:20:29 02859_replicated_db_name_zookeeper: [ OK ] 1.07 sec. 2025-10-03 23:20:29 01069_database_memory: [ OK ] 0.22 sec. 2025-10-03 23:20:29 01825_type_json_from_map: [ OK ] 1.93 sec. 2025-10-03 23:20:29 02515_projections_with_totals: [ OK ] 0.17 sec. 2025-10-03 23:20:29 02814_currentDatabase_for_table_functions: [ OK ] 1.18 sec. 2025-10-03 23:20:29 02017_create_distributed_table_coredump: [ OK ] 0.17 sec. 2025-10-03 23:20:29 00098_1_union_all: [ OK ] 0.17 sec. 2025-10-03 23:20:29 02998_http_redirects: [ OK ] 0.37 sec. 2025-10-03 23:20:29 02752_space_function: [ OK ] 0.27 sec. 2025-10-03 23:20:29 01117_comma_and_others_join_mix: [ OK ] 0.17 sec. 2025-10-03 23:20:29 02732_transform_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:20:30 02783_max_bytes_to_read_in_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:20:30 00746_sql_fuzzy: [ OK ] 94.88 sec. 2025-10-03 23:20:30 03095_msan_uuid_string_to_num: [ OK ] 0.17 sec. 2025-10-03 23:20:30 03032_multi_search_const_low_cardinality: [ OK ] 0.12 sec. 2025-10-03 23:20:30 00834_dont_allow_to_set_two_configuration_files_in_client: [ OK ] 0.32 sec. 2025-10-03 23:20:30 01045_dictionaries_restrictions: [ OK ] 0.17 sec. 2025-10-03 23:20:30 00995_order_by_with_fill: [ OK ] 0.22 sec. 2025-10-03 23:20:30 00200_shard_distinct_order_by_limit_distributed: [ OK ] 0.17 sec. 2025-10-03 23:20:30 02751_protobuf_ipv6: [ OK ] 0.47 sec. 2025-10-03 23:20:30 00162_shard_global_join: [ OK ] 0.12 sec. 2025-10-03 23:20:30 00098_5_union_all: [ OK ] 0.17 sec. 2025-10-03 23:20:31 02345_analyzer_subqueries: [ OK ] 0.27 sec. 2025-10-03 23:20:31 02561_temporary_table_grants: [ OK ] 1.72 sec. 2025-10-03 23:20:31 02302_join_auto_lc_nullable_bug: [ OK ] 0.12 sec. 2025-10-03 23:20:31 00829_bitmap64_function: [ OK ] 0.27 sec. 2025-10-03 23:20:31 01258_bom_tsv: [ OK ] 0.37 sec. 2025-10-03 23:20:31 01634_uuid_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:20:31 01387_clear_column_default_depends: [ OK ] 0.32 sec. 2025-10-03 23:20:31 02563_arrow_low_cardinality_bug: [ OK ] 0.82 sec. 2025-10-03 23:20:31 01384_bloom_filter_bad_arguments: [ OK ] 0.17 sec. 2025-10-03 23:20:31 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.17 sec. 2025-10-03 23:20:32 03002_analyzer_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:20:32 02369_lost_part_intersecting_merges: [ OK ] 2.73 sec. 2025-10-03 23:20:32 00626_replace_partition_from_table: [ OK ] 0.47 sec. 2025-10-03 23:20:32 03038_nested_dynamic_merges_wide_vertical: [ OK ] 1.93 sec. 2025-10-03 23:20:32 01661_arraySlice_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:20:32 01947_mv_subquery: [ OK ] 0.52 sec. 2025-10-03 23:20:32 01852_multiple_joins_with_union_join: [ OK ] 0.17 sec. 2025-10-03 23:20:32 01277_toUnixTimestamp64: [ OK ] 0.22 sec. 2025-10-03 23:20:32 00447_foreach_modifier: [ OK ] 0.17 sec. 2025-10-03 23:20:32 00916_join_using_duplicate_columns: [ OK ] 0.22 sec. 2025-10-03 23:20:33 01086_modulo_or_zero: [ OK ] 0.17 sec. 2025-10-03 23:20:33 02697_stop_reading_on_first_cancel: [ OK ] 0.62 sec. 2025-10-03 23:20:33 03152_analyzer_columns_list: [ OK ] 0.17 sec. 2025-10-03 23:20:33 02971_limit_by_distributed: [ OK ] 0.17 sec. 2025-10-03 23:20:33 00870_t64_codec: [ OK ] 1.02 sec. 2025-10-03 23:20:34 00939_limit_by_offset: [ OK ] 0.17 sec. 2025-10-03 23:20:34 00733_if_datetime: [ OK ] 0.17 sec. 2025-10-03 23:20:34 02125_lz4_compression_bug_Native: [ OK ] 1.97 sec. 2025-10-03 23:20:34 02904_arrow_dictionary_indexes: [ OK ] 1.12 sec. 2025-10-03 23:20:34 00316_rounding_functions_and_empty_block: [ OK ] 0.12 sec. 2025-10-03 23:20:34 02371_select_projection_normal_agg: [ OK ] 1.47 sec. 2025-10-03 23:20:34 00822_array_insert_default: [ OK ] 0.42 sec. 2025-10-03 23:20:34 02834_array_exists_segfault: [ OK ] 0.12 sec. 2025-10-03 23:20:35 03143_window_functions_qualify_validation: [ OK ] 0.12 sec. 2025-10-03 23:20:35 00994_table_function_numbers_mt: [ OK ] 0.17 sec. 2025-10-03 23:20:35 00802_system_parts_with_datetime_partition: [ OK ] 0.27 sec. 2025-10-03 23:20:35 01481_join_with_materialized: [ OK ] 0.17 sec. 2025-10-03 23:20:35 01326_hostname_alias: [ OK ] 0.12 sec. 2025-10-03 23:20:35 03251_parquet_page_v2_native_reader: [ OK ] 0.57 sec. 2025-10-03 23:20:35 01632_select_all_syntax: [ OK ] 0.17 sec. 2025-10-03 23:20:35 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.12 sec. 2025-10-03 23:20:35 01925_merge_prewhere_table: [ OK ] 0.17 sec. 2025-10-03 23:20:35 03273_dynamic_pretty_json_serialization: [ OK ] 0.12 sec. 2025-10-03 23:20:36 02122_parallel_formatting_PrettySpace: [ OK ] 1.82 sec. 2025-10-03 23:20:36 02676_optimize_old_parts_replicated: [ OK ] 42.97 sec. 2025-10-03 23:20:36 02999_ulid_short_circuit: [ OK ] 0.17 sec. 2025-10-03 23:20:36 02800_clickhouse_local_default_settings: [ OK ] 0.42 sec. 2025-10-03 23:20:37 01417_query_time_in_system_events: [ OK ] 2.88 sec. 2025-10-03 23:20:37 02480_client_option_print_num_processed_rows: [ OK ] 0.87 sec. 2025-10-03 23:20:37 00909_arrayEnumerateUniq: [ OK ] 1.17 sec. 2025-10-03 23:20:37 02155_binary_op_between_float_and_decimal: [ OK ] 0.42 sec. 2025-10-03 23:20:37 02901_parallel_replicas_rollup: [ OK ] 1.63 sec. 2025-10-03 23:20:37 02151_hash_table_sizes_stats: [ OK ] 9.25 sec. 2025-10-03 23:20:37 03211_nested_json_merges_small: [ OK ] 1.42 sec. 2025-10-03 23:20:37 01825_new_type_json_order_by: [ OK ] 0.12 sec. 2025-10-03 23:20:37 00250_tuple_comparison: [ OK ] 0.22 sec. 2025-10-03 23:20:37 02706_keeper_map_insert_strict: [ OK ] 0.17 sec. 2025-10-03 23:20:38 00339_parsing_bad_arrays: [ OK ] 0.37 sec. 2025-10-03 23:20:38 00280_hex_escape_sequence: [ OK ] 0.13 sec. 2025-10-03 23:20:38 01474_custom_null_tsv: [ OK ] 0.77 sec. 2025-10-03 23:20:38 02267_type_inference_for_insert_into_function_null: [ OK ] 0.17 sec. 2025-10-03 23:20:38 01730_distributed_group_by_no_merge_order_by_long: [ OK ] 0.83 sec. 2025-10-03 23:20:38 01641_memory_tracking_insert_optimize: [ OK ] 0.47 sec. 2025-10-03 23:20:38 00291_array_reduce: [ OK ] 0.12 sec. 2025-10-03 23:20:38 02517_avro_bool_type: [ OK ] 0.48 sec. 2025-10-03 23:20:39 01838_system_dictionaries_virtual_key_column: [ OK ] 0.17 sec. 2025-10-03 23:20:39 01720_country_intersection: [ OK ] 1.48 sec. 2025-10-03 23:20:39 01493_alter_remove_properties: [ OK ] 0.32 sec. 2025-10-03 23:20:39 01761_cast_to_enum_nullable: [ OK ] 0.12 sec. 2025-10-03 23:20:39 00252_shard_global_in_aggregate_function: [ OK ] 0.17 sec. 2025-10-03 23:20:39 00219_full_right_join_column_order: [ OK ] 0.12 sec. 2025-10-03 23:20:39 01293_show_clusters: [ OK ] 0.52 sec. 2025-10-03 23:20:39 02841_not_ready_set_constraints: [ OK ] 0.22 sec. 2025-10-03 23:20:39 01917_system_data_skipping_indices: [ OK ] 0.17 sec. 2025-10-03 23:20:39 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.12 sec. 2025-10-03 23:20:39 00269_database_table_whitespace: [ OK ] 0.13 sec. 2025-10-03 23:20:39 03013_repeat_with_nonnative_integers: [ OK ] 0.12 sec. 2025-10-03 23:20:39 03001_max_parallel_replicas_zero_value: [ OK ] 0.12 sec. 2025-10-03 23:20:39 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.17 sec. 2025-10-03 23:20:39 00403_to_start_of_day: [ OK ] 0.12 sec. 2025-10-03 23:20:39 02508_bad_graphite: [ OK ] 0.17 sec. 2025-10-03 23:20:39 01347_partition_date_vs_datetime: [ OK ] 0.12 sec. 2025-10-03 23:20:39 01083_match_zero_byte: [ OK ] 0.17 sec. 2025-10-03 23:20:39 02304_grouping_set_order_by: [ OK ] 0.12 sec. 2025-10-03 23:20:40 02967_mysql_settings_override: [ OK ] 0.57 sec. 2025-10-03 23:20:40 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.12 sec. 2025-10-03 23:20:40 02907_system_backups_profile_events: [ OK ] 0.62 sec. 2025-10-03 23:20:40 00064_negate_bug: [ OK ] 0.12 sec. 2025-10-03 23:20:41 02946_format_values: [ OK ] 0.47 sec. 2025-10-03 23:20:41 01064_pm_all_join_const_and_nullable: [ OK ] 0.32 sec. 2025-10-03 23:20:41 03205_column_type_check: [ OK ] 0.12 sec. 2025-10-03 23:20:41 02713_sequence_match_serialization_fix: [ OK ] 0.17 sec. 2025-10-03 23:20:41 01034_order_by_pk_prefix: [ OK ] 0.22 sec. 2025-10-03 23:20:41 02132_empty_mutation_livelock: [ OK ] 0.22 sec. 2025-10-03 23:20:42 02459_group_by_all: [ OK ] 0.27 sec. 2025-10-03 23:20:42 01663_aes_msan: [ OK ] 0.12 sec. 2025-10-03 23:20:42 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 2.53 sec. 2025-10-03 23:20:42 02044_url_glob_parallel: [ OK ] 2.43 sec. 2025-10-03 23:20:42 00323_quantiles_timing_bug: [ OK ] 0.22 sec. 2025-10-03 23:20:42 02179_bool_type: [ OK ] 0.27 sec. 2025-10-03 23:20:42 01941_dict_get_has_complex_single_key: [ OK ] 0.17 sec. 2025-10-03 23:20:42 02568_json_array_length: [ OK ] 0.17 sec. 2025-10-03 23:20:43 02985_dialects_with_distributed_tables: [ OK ] 0.22 sec. 2025-10-03 23:20:43 00148_summing_merge_tree_nested_map_multiple_values: [ OK ] 0.17 sec. 2025-10-03 23:20:44 03168_query_log_privileges_not_empty: [ OK ] 1.77 sec. 2025-10-03 23:20:44 01410_nullable_key_and_index_negate_cond: [ OK ] 0.22 sec. 2025-10-03 23:20:44 00964_bloom_index_string_functions: [ OK ] 3.28 sec. 2025-10-03 23:20:44 02427_msan_group_array_resample: [ OK ] 0.12 sec. 2025-10-03 23:20:44 02994_cosineDistanceNullable: [ OK ] 0.12 sec. 2025-10-03 23:20:44 01957_heredoc_more: [ OK ] 0.12 sec. 2025-10-03 23:20:44 02813_create_index_noop: [ OK ] 2.13 sec. 2025-10-03 23:20:44 01411_xor_itai_shirav: [ OK ] 0.12 sec. 2025-10-03 23:20:44 01429_join_on_error_messages: [ OK ] 0.17 sec. 2025-10-03 23:20:44 02499_read_json_objects_as_strings: [ OK ] 0.13 sec. 2025-10-03 23:20:45 00988_parallel_parts_removal: [ OK ] 1.82 sec. 2025-10-03 23:20:45 02477_age: [ OK ] 0.32 sec. 2025-10-03 23:20:45 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.12 sec. 2025-10-03 23:20:45 02843_date_predicate_optimizations_bugs: [ OK ] 0.12 sec. 2025-10-03 23:20:45 02500_analyzer_storage_view_crash_fix: [ OK ] 0.22 sec. 2025-10-03 23:20:45 02720_row_policy_column_with_dots: [ OK ] 0.17 sec. 2025-10-03 23:20:45 03032_numbers_zeros: [ OK ] 0.22 sec. 2025-10-03 23:20:45 01711_decimal_multiplication: [ OK ] 0.12 sec. 2025-10-03 23:20:45 02342_window_view_different_struct: [ OK ] 0.27 sec. 2025-10-03 23:20:46 00871_t64_codec_signed: [ OK ] 0.92 sec. 2025-10-03 23:20:46 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.22 sec. 2025-10-03 23:20:46 02421_truncate_isolation_with_mutations: [ OK ] 8.75 sec. 2025-10-03 23:20:46 01825_type_json_in_other_types: [ OK ] 1.37 sec. 2025-10-03 23:20:46 01761_round_year_bounds: [ OK ] 0.12 sec. 2025-10-03 23:20:46 01418_query_scope_constants_and_remote: [ OK ] 0.17 sec. 2025-10-03 23:20:46 00589_removal_unused_columns_aggregation: [ OK ] 0.22 sec. 2025-10-03 23:20:46 03142_alter_comment_parameterized_view: [ OK ] 0.12 sec. 2025-10-03 23:20:46 03166_optimize_row_order_during_insert: [ OK ] 0.22 sec. 2025-10-03 23:20:46 02416_json_object_inference: [ OK ] 0.12 sec. 2025-10-03 23:20:46 01906_lc_in_bug: [ OK ] 0.27 sec. 2025-10-03 23:20:46 01009_insert_select_data_loss: [ OK ] 0.17 sec. 2025-10-03 23:20:46 01268_shard_avgweighted: [ OK ] 0.22 sec. 2025-10-03 23:20:47 02918_multif_for_nullable: [ OK ] 0.72 sec. 2025-10-03 23:20:47 01414_bloom_filter_index_with_const_column: [ OK ] 0.17 sec. 2025-10-03 23:20:47 03237_max_map_state_decimal_serialization: [ OK ] 0.12 sec. 2025-10-03 23:20:47 00523_aggregate_functions_in_group_array: [ OK ] 0.12 sec. 2025-10-03 23:20:47 03042_analyzer_alias_join: [ OK ] 0.12 sec. 2025-10-03 23:20:47 02021_map_bloom_filter_index: [ OK ] 0.37 sec. 2025-10-03 23:20:48 02810_async_insert_dedup_replicated_collapsing: [ OK ] 10.31 sec. 2025-10-03 23:20:48 03001_analyzer_nullable_nothing: [ OK ] 0.12 sec. 2025-10-03 23:20:48 01681_hyperscan_debug_assertion: [ OK ] 0.52 sec. 2025-10-03 23:20:49 02947_merge_tree_index_table_3: [ OK ] 1.47 sec. 2025-10-03 23:20:49 01825_new_type_json_bools: [ OK ] 0.17 sec. 2025-10-03 23:20:49 00952_basic_constraints: [ OK ] 1.77 sec. 2025-10-03 23:20:49 02292_nested_not_flattened_detach: [ OK ] 0.12 sec. 2025-10-03 23:20:49 00436_fixed_string_16_comparisons: [ OK ] 0.17 sec. 2025-10-03 23:20:49 01284_escape_sequences_php_mysql_style: [ OK ] 0.17 sec. 2025-10-03 23:20:49 02494_analyzer_cte_resolution_in_subquery_fix: [ OK ] 0.17 sec. 2025-10-03 23:20:49 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.12 sec. 2025-10-03 23:20:50 01921_datatype_date32: [ OK ] 0.72 sec. 2025-10-03 23:20:51 00678_shard_funnel_window: [ OK ] 0.27 sec. 2025-10-03 23:20:51 01561_mann_whitney_scipy: [ OK ] 1.88 sec. 2025-10-03 23:20:51 02024_storage_filelog_mv: [ OK ] 5.09 sec. 2025-10-03 23:20:51 02560_quantile_min_max: [ OK ] 0.17 sec. 2025-10-03 23:20:51 00927_asof_joins: [ OK ] 0.22 sec. 2025-10-03 23:20:51 01825_new_type_json_9: [ OK ] 0.17 sec. 2025-10-03 23:20:51 02294_nothing_arguments_in_functions: [ OK ] 0.22 sec. 2025-10-03 23:20:51 01552_dict_fixedstring: [ OK ] 0.17 sec. 2025-10-03 23:20:51 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:20:52 00936_function_result_with_operator_in: [ OK ] 0.22 sec. 2025-10-03 23:20:52 03160_dynamic_type_agg: [ OK ] 0.12 sec. 2025-10-03 23:20:52 02344_distinct_limit_distiributed: [ OK ] 0.47 sec. 2025-10-03 23:20:52 01810_max_part_removal_threads_long: [ OK ] 1.47 sec. 2025-10-03 23:20:52 01352_generate_random_overflow: [ OK ] 0.12 sec. 2025-10-03 23:20:52 00999_settings_no_extra_quotes: [ OK ] 0.12 sec. 2025-10-03 23:20:52 01675_data_type_coroutine_2: [ OK ] 7.14 sec. 2025-10-03 23:20:52 02335_column_ttl_expired_column_optimization: [ OK ] 0.52 sec. 2025-10-03 23:20:52 03211_convert_outer_join_to_inner_join_anti_join: [ OK ] 0.17 sec. 2025-10-03 23:20:52 01881_to_week_monotonic_fix: [ OK ] 0.12 sec. 2025-10-03 23:20:52 02788_current_schemas_function: [ OK ] 0.17 sec. 2025-10-03 23:20:53 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.37 sec. 2025-10-03 23:20:53 02191_nested_with_dots: [ OK ] 0.22 sec. 2025-10-03 23:20:53 02021_h3_is_res_classIII: [ OK ] 0.17 sec. 2025-10-03 23:20:53 03003_arrayEnumerate_crash: [ OK ] 0.12 sec. 2025-10-03 23:20:53 01418_custom_settings: [ OK ] 0.27 sec. 2025-10-03 23:20:53 02311_system_zookeeper_insert: [ OK ] 0.32 sec. 2025-10-03 23:20:53 00394_new_nested_column_keeps_offsets: [ OK ] 0.17 sec. 2025-10-03 23:20:53 03033_hive_text_read_variable_fields: [ OK ] 0.72 sec. 2025-10-03 23:20:53 01765_tehran_dst: [ OK ] 0.17 sec. 2025-10-03 23:20:53 02916_dictionary_access: [ OK ] 0.72 sec. 2025-10-03 23:20:54 02499_analyzer_set_index: [ OK ] 0.17 sec. 2025-10-03 23:20:54 02998_operator_respect_nulls: [ OK ] 0.12 sec. 2025-10-03 23:20:54 02353_translate: [ OK ] 0.17 sec. 2025-10-03 23:20:54 02000_map_full_text_bloom_filter_index: [ OK ] 0.62 sec. 2025-10-03 23:20:54 02966_topk_counts_approx_count_sum: [ OK ] 0.17 sec. 2025-10-03 23:20:54 01809_inactive_parts_to_delay_throw_insert: [ OK ] 1.17 sec. 2025-10-03 23:20:54 02996_nullable_arrayReduce: [ OK ] 0.17 sec. 2025-10-03 23:20:55 03059_analyzer_join_engine_missing_column: [ OK ] 0.12 sec. 2025-10-03 23:20:55 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.17 sec. 2025-10-03 23:20:55 00719_insert_block_without_column: [ OK ] 0.77 sec. 2025-10-03 23:20:55 02475_or_function_alias_and_const_where: [ OK ] 0.12 sec. 2025-10-03 23:20:55 01701_parallel_parsing_infinite_segmentation: [ OK ] 0.87 sec. 2025-10-03 23:20:55 01458_is_decimal_overflow: [ OK ] 0.22 sec. 2025-10-03 23:20:55 00830_join_overwrite: [ OK ] 0.17 sec. 2025-10-03 23:20:56 03035_internal_functions_direct_call: [ OK ] 0.22 sec. 2025-10-03 23:20:56 02703_row_policies_for_database_combination: [ OK ] 0.62 sec. 2025-10-03 23:20:56 02980_s3_plain_DROP_TABLE_MergeTree: [ OK ] 1.02 sec. 2025-10-03 23:20:56 02501_analyzer_expired_context_crash_fix: [ OK ] 0.17 sec. 2025-10-03 23:20:56 02592_avro_more_types: [ OK ] 0.47 sec. 2025-10-03 23:20:56 01052_compression_buffer_overrun: [ OK ] 0.37 sec. 2025-10-03 23:20:56 01548_parallel_parsing_max_memory: [ OK ] 3.28 sec. 2025-10-03 23:20:56 00005_shard_format_ast_and_remote_table_lambda: [ OK ] 0.17 sec. 2025-10-03 23:20:57 02479_if_with_null_and_cullable_const: [ OK ] 0.12 sec. 2025-10-03 23:20:57 00948_to_valid_utf8: [ OK ] 0.57 sec. 2025-10-03 23:20:57 00587_union_all_type_conversions: [ OK ] 0.17 sec. 2025-10-03 23:20:57 01030_storage_set_supports_read: [ OK ] 0.17 sec. 2025-10-03 23:20:57 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ OK ] 48.17 sec. 2025-10-03 23:20:57 00688_low_cardinality_serialization: [ OK ] 1.22 sec. 2025-10-03 23:20:58 02560_agg_state_deserialization_hash_table_crash: [ OK ] 0.17 sec. 2025-10-03 23:20:58 02999_scalar_subqueries_bug_2: [ OK ] 0.12 sec. 2025-10-03 23:20:58 02267_jsonlines_ndjson_format: [ OK ] 0.17 sec. 2025-10-03 23:20:58 02878_use_structure_from_insertion_table_with_explicit_insert_columns: [ OK ] 0.47 sec. 2025-10-03 23:20:58 02789_jit_cannot_convert_column: [ OK ] 0.12 sec. 2025-10-03 23:20:58 01882_scalar_subquery_exception: [ OK ] 0.17 sec. 2025-10-03 23:20:58 00608_uniq_array: [ OK ] 0.12 sec. 2025-10-03 23:20:58 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 1.68 sec. 2025-10-03 23:20:58 00571_alter_nullable: [ OK ] 0.22 sec. 2025-10-03 23:20:58 01014_format_custom_separated: [ OK ] 1.17 sec. 2025-10-03 23:20:58 01710_minmax_count_projection_distributed_query: [ OK ] 0.17 sec. 2025-10-03 23:20:59 02028_tokens: [ OK ] 0.17 sec. 2025-10-03 23:20:59 02190_format_regexp_cr_in_the_middle: [ OK ] 0.42 sec. 2025-10-03 23:20:59 02483_password_reset: [ OK ] 0.54 sec. 2025-10-03 23:20:59 01444_create_table_drop_database_race: [ OK ] 10.40 sec. 2025-10-03 23:20:59 02575_merge_prewhere_default_expression: [ OK ] 0.17 sec. 2025-10-03 23:20:59 01258_wrong_cast_filimonov: [ OK ] 0.12 sec. 2025-10-03 23:20:59 02023_nullable_int_uint_where: [ OK ] 0.17 sec. 2025-10-03 23:20:59 03035_max_insert_threads_support: [ OK ] 0.52 sec. 2025-10-03 23:20:59 02525_different_engines_in_temporary_tables: [ OK ] 0.22 sec. 2025-10-03 23:20:59 02044_exists_operator: [ OK ] 0.17 sec. 2025-10-03 23:20:59 03093_virtual_column_override_group_by: [ OK ] 0.17 sec. 2025-10-03 23:20:59 02181_format_describe_query: [ OK ] 0.37 sec. 2025-10-03 23:20:59 00469_comparison_of_strings_containing_null_char: [ OK ] 0.17 sec. 2025-10-03 23:20:59 01421_assert_in_in: [ OK ] 0.12 sec. 2025-10-03 23:20:59 02493_analyzer_sum_if_to_count_if: [ OK ] 0.17 sec. 2025-10-03 23:20:59 01070_to_decimal_or_null_exception: [ OK ] 0.22 sec. 2025-10-03 23:20:59 00844_join_lightee2: [ OK ] 0.17 sec. 2025-10-03 23:21:00 02843_context_has_expired: [ OK ] 0.22 sec. 2025-10-03 23:21:00 03036_clamp: [ OK ] 0.22 sec. 2025-10-03 23:21:00 00609_prewhere_and_default: [ OK ] 0.42 sec. 2025-10-03 23:21:00 00957_delta_diff_bug: [ OK ] 0.17 sec. 2025-10-03 23:21:00 00810_in_operators_segfault: [ OK ] 0.12 sec. 2025-10-03 23:21:00 00700_decimal_bounds: [ OK ] 0.37 sec. 2025-10-03 23:21:00 02911_analyzer_order_by_read_in_order_query_plan: [ OK ] 0.67 sec. 2025-10-03 23:21:00 01781_map_op_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:21:00 01585_fuzz_bits_with_bugfix: [ OK ] 0.12 sec. 2025-10-03 23:21:00 02900_matview_create_to_errors: [ OK ] 0.42 sec. 2025-10-03 23:21:00 01080_check_for_error_incorrect_size_of_nested_column: [ OK ] 0.22 sec. 2025-10-03 23:21:00 02982_comments_in_system_tables: [ OK ] 0.47 sec. 2025-10-03 23:21:01 01755_client_highlight_multi_line_comment_regression: [ OK ] 0.42 sec. 2025-10-03 23:21:01 01034_sample_final_distributed: [ OK ] 0.57 sec. 2025-10-03 23:21:01 00945_ml_test: [ OK ] 0.37 sec. 2025-10-03 23:21:01 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.42 sec. 2025-10-03 23:21:01 00639_startsWith: [ OK ] 0.17 sec. 2025-10-03 23:21:01 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.02 sec. 2025-10-03 23:21:01 01891_not_in_partition_prune: [ OK ] 0.22 sec. 2025-10-03 23:21:01 01913_names_of_tuple_literal: [ OK ] 0.12 sec. 2025-10-03 23:21:01 03237_create_table_select_as_with_recursive: [ OK ] 0.12 sec. 2025-10-03 23:21:01 02029_output_csv_null_representation: [ OK ] 0.17 sec. 2025-10-03 23:21:01 02517_wrong_total_structure_crash: [ OK ] 0.17 sec. 2025-10-03 23:21:01 01804_uniq_up_to_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:21:01 02751_parallel_replicas_bug_chunkinfo_not_set: [ OK ] 0.17 sec. 2025-10-03 23:21:01 00917_multiple_joins_denny_crane: [ OK ] 0.17 sec. 2025-10-03 23:21:01 02504_bar_fractions: [ OK ] 0.12 sec. 2025-10-03 23:21:02 00483_reading_from_array_structure: [ OK ] 0.22 sec. 2025-10-03 23:21:02 01412_mod_float: [ OK ] 0.17 sec. 2025-10-03 23:21:02 02482_execute_functions_before_sorting_bug: [ OK ] 0.17 sec. 2025-10-03 23:21:02 00098_c_union_all: [ OK ] 0.12 sec. 2025-10-03 23:21:02 01119_session_log: [ OK ] 30.36 sec. 2025-10-03 23:21:02 00507_array_no_params: [ OK ] 0.62 sec. 2025-10-03 23:21:02 01268_mv_scalars: [ OK ] 0.32 sec. 2025-10-03 23:21:02 02400_memory_accounting_on_error: [ OK ] 0.17 sec. 2025-10-03 23:21:02 02997_projections_formatting: [ OK ] 0.12 sec. 2025-10-03 23:21:02 02251_alter_enum_nested_struct: [ OK ] 0.17 sec. 2025-10-03 23:21:02 01529_bad_memory_tracking: [ OK ] 1.17 sec. 2025-10-03 23:21:03 01011_test_create_as_skip_indices: [ OK ] 0.17 sec. 2025-10-03 23:21:03 02246_tsv_csv_best_effort_schema_inference: [ OK ] 7.09 sec. 2025-10-03 23:21:03 01888_bloom_filter_hasAny: [ OK ] 0.27 sec. 2025-10-03 23:21:03 02249_insert_select_from_input_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:21:03 00170_lower_upper_utf8: [ OK ] 0.27 sec. 2025-10-03 23:21:03 02985_minmax_index_aggregate_function: [ OK ] 0.22 sec. 2025-10-03 23:21:03 02900_limit_by_query_stage: [ OK ] 0.62 sec. 2025-10-03 23:21:03 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.27 sec. 2025-10-03 23:21:03 00151_tuple_with_array: [ OK ] 0.13 sec. 2025-10-03 23:21:03 02714_local_object_storage: [ OK ] 0.22 sec. 2025-10-03 23:21:03 02235_brotli_bug: [ OK ] 1.17 sec. 2025-10-03 23:21:04 00050_any_left_join: [ OK ] 0.12 sec. 2025-10-03 23:21:04 00396_uuid_v7: [ OK ] 0.32 sec. 2025-10-03 23:21:04 00751_default_databasename_for_view: [ OK ] 0.22 sec. 2025-10-03 23:21:04 01013_hex_float: [ OK ] 0.17 sec. 2025-10-03 23:21:04 02914_t64_buffer_overflow: [ OK ] 0.37 sec. 2025-10-03 23:21:04 02907_backup_mv_with_no_source_table: [ OK ] 1.42 sec. 2025-10-03 23:21:04 02973_s3_compressed_file_in_error_message: [ OK ] 0.42 sec. 2025-10-03 23:21:05 02877_optimize_read_in_order_from_view: [ OK ] 0.97 sec. 2025-10-03 23:21:05 02864_replace_partition_with_duplicated_parts_zookeeper: [ OK ] 1.82 sec. 2025-10-03 23:21:05 00570_empty_array_is_const: [ OK ] 0.12 sec. 2025-10-03 23:21:05 02908_alter_column_alias: [ OK ] 0.12 sec. 2025-10-03 23:21:05 02815_join_algorithm_setting: [ OK ] 0.77 sec. 2025-10-03 23:21:05 02227_union_match_by_name: [ OK ] 0.12 sec. 2025-10-03 23:21:05 01925_date_date_time_comparison: [ OK ] 0.12 sec. 2025-10-03 23:21:05 01640_marks_corruption_regression: [ OK ] 0.22 sec. 2025-10-03 23:21:05 00818_alias_bug_4110: [ OK ] 0.22 sec. 2025-10-03 23:21:05 03036_dynamic_read_subcolumns_wide_merge_tree: [ OK ] 1.52 sec. 2025-10-03 23:21:05 01702_toDateTime_from_string_clamping: [ OK ] 0.17 sec. 2025-10-03 23:21:06 00612_pk_in_tuple: [ OK ] 0.37 sec. 2025-10-03 23:21:06 02534_analyzer_grouping_function: [ OK ] 0.22 sec. 2025-10-03 23:21:06 02835_parallel_replicas_over_distributed: [ OK ] 0.27 sec. 2025-10-03 23:21:06 02419_contingency_array_nullable: [ OK ] 0.12 sec. 2025-10-03 23:21:06 02027_ngrams: [ OK ] 0.22 sec. 2025-10-03 23:21:06 00264_uniq_many_args: [ OK ] 0.32 sec. 2025-10-03 23:21:06 00072_in_types: [ OK ] 0.12 sec. 2025-10-03 23:21:06 02487_create_index_normalize_functions: [ OK ] 0.22 sec. 2025-10-03 23:21:06 03044_array_join_columns_in_nested_table: [ OK ] 0.17 sec. 2025-10-03 23:21:06 02971_functions_to_subcolumns_map: [ OK ] 0.17 sec. 2025-10-03 23:21:06 01825_type_json_18: [ OK ] 0.17 sec. 2025-10-03 23:21:06 03172_error_log_table_not_empty: [ OK ] 5.38 sec. 2025-10-03 23:21:06 02919_storage_fuzzjson: [ OK ] 0.22 sec. 2025-10-03 23:21:06 00712_prewhere_with_missing_columns_2: [ OK ] 0.17 sec. 2025-10-03 23:21:06 00372_cors_header: [ OK ] 0.37 sec. 2025-10-03 23:21:06 03017_analyzer_groupby_fuzz_61600: [ OK ] 0.17 sec. 2025-10-03 23:21:06 00511_get_size_of_enum: [ OK ] 0.12 sec. 2025-10-03 23:21:06 02347_rank_corr_size_overflow: [ OK ] 0.47 sec. 2025-10-03 23:21:07 02366_kql_func_scalar: [ OK ] 0.22 sec. 2025-10-03 23:21:07 02950_dictionary_ssd_cache_short_circuit: [ OK ] 0.47 sec. 2025-10-03 23:21:07 02203_shebang: [ OK ] 0.42 sec. 2025-10-03 23:21:08 00679_replace_asterisk: [ OK ] 0.17 sec. 2025-10-03 23:21:08 02293_optimize_aggregation_in_order_Array_functions: [ OK ] 0.17 sec. 2025-10-03 23:21:08 02158_proportions_ztest_cmp: [ OK ] 1.47 sec. 2025-10-03 23:21:08 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.17 sec. 2025-10-03 23:21:08 03160_pretty_format_tty: [ OK ] 0.42 sec. 2025-10-03 23:21:08 01649_with_alias_key_condition: [ OK ] 0.17 sec. 2025-10-03 23:21:08 01554_bloom_filter_index_big_integer_uuid: [ OK ] 0.27 sec. 2025-10-03 23:21:09 00944_create_bloom_filter_index_with_merge_tree: [ OK ] 2.07 sec. 2025-10-03 23:21:09 01700_deltasum: [ OK ] 0.17 sec. 2025-10-03 23:21:09 03040_dynamic_type_alters_2_wide_merge_tree: [ OK ] 0.37 sec. 2025-10-03 23:21:09 00821_distributed_storage_with_join_on: [ OK ] 0.22 sec. 2025-10-03 23:21:09 01926_bin_unbin: [ OK ] 0.22 sec. 2025-10-03 23:21:09 02815_analyzer_aggregate_functions_of_group_by_keys: [ OK ] 0.62 sec. 2025-10-03 23:21:09 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.17 sec. 2025-10-03 23:21:09 02383_schema_inference_hints: [ OK ] 0.17 sec. 2025-10-03 23:21:09 02876_yyyymmddhhmmsstodatetime: [ OK ] 0.57 sec. 2025-10-03 23:21:09 00534_functions_bad_arguments11: [ OK ] 5.64 sec. 2025-10-03 23:21:10 00811_garbage: [ OK ] 0.17 sec. 2025-10-03 23:21:10 00500_point_in_polygon_nan: [ OK ] 0.12 sec. 2025-10-03 23:21:10 01435_lcm_overflow: [ OK ] 0.17 sec. 2025-10-03 23:21:10 00216_bit_test_function_family: [ OK ] 0.17 sec. 2025-10-03 23:21:10 01870_modulo_partition_key: [ OK ] 0.57 sec. 2025-10-03 23:21:10 02863_interpolate_subquery: [ OK ] 0.17 sec. 2025-10-03 23:21:10 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 0.57 sec. 2025-10-03 23:21:10 03043_group_array_result_is_expected: [ OK ] 0.17 sec. 2025-10-03 23:21:10 01825_new_type_json_3: [ OK ] 0.37 sec. 2025-10-03 23:21:10 02304_grouping_sets_with_rollup_cube: [ OK ] 0.12 sec. 2025-10-03 23:21:11 01015_insert_values_parametrized: [ OK ] 0.97 sec. 2025-10-03 23:21:11 02661_read_from_archive_tarbzip2: [ OK ] 4.08 sec. 2025-10-03 23:21:11 01686_rocksdb: [ OK ] 0.32 sec. 2025-10-03 23:21:11 00940_max_parts_in_total: [ OK ] 0.17 sec. 2025-10-03 23:21:11 02994_merge_tree_mutations_cleanup: [ OK ] 10.25 sec. 2025-10-03 23:21:11 01544_errorCodeToName: [ OK ] 0.12 sec. 2025-10-03 23:21:11 02150_replace_regexp_all_empty_match: [ OK ] 0.12 sec. 2025-10-03 23:21:11 02424_pod_array_overflow: [ OK ] 0.12 sec. 2025-10-03 23:21:11 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.17 sec. 2025-10-03 23:21:11 01081_demangle: [ OK ] 0.12 sec. 2025-10-03 23:21:12 01180_client_syntax_errors: [ OK ] 0.42 sec. 2025-10-03 23:21:12 02771_multiple_query_arguments: [ OK ] 1.32 sec. 2025-10-03 23:21:12 02154_parser_backtracking: [ OK ] 1.52 sec. 2025-10-03 23:21:12 02303_query_kind: [ OK ] 0.69 sec. 2025-10-03 23:21:12 00098_shard_i_union_all: [ OK ] 0.22 sec. 2025-10-03 23:21:13 01008_materialized_view_henyihanwobushi: [ OK ] 0.22 sec. 2025-10-03 23:21:13 02225_parallel_distributed_insert_select_view: [ OK ] 0.67 sec. 2025-10-03 23:21:13 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.17 sec. 2025-10-03 23:21:13 00506_union_distributed: [ OK ] 0.32 sec. 2025-10-03 23:21:13 00979_set_index_not: [ OK ] 0.17 sec. 2025-10-03 23:21:13 02408_to_fixed_string_short_circuit: [ OK ] 0.12 sec. 2025-10-03 23:21:13 02987_group_array_intersect: [ OK ] 0.92 sec. 2025-10-03 23:21:13 01720_constraints_complex_types: [ OK ] 0.22 sec. 2025-10-03 23:21:13 03004_json_named_tuples_inference_ambiguous_paths_as_string: [ OK ] 0.12 sec. 2025-10-03 23:21:13 02497_analyzer_sum_if_count_if_pass_crash_fix: [ OK ] 0.12 sec. 2025-10-03 23:21:13 01482_move_to_prewhere_and_cast: [ OK ] 0.17 sec. 2025-10-03 23:21:14 02243_ipv6_long_parsing: [ OK ] 0.17 sec. 2025-10-03 23:21:14 02482_insert_into_dist_race: [ OK ] 0.17 sec. 2025-10-03 23:21:14 02916_distributed_skip_unavailable_shards: [ OK ] 0.17 sec. 2025-10-03 23:21:14 03120_analyzer_dist_join: [ OK ] 0.37 sec. 2025-10-03 23:21:14 00465_nullable_default: [ OK ] 0.12 sec. 2025-10-03 23:21:14 03036_reading_s3_archives: [ OK ] 0.47 sec. 2025-10-03 23:21:14 02341_global_join_cte: [ OK ] 0.22 sec. 2025-10-03 23:21:14 03032_storage_memory_modify_settings: [ OK ] 0.32 sec. 2025-10-03 23:21:14 01550_mutation_subquery: [ OK ] 0.17 sec. 2025-10-03 23:21:14 00393_if_with_constant_condition: [ OK ] 0.17 sec. 2025-10-03 23:21:14 01865_aggregator_overflow_row: [ OK ] 0.17 sec. 2025-10-03 23:21:15 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.17 sec. 2025-10-03 23:21:15 01067_join_null: [ OK ] 0.12 sec. 2025-10-03 23:21:15 01448_json_compact_strings_each_row: [ OK ] 0.37 sec. 2025-10-03 23:21:15 00856_no_column_issue_4242: [ OK ] 0.17 sec. 2025-10-03 23:21:15 02494_combinators_with_null_argument: [ OK ] 0.17 sec. 2025-10-03 23:21:15 02021_prewhere_column_optimization: [ OK ] 0.17 sec. 2025-10-03 23:21:15 02481_prewhere_filtered_rows_div_by_zero: [ OK ] 0.32 sec. 2025-10-03 23:21:15 02559_multiple_read_steps_in_prewhere_missing_columns: [ OK ] 0.42 sec. 2025-10-03 23:21:15 02725_memory-for-merges: [ OK ] 3.88 sec. 2025-10-03 23:21:15 01690_quantilesTiming_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:21:15 02795_full_join_assert_cast: [ OK ] 0.12 sec. 2025-10-03 23:21:15 02140_clickhouse_local_queries_file_table: [ OK ] 0.42 sec. 2025-10-03 23:21:15 01586_columns_pruning: [ OK ] 0.27 sec. 2025-10-03 23:21:15 00819_full_join_wrong_columns_in_block: [ OK ] 0.17 sec. 2025-10-03 23:21:15 03148_asof_join_ddb_subquery: [ OK ] 0.17 sec. 2025-10-03 23:21:16 01075_allowed_client_hosts: [ OK ] 0.17 sec. 2025-10-03 23:21:16 03013_hop_infinite_loop: [ OK ] 0.12 sec. 2025-10-03 23:21:16 03003_functions_to_subcolumns_final: [ OK ] 0.22 sec. 2025-10-03 23:21:16 03167_boom_filter_index_with_map: [ OK ] 0.52 sec. 2025-10-03 23:21:16 02915_analyzer_fuzz_6: [ OK ] 0.17 sec. 2025-10-03 23:21:16 01543_collate_in_tuple: [ OK ] 0.22 sec. 2025-10-03 23:21:16 02707_skip_index_with_in: [ OK ] 0.17 sec. 2025-10-03 23:21:16 02967_index_hint_crash: [ OK ] 0.17 sec. 2025-10-03 23:21:16 00736_disjunction_optimisation: [ OK ] 0.27 sec. 2025-10-03 23:21:16 01065_if_not_finite: [ OK ] 0.17 sec. 2025-10-03 23:21:16 02771_resolve_compound_identifier: [ OK ] 0.17 sec. 2025-10-03 23:21:16 00126_buffer: [ OK ] 0.32 sec. 2025-10-03 23:21:16 01358_constexpr_constraint: [ OK ] 0.12 sec. 2025-10-03 23:21:17 01523_client_local_queries_file_parameter: [ OK ] 0.77 sec. 2025-10-03 23:21:17 01332_join_type_syntax_position: [ OK ] 0.22 sec. 2025-10-03 23:21:17 02233_optimize_aggregation_in_order_prefix_with_merge: [ OK ] 0.17 sec. 2025-10-03 23:21:17 02480_max_map_null_totals: [ OK ] 0.42 sec. 2025-10-03 23:21:17 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.32 sec. 2025-10-03 23:21:17 00750_merge_tree_merge_with_o_direct: [ OK ] 0.22 sec. 2025-10-03 23:21:17 02022_storage_filelog_one_file: [ OK ] 1.12 sec. 2025-10-03 23:21:17 01040_distributed_background_insert_batch_inserts: [ OK ] 0.32 sec. 2025-10-03 23:21:17 01083_log_first_column_alias: [ OK ] 0.17 sec. 2025-10-03 23:21:17 03199_has_lc_fixed_string: [ OK ] 0.17 sec. 2025-10-03 23:21:17 02475_analyzer_subquery_compound_expression: [ OK ] 0.12 sec. 2025-10-03 23:21:17 00937_template_output_format: [ OK ] 0.77 sec. 2025-10-03 23:21:18 02499_escaped_quote_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:21:18 01073_show_tables_not_like: [ OK ] 0.22 sec. 2025-10-03 23:21:18 00293_shard_max_subquery_depth: [ OK ] 0.17 sec. 2025-10-03 23:21:18 01409_topK_merge: [ OK ] 0.17 sec. 2025-10-03 23:21:18 00906_low_cardinality_const_argument: [ OK ] 0.12 sec. 2025-10-03 23:21:18 01012_serialize_array_memory_usage: [ OK ] 0.22 sec. 2025-10-03 23:21:18 00176_if_string_arrays: [ OK ] 0.17 sec. 2025-10-03 23:21:18 00839_bitmask_negative: [ OK ] 0.17 sec. 2025-10-03 23:21:18 01256_misspell_layout_name_podshumok: [ OK ] 0.12 sec. 2025-10-03 23:21:18 03035_recursive_cte_postgres_1: [ OK ] 0.27 sec. 2025-10-03 23:21:19 00336_shard_stack_trace: [ OK ] 0.67 sec. 2025-10-03 23:21:19 01547_query_log_current_database: [ OK ] 0.37 sec. 2025-10-03 23:21:20 03214_backup_and_clear_old_temporary_directories: [ OK ] 2.22 sec. 2025-10-03 23:21:20 02352_interactive_queries_from_file: [ OK ] 0.47 sec. 2025-10-03 23:21:20 01034_values_parse_float_bug: [ OK ] 1.37 sec. 2025-10-03 23:21:21 01493_alter_remove_wrong_default: [ OK ] 0.17 sec. 2025-10-03 23:21:21 02867_storage_set_tsan: [ OK ] 10.51 sec. 2025-10-03 23:21:21 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:21:21 03122_analyzer_collate_in_window_function: [ OK ] 0.17 sec. 2025-10-03 23:21:21 01425_decimal_parse_big_negative_exponent: [ OK ] 0.17 sec. 2025-10-03 23:21:21 02918_alter_temporary_table: [ OK ] 0.17 sec. 2025-10-03 23:21:21 01801_approx_total_rows_mergetree_reverse: [ OK ] 0.17 sec. 2025-10-03 23:21:21 00213_multiple_global_in: [ OK ] 0.12 sec. 2025-10-03 23:21:22 02458_relax_too_many_parts: [ OK ] 0.27 sec. 2025-10-03 23:21:22 00953_constraints_operations: [ OK ] 1.37 sec. 2025-10-03 23:21:22 02559_ip_types_bloom: [ OK ] 0.17 sec. 2025-10-03 23:21:22 01278_format_multiple_queries: [ OK ] 0.32 sec. 2025-10-03 23:21:22 01034_move_partition_from_table_zookeeper: [ OK ] 35.67 sec. 2025-10-03 23:21:22 03261_sort_cursor_crash: [ OK ] 0.22 sec. 2025-10-03 23:21:22 03040_dynamic_type_alters_2_compact_merge_tree: [ OK ] 0.32 sec. 2025-10-03 23:21:22 02816_clickhouse_local_table_name_expressions: [ OK ] 3.89 sec. 2025-10-03 23:21:22 02833_local_with_dialect: [ OK ] 0.42 sec. 2025-10-03 23:21:23 00729_prewhere_array_join: [ OK ] 0.27 sec. 2025-10-03 23:21:23 01079_window_view_inner_table_memory_tumble: [ OK ] 0.97 sec. 2025-10-03 23:21:23 01932_alter_index_with_order: [ OK ] 0.17 sec. 2025-10-03 23:21:23 01717_int_div_float_too_large_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:21:23 01042_check_query_and_last_granule_size: [ OK ] 0.27 sec. 2025-10-03 23:21:23 00949_format: [ OK ] 0.92 sec. 2025-10-03 23:21:23 01333_select_abc_asterisk: [ OK ] 0.17 sec. 2025-10-03 23:21:23 01825_type_json_bools: [ OK ] 0.12 sec. 2025-10-03 23:21:24 02247_fix_extract_parser: [ OK ] 0.17 sec. 2025-10-03 23:21:24 02461_alter_update_respect_part_column_type_bug: [ OK ] 1.77 sec. 2025-10-03 23:21:24 02368_analyzer_table_functions: [ OK ] 0.17 sec. 2025-10-03 23:21:24 02707_keeper_map_delete_update_strict: [ OK ] 0.27 sec. 2025-10-03 23:21:24 01823_explain_json: [ OK ] 0.92 sec. 2025-10-03 23:21:24 03243_create_or_replace_view_dependency_check: [ OK ] 0.17 sec. 2025-10-03 23:21:24 01421_array_nullable_element_nullable_index: [ OK ] 0.12 sec. 2025-10-03 23:21:24 01125_generate_random_qoega: [ OK ] 0.32 sec. 2025-10-03 23:21:24 00988_expansion_aliases_limit: [ OK ] 0.12 sec. 2025-10-03 23:21:24 00968_roundAge: [ OK ] 0.17 sec. 2025-10-03 23:21:24 00803_odbc_driver_2_format: [ OK ] 0.12 sec. 2025-10-03 23:21:25 01662_date_ubsan: [ OK ] 0.37 sec. 2025-10-03 23:21:25 00929_multi_match_edit_distance: [ OK ] 0.62 sec. 2025-10-03 23:21:25 01515_logtrace_function: [ OK ] 0.42 sec. 2025-10-03 23:21:25 01853_s2_cells_intersect: [ OK ] 0.17 sec. 2025-10-03 23:21:25 00018_distinct_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:21:25 02241_join_rocksdb_bs: [ OK ] 2.07 sec. 2025-10-03 23:21:25 01659_array_aggregation_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:21:25 03094_transform_return_first: [ OK ] 0.12 sec. 2025-10-03 23:21:25 00031_parser_number: [ OK ] 0.12 sec. 2025-10-03 23:21:25 00359_convert_or_zero_functions: [ OK ] 0.12 sec. 2025-10-03 23:21:25 02148_cast_type_parsing: [ OK ] 0.12 sec. 2025-10-03 23:21:25 02183_dictionary_no_attributes: [ OK ] 0.47 sec. 2025-10-03 23:21:26 02767_into_outfile_extensions_msan: [ OK ] 0.42 sec. 2025-10-03 23:21:26 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 1.12 sec. 2025-10-03 23:21:27 01491_nested_multiline_comments: [ OK ] 0.12 sec. 2025-10-03 23:21:27 02932_kill_query_sleep: [ OK ] 1.72 sec. 2025-10-03 23:21:27 00279_quantiles_permuted_args: [ OK ] 0.17 sec. 2025-10-03 23:21:27 00263_merge_aggregates_and_overflow: [ OK ] 0.17 sec. 2025-10-03 23:21:27 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 1.17 sec. 2025-10-03 23:21:27 02900_clickhouse_local_drop_current_database: [ OK ] 0.42 sec. 2025-10-03 23:21:27 02918_sqlite_path_check: [ OK ] 0.52 sec. 2025-10-03 23:21:28 00673_subquery_prepared_set_performance: [ OK ] 0.27 sec. 2025-10-03 23:21:28 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.37 sec. 2025-10-03 23:21:28 03199_unbin_buffer_overflow: [ OK ] 2.93 sec. 2025-10-03 23:21:28 02681_final_excessive_reading_bug: [ OK ] 1.07 sec. 2025-10-03 23:21:28 03128_argMin_combinator_projection: [ OK ] 0.22 sec. 2025-10-03 23:21:28 02919_ddsketch_quantile: [ OK ] 0.27 sec. 2025-10-03 23:21:29 00163_shard_join_with_empty_table: [ OK ] 0.62 sec. 2025-10-03 23:21:30 01170_alter_partition_isolation: [ OK ] 2.18 sec. 2025-10-03 23:21:30 02783_parsedatetimebesteffort_syslog: [ OK ] 0.17 sec. 2025-10-03 23:21:31 01882_check_max_parts_to_merge_at_once: [ OK ] 0.57 sec. 2025-10-03 23:21:31 02692_multiple_joins_unicode: [ OK ] 0.17 sec. 2025-10-03 23:21:31 03045_unknown_identifier_alias_substitution: [ OK ] 0.17 sec. 2025-10-03 23:21:33 03037_dynamic_merges_1_horizontal_compact_merge_tree: [ OK ] 1.72 sec. 2025-10-03 23:21:33 02560_count_digits: [ OK ] 0.17 sec. 2025-10-03 23:21:34 02806_system_parts_columns_modification_time: [ OK ] 6.19 sec. 2025-10-03 23:21:34 00117_parsing_arrays: [ OK ] 0.17 sec. 2025-10-03 23:21:34 02097_json_strings_deserialization: [ OK ] 1.02 sec. 2025-10-03 23:21:34 02032_short_circuit_least_greatest_bug: [ OK ] 0.12 sec. 2025-10-03 23:21:34 01692_DateTime64_from_DateTime: [ OK ] 0.17 sec. 2025-10-03 23:21:34 01397_in_bad_arguments: [ OK ] 0.12 sec. 2025-10-03 23:21:35 01297_alter_distributed: [ OK ] 0.22 sec. 2025-10-03 23:21:35 00981_no_virtual_columns: [ OK ] 0.17 sec. 2025-10-03 23:21:35 01356_state_resample: [ OK ] 0.17 sec. 2025-10-03 23:21:35 00256_reverse: [ OK ] 0.17 sec. 2025-10-03 23:21:35 02373_progress_contain_result: [ OK ] 0.32 sec. 2025-10-03 23:21:35 00507_sumwithoverflow: [ OK ] 0.12 sec. 2025-10-03 23:21:35 00746_hashing_tuples: [ OK ] 0.17 sec. 2025-10-03 23:21:35 02511_complex_literals_as_aggregate_function_parameters: [ OK ] 0.17 sec. 2025-10-03 23:21:35 02891_functions_over_sparse_columns: [ OK ] 0.17 sec. 2025-10-03 23:21:36 02562_regexp_extract: [ OK ] 0.32 sec. 2025-10-03 23:21:37 02470_mutation_sync_race: [ OK ] 30.61 sec. 2025-10-03 23:21:37 02220_array_join_format: [ OK ] 0.12 sec. 2025-10-03 23:21:37 01759_optimize_skip_unused_shards_zero_shards: [ OK ] 0.12 sec. 2025-10-03 23:21:37 03093_analyzer_miel_test: [ OK ] 0.17 sec. 2025-10-03 23:21:37 02370_lost_part_intersecting_merges: [ OK ] 9.39 sec. 2025-10-03 23:21:38 02377_executable_function_settings: [ OK ] 0.22 sec. 2025-10-03 23:21:38 01825_new_type_json_ghdata: [ OK ] 2.02 sec. 2025-10-03 23:21:38 01272_suspicious_codecs: [ OK ] 0.67 sec. 2025-10-03 23:21:38 03252_fill_missed_arrays: [ OK ] 0.22 sec. 2025-10-03 23:21:38 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.17 sec. 2025-10-03 23:21:38 02705_protobuf_debug_abort: [ OK ] 0.42 sec. 2025-10-03 23:21:38 01085_window_view_attach: [ OK ] 0.22 sec. 2025-10-03 23:21:38 01443_merge_truncate_long: [ OK ] 15.61 sec. 2025-10-03 23:21:38 00934_is_valid_utf8: [ OK ] 0.57 sec. 2025-10-03 23:21:39 00408_http_keep_alive: [ OK ] 0.37 sec. 2025-10-03 23:21:39 03216_arrayWithConstant_limits: [ OK ] 3.28 sec. 2025-10-03 23:21:39 00700_decimal_null: [ OK ] 0.27 sec. 2025-10-03 23:21:39 01416_clear_column_pk: [ OK ] 0.17 sec. 2025-10-03 23:21:39 01045_array_zip: [ OK ] 0.22 sec. 2025-10-03 23:21:39 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.22 sec. 2025-10-03 23:21:39 02572_query_views_log_background_thread: [ OK ] 10.20 sec. 2025-10-03 23:21:39 01090_zookeeper_mutations_and_insert_quorum_long: [ OK ] 0.57 sec. 2025-10-03 23:21:39 00027_argMinMax: [ OK ] 0.17 sec. 2025-10-03 23:21:39 00940_order_by_read_in_order_query_plan: [ OK ] 0.72 sec. 2025-10-03 23:21:39 00571_non_exist_database_when_create_materializ_view: [ OK ] 0.17 sec. 2025-10-03 23:21:39 03033_from_unixtimestamp_joda_by_int64: [ OK ] 0.12 sec. 2025-10-03 23:21:40 00836_numbers_table_function_zero: [ OK ] 0.17 sec. 2025-10-03 23:21:40 02526_kv_engine_different_filter_type: [ OK ] 0.27 sec. 2025-10-03 23:21:40 01079_new_range_reader_segfault: [ OK ] 0.17 sec. 2025-10-03 23:21:40 01511_different_expression_with_same_alias: [ OK ] 0.17 sec. 2025-10-03 23:21:40 00936_substring_utf8_non_const: [ OK ] 1.52 sec. 2025-10-03 23:21:40 01380_nullable_state: [ OK ] 0.37 sec. 2025-10-03 23:21:40 02431_single_value_or_null_empty: [ OK ] 0.17 sec. 2025-10-03 23:21:40 01113_local_dictionary_type_conversion: [ OK ] 0.12 sec. 2025-10-03 23:21:40 02862_uuid_reinterpret_as_numeric: [ OK ] 0.17 sec. 2025-10-03 23:21:40 01442_merge_detach_attach_long: [ OK ] 30.21 sec. 2025-10-03 23:21:40 00394_replaceall_vector_fixed: [ OK ] 0.17 sec. 2025-10-03 23:21:40 03173_set_transformed_partition_pruning: [ OK ] 1.62 sec. 2025-10-03 23:21:40 01293_client_interactive_vertical_singleline: [ OK ] 0.42 sec. 2025-10-03 23:21:40 01039_test_setting_parse: [ OK ] 0.17 sec. 2025-10-03 23:21:40 02963_test_flexible_disk_configuration: [ OK ] 0.47 sec. 2025-10-03 23:21:40 02768_cse_nested_distributed: [ OK ] 0.22 sec. 2025-10-03 23:21:41 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.57 sec. 2025-10-03 23:21:41 00011_array_join_alias: [ OK ] 0.17 sec. 2025-10-03 23:21:41 02540_duplicate_primary_key2: [ OK ] 0.12 sec. 2025-10-03 23:21:41 00720_combinations_of_aggregate_combinators: [ OK ] 0.17 sec. 2025-10-03 23:21:41 02688_aggregate_states: [ OK ] 0.22 sec. 2025-10-03 23:21:41 01770_extended_range_3: [ OK ] 0.17 sec. 2025-10-03 23:21:41 01055_compact_parts_granularity: [ OK ] 1.17 sec. 2025-10-03 23:21:41 01259_dictionary_custom_settings_ddl: [ OK ] 0.22 sec. 2025-10-03 23:21:41 00056_join_number_string: [ OK ] 0.12 sec. 2025-10-03 23:21:41 01101_prewhere_after_alter: [ OK ] 0.27 sec. 2025-10-03 23:21:41 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.53 sec. 2025-10-03 23:21:42 02592_avro_records_with_same_names: [ OK ] 0.47 sec. 2025-10-03 23:21:42 02896_union_distinct_http_format: [ OK ] 0.37 sec. 2025-10-03 23:21:42 01051_all_join_engine: [ OK ] 0.42 sec. 2025-10-03 23:21:42 03222_json_squashing: [ OK ] 0.83 sec. 2025-10-03 23:21:42 02401_merge_tree_old_tmp_dirs_cleanup: [ OK ] 1.17 sec. 2025-10-03 23:21:42 01753_fix_clickhouse_format: [ OK ] 0.47 sec. 2025-10-03 23:21:43 02157_readonly_system_suspend: [ OK ] 0.42 sec. 2025-10-03 23:21:43 02869_parallel_replicas_read_from_several: [ OK ] 0.42 sec. 2025-10-03 23:21:43 01515_with_global_and_with_propagation: [ OK ] 0.22 sec. 2025-10-03 23:21:43 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.17 sec. 2025-10-03 23:21:43 02212_cte_and_table_alias: [ OK ] 0.17 sec. 2025-10-03 23:21:43 01024__getScalar: [ OK ] 0.13 sec. 2025-10-03 23:21:43 02801_transform_nullable: [ OK ] 0.17 sec. 2025-10-03 23:21:43 03066_analyzer_global_with_statement: [ OK ] 0.17 sec. 2025-10-03 23:21:43 02898_parallel_replicas_custom_key_final: [ OK ] 0.27 sec. 2025-10-03 23:21:43 02870_move_partition_to_volume_io_throttling: [ OK ] 4.43 sec. 2025-10-03 23:21:44 01666_great_circle_distance_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:21:44 00298_enum_width_and_cast: [ OK ] 0.27 sec. 2025-10-03 23:21:44 02526_merge_join_int_decimal: [ OK ] 0.42 sec. 2025-10-03 23:21:44 00989_parallel_parts_loading: [ OK ] 2.48 sec. 2025-10-03 23:21:44 02205_postgresql_functions: [ OK ] 0.37 sec. 2025-10-03 23:21:45 02676_kafka_murmur_hash: [ OK ] 0.12 sec. 2025-10-03 23:21:45 02875_clickhouse_local_multiquery: [ OK ] 0.81 sec. 2025-10-03 23:21:45 00752_low_cardinality_array_result: [ OK ] 0.12 sec. 2025-10-03 23:21:45 03218_materialize_msan: [ OK ] 0.17 sec. 2025-10-03 23:21:45 00098_d_union_all: [ OK ] 0.18 sec. 2025-10-03 23:21:45 01425_default_value_of_type_name: [ OK ] 0.13 sec. 2025-10-03 23:21:45 00977_join_use_nulls_denny_crane: [ OK ] 0.38 sec. 2025-10-03 23:21:45 00456_alter_nullable: [ OK ] 0.22 sec. 2025-10-03 23:21:45 00567_parse_datetime_as_unix_timestamp: [ OK ] 0.12 sec. 2025-10-03 23:21:45 01018_ambiguous_column: [ OK ] 0.22 sec. 2025-10-03 23:21:45 01456_ast_optimizations_over_distributed: [ OK ] 0.32 sec. 2025-10-03 23:21:46 02155_h3_to_center_child: [ OK ] 0.57 sec. 2025-10-03 23:21:46 02815_no_throw_in_simple_queries: [ FAIL ] 0.93 sec. 2025-10-03 23:21:46 Reason: return code: 1 2025-10-03 23:21:46 send: spawn id exp3 not open 2025-10-03 23:21:46 while executing 2025-10-03 23:21:46 "send -- "SELECT 1\r"" 2025-10-03 23:21:46 , result: 2025-10-03 23:21:46 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 2025-10-03 23:21:46 stdout: 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 Failed 2025-10-03 23:21:46 2025-10-03 23:21:46 2025-10-03 23:21:46 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 10375258 --max_read_buffer_size 659559 --prefer_localhost_replica 1 --max_block_size 55202 --max_joined_block_size_rows 38087 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 29 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 21208012 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 24 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 8415133502 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1638427045 --min_compress_block_size 2218837 --max_compress_block_size 1199026 --merge_tree_compact_parts_min_granules_to_multibuffer_read 13 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 5752738 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone Africa/Khartoum --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.05 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 1 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2025-10-03 23:21:46 2025-10-03 23:21:46 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 132679715 --index_granularity_bytes 1491609 --merge_max_block_size 4545 --index_granularity 3627 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 47970 --primary_key_compress_block_size 80426 --replace_long_file_name_to_hash 1 --max_file_name_length 128 --min_bytes_for_full_part_storage 43307732 --compact_parts_max_bytes_to_buffer 451296081 --compact_parts_max_granules_to_buffer 28 --compact_parts_merge_max_bytes_to_prefetch_part 14582145 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 0 --old_parts_lifetime 480 2025-10-03 23:21:46 2025-10-03 23:21:46 Database: test_i653x5cr 2025-10-03 23:21:46 02845_parquet_odd_decimals: [ OK ] 0.73 sec. 2025-10-03 23:21:46 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.17 sec. 2025-10-03 23:21:47 01544_fromModifiedJulianDay: [ OK ] 0.22 sec. 2025-10-03 23:21:47 01925_broken_partition_id_zookeeper: [ OK ] 0.22 sec. 2025-10-03 23:21:47 01535_decimal_round_scale_overflow_check: [ OK ] 0.17 sec. 2025-10-03 23:21:47 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.17 sec. 2025-10-03 23:21:47 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:21:48 01746_long_zlib_http_compression_json_format: [ OK ] 0.52 sec. 2025-10-03 23:21:48 00754_alter_modify_order_by_replicated_zookeeper_long: [ OK ] 30.43 sec. 2025-10-03 23:21:48 02366_decimal_agg_state_conversion: [ OK ] 0.22 sec. 2025-10-03 23:21:48 02887_format_readable_timedelta_subseconds: [ OK ] 0.17 sec. 2025-10-03 23:21:48 03093_analyzer_column_alias: [ OK ] 0.18 sec. 2025-10-03 23:21:49 00979_toFloat_monotonicity: [ OK ] 0.32 sec. 2025-10-03 23:21:49 02956_rocksdb_bulk_sink: [ OK ] 5.58 sec. 2025-10-03 23:21:49 02724_delay_mutations: [ OK ] 3.29 sec. 2025-10-03 23:21:49 03221_mutation_analyzer_skip_part: [ OK ] 0.59 sec. 2025-10-03 23:21:49 00606_quantiles_and_nans: [ OK ] 0.14 sec. 2025-10-03 23:21:49 02865_tcp_proxy_query_packet_validation: [ OK ] 0.42 sec. 2025-10-03 23:21:49 01732_bigint_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:21:49 00047_stored_aggregates_complex: [ OK ] 0.22 sec. 2025-10-03 23:21:49 02025_nested_func_for_if_combinator: [ OK ] 0.17 sec. 2025-10-03 23:21:49 02353_simdjson_buffer_overflow: [ OK ] 3.13 sec. 2025-10-03 23:21:49 01419_merge_tree_settings_sanity_check: [ OK ] 0.17 sec. 2025-10-03 23:21:50 02011_normalize_utf8: [ OK ] 0.32 sec. 2025-10-03 23:21:50 03130_analyzer_self_join_group_by: [ OK ] 0.27 sec. 2025-10-03 23:21:50 01674_clickhouse_client_query_param_cte: [ OK ] 0.47 sec. 2025-10-03 23:21:50 02565_analyzer_limit_settings: [ OK ] 0.27 sec. 2025-10-03 23:21:50 02429_combinators_in_array_reduce: [ OK ] 0.17 sec. 2025-10-03 23:21:50 01248_least_greatest_mixed_const: [ OK ] 0.12 sec. 2025-10-03 23:21:50 02022_bzip2_truncated: [ OK ] 1.02 sec. 2025-10-03 23:21:50 02426_pod_array_overflow_3: [ OK ] 0.12 sec. 2025-10-03 23:21:51 01523_date_time_compare_with_date_literal: [ OK ] 0.47 sec. 2025-10-03 23:21:51 02160_h3_cell_area_rads2: [ OK ] 0.22 sec. 2025-10-03 23:21:51 01715_background_checker_blather_zookeeper_long: [ OK ] 10.26 sec. 2025-10-03 23:21:51 03167_fancy_quotes_off_by_one: [ OK ] 0.12 sec. 2025-10-03 23:21:51 00125_array_element_of_array_of_tuple: [ OK ] 0.12 sec. 2025-10-03 23:21:51 01532_collate_in_low_cardinality: [ OK ] 0.22 sec. 2025-10-03 23:21:51 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.17 sec. 2025-10-03 23:21:51 01671_merge_join_and_constants: [ OK ] 0.22 sec. 2025-10-03 23:21:51 00181_aggregate_functions_statistics_stable: [ OK ] 0.32 sec. 2025-10-03 23:21:51 01006_ttl_with_default_2: [ OK ] 1.57 sec. 2025-10-03 23:21:51 02004_intersect_except_distinct_operators: [ OK ] 0.58 sec. 2025-10-03 23:21:52 01561_Date_and_DateTime64_comparision: [ OK ] 0.12 sec. 2025-10-03 23:21:52 00967_insert_into_distributed_different_types: [ OK ] 0.17 sec. 2025-10-03 23:21:52 02668_column_block_number: [ OK ] 0.27 sec. 2025-10-03 23:21:52 02916_date_text_parsing: [ OK ] 0.33 sec. 2025-10-03 23:21:52 02518_rewrite_aggregate_function_with_if: [ OK ] 0.17 sec. 2025-10-03 23:21:53 01029_early_constant_folding: [ OK ] 0.12 sec. 2025-10-03 23:21:53 02345_partial_sort_transform_optimization: [ OK ] 0.17 sec. 2025-10-03 23:21:53 01165_lost_part_empty_partition: [ OK ] 2.78 sec. 2025-10-03 23:21:53 00618_nullable_in: [ OK ] 0.13 sec. 2025-10-03 23:21:53 00099_join_many_blocks_segfault: [ OK ] 0.17 sec. 2025-10-03 23:21:53 02122_parallel_formatting_Pretty: [ OK ] 2.23 sec. 2025-10-03 23:21:54 03209_parameterized_view_with_non_literal_params: [ OK ] 0.52 sec. 2025-10-03 23:21:54 01288_shard_max_network_bandwidth: [ OK ] 2.64 sec. 2025-10-03 23:21:54 03032_string_to_variant_cast: [ OK ] 0.22 sec. 2025-10-03 23:21:54 00825_protobuf_format_squares: [ OK ] 1.52 sec. 2025-10-03 23:21:54 01213_optimize_skip_unused_shards_DISTINCT: [ OK ] 0.27 sec. 2025-10-03 23:21:55 02675_profile_events_from_query_log_and_client: [ OK ] 1.53 sec. 2025-10-03 23:21:55 02456_aggregate_state_conversion: [ OK ] 0.12 sec. 2025-10-03 23:21:55 02111_with_fill_no_rows: [ OK ] 0.18 sec. 2025-10-03 23:21:55 03148_async_queries_in_query_log_errors: [ OK ] 1.02 sec. 2025-10-03 23:21:55 01710_projection_in_set: [ OK ] 0.22 sec. 2025-10-03 23:21:55 01643_merge_tree_fsync_smoke: [ OK ] 0.47 sec. 2025-10-03 23:21:55 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.17 sec. 2025-10-03 23:21:55 00500_point_in_polygon_2d_const: [ OK ] 0.22 sec. 2025-10-03 23:21:55 03130_convert_outer_join_to_inner_join: [ OK ] 0.22 sec. 2025-10-03 23:21:56 02966_float32_promotion: [ OK ] 0.17 sec. 2025-10-03 23:21:56 02992_settings_overflow: [ OK ] 0.12 sec. 2025-10-03 23:21:56 00941_system_columns_race_condition: [ OK ] 15.20 sec. 2025-10-03 23:21:56 02366_kql_create_table: [ OK ] 0.17 sec. 2025-10-03 23:21:56 00984_materialized_view_to_columns: [ OK ] 0.17 sec. 2025-10-03 23:21:56 01764_collapsing_merge_adaptive_granularity: [ OK ] 0.22 sec. 2025-10-03 23:21:56 00096_aggregation_min_if: [ OK ] 1.58 sec. 2025-10-03 23:21:56 01375_GROUP_BY_injective_elimination_dictGet_BAD_ARGUMENTS: [ OK ] 0.12 sec. 2025-10-03 23:21:56 01049_window_view_window_functions: [ OK ] 0.32 sec. 2025-10-03 23:21:57 01062_alter_on_mutataion_zookeeper_long: [ OK ] 0.62 sec. 2025-10-03 23:21:57 02535_ip_parser_not_whole: [ OK ] 0.17 sec. 2025-10-03 23:21:57 02457_morton_coding_with_mask: [ OK ] 0.57 sec. 2025-10-03 23:21:57 02577_keepermap_delete_update: [ OK ] 0.27 sec. 2025-10-03 23:21:58 02810_convert_uuid_to_uint128: [ OK ] 0.17 sec. 2025-10-03 23:21:58 00347_has_tuple: [ OK ] 0.22 sec. 2025-10-03 23:21:58 03208_numbers_total_rows_approx: [ OK ] 0.12 sec. 2025-10-03 23:21:58 02124_insert_deduplication_token_multiple_blocks_replica: [ OK ] 1.83 sec. 2025-10-03 23:21:58 02789_reading_from_s3_with_connection_pool: [ OK ] 2.27 sec. 2025-10-03 23:21:59 02157_line_as_string_output_format: [ OK ] 0.12 sec. 2025-10-03 23:21:59 01155_old_mutation_parts_to_do: [ OK ] 9.71 sec. 2025-10-03 23:21:59 01305_array_join_prewhere_in_subquery: [ OK ] 0.17 sec. 2025-10-03 23:21:59 02116_interactive_hello: [ OK ] 0.42 sec. 2025-10-03 23:21:59 02813_starting_in_text_log: [ OK ] 0.27 sec. 2025-10-03 23:21:59 00104_totals_having_mode: [ OK ] 0.22 sec. 2025-10-03 23:21:59 02342_analyzer_compound_types: [ OK ] 0.42 sec. 2025-10-03 23:22:00 03015_with_fill_invalid_expression: [ OK ] 0.17 sec. 2025-10-03 23:22:00 02352_lightweight_delete: [ OK ] 1.47 sec. 2025-10-03 23:22:00 00937_format_schema_rows_template: [ OK ] 1.07 sec. 2025-10-03 23:22:01 02366_kql_summarize: [ OK ] 0.42 sec. 2025-10-03 23:22:01 01259_combinator_distinct_distributed: [ OK ] 0.33 sec. 2025-10-03 23:22:01 01006_simpod_empty_part_single_column_write: [ OK ] 1.32 sec. 2025-10-03 23:22:01 00711_array_enumerate_variants: [ OK ] 0.12 sec. 2025-10-03 23:22:01 02496_row_binary_large_string_size: [ OK ] 0.47 sec. 2025-10-03 23:22:01 02047_alias_for_table_and_database_name: [ OK ] 0.12 sec. 2025-10-03 23:22:01 03040_dynamic_type_alters_1_compact_merge_tree: [ OK ] 0.47 sec. 2025-10-03 23:22:01 01087_storage_generate: [ OK ] 0.17 sec. 2025-10-03 23:22:01 03060_analyzer_regular_view_alias: [ OK ] 0.17 sec. 2025-10-03 23:22:02 02310_clickhouse_client_INSERT_progress_profile_events: [ OK ] 0.57 sec. 2025-10-03 23:22:02 03167_base64_url_functions_sh: [ OK ] 20.11 sec. 2025-10-03 23:22:02 01834_alias_columns_laziness_filimonov: [ OK ] 0.72 sec. 2025-10-03 23:22:02 02122_parallel_formatting_CSVWithNames: [ OK ] 0.97 sec. 2025-10-03 23:22:02 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.27 sec. 2025-10-03 23:22:02 02931_file_cluster: [ OK ] 0.42 sec. 2025-10-03 23:22:02 01013_hex_decimal: [ OK ] 0.17 sec. 2025-10-03 23:22:03 01698_map_populate_overflow: [ OK ] 0.12 sec. 2025-10-03 23:22:03 03123_analyzer_dist_join_CTE: [ OK ] 0.18 sec. 2025-10-03 23:22:03 02891_rename_table_without_keyword: [ OK ] 0.22 sec. 2025-10-03 23:22:03 02478_factorial: [ OK ] 0.17 sec. 2025-10-03 23:22:03 01019_alter_materialized_view_atomic: [ OK ] 11.21 sec. 2025-10-03 23:22:03 00715_bounding_ratio_merge_empty: [ OK ] 0.17 sec. 2025-10-03 23:22:03 00044_sorting_by_string_descending: [ OK ] 0.12 sec. 2025-10-03 23:22:03 01946_profile_sleep: [ OK ] 0.52 sec. 2025-10-03 23:22:03 01099_parallel_distributed_insert_select: [ OK ] 1.07 sec. 2025-10-03 23:22:03 02481_analyzer_join_alias_unknown_identifier_crash: [ OK ] 0.22 sec. 2025-10-03 23:22:03 01622_defaults_for_file_engine: [ OK ] 0.17 sec. 2025-10-03 23:22:04 03048_not_found_column_xxx_in_block: [ OK ] 0.17 sec. 2025-10-03 23:22:04 03128_merge_tree_index_lazy_load: [ OK ] 0.17 sec. 2025-10-03 23:22:04 01657_test_toHour_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:22:04 00955_complex_prepared_statements: [ OK ] 1.28 sec. 2025-10-03 23:22:04 02712_bool_better_exception_message: [ OK ] 0.82 sec. 2025-10-03 23:22:04 03064_analyzer_named_subqueries: [ OK ] 0.12 sec. 2025-10-03 23:22:04 00671_max_intersections: [ OK ] 0.17 sec. 2025-10-03 23:22:04 01718_subtract_seconds_date: [ OK ] 0.12 sec. 2025-10-03 23:22:04 03164_selects_with_pk_usage_profile_event: [ OK ] 1.67 sec. 2025-10-03 23:22:05 00255_array_concat_string: [ OK ] 0.22 sec. 2025-10-03 23:22:05 00450_higher_order_and_nullable: [ OK ] 0.12 sec. 2025-10-03 23:22:05 01582_distinct_optimization: [ OK ] 0.67 sec. 2025-10-03 23:22:05 00485_http_insert_format: [ OK ] 0.72 sec. 2025-10-03 23:22:05 03215_parquet_index: [ OK ] 0.17 sec. 2025-10-03 23:22:06 01622_constraints_where_optimization: [ OK ] 0.22 sec. 2025-10-03 23:22:06 02995_forget_partition: [ OK ] 10.60 sec. 2025-10-03 23:22:06 02377_extend_protocol_with_query_parameters: [ OK ] 1.52 sec. 2025-10-03 23:22:06 03231_dynamic_not_safe_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:22:06 02892_input_csv_cr_end_count_many_rows: [ OK ] 0.87 sec. 2025-10-03 23:22:07 01388_multi_if_optimization: [ OK ] 0.12 sec. 2025-10-03 23:22:07 02864_statistics_bugs: [ OK ] 0.27 sec. 2025-10-03 23:22:07 03008_s3_plain_rewritable: [ OK ] 3.13 sec. 2025-10-03 23:22:07 02584_compressor_codecs: [ OK ] 0.62 sec. 2025-10-03 23:22:07 01670_neighbor_lc_bug: [ OK ] 0.17 sec. 2025-10-03 23:22:07 01890_stem: [ OK ] 0.17 sec. 2025-10-03 23:22:08 02316_expressions_with_window_functions: [ OK ] 0.12 sec. 2025-10-03 23:22:08 02315_grouping_constant_folding: [ OK ] 0.17 sec. 2025-10-03 23:22:08 01085_extract_all_empty: [ OK ] 0.12 sec. 2025-10-03 23:22:08 01501_clickhouse_client_INSERT_exception: [ OK ] 0.87 sec. 2025-10-03 23:22:08 00327_summing_composite_nested: [ OK ] 0.27 sec. 2025-10-03 23:22:08 00376_shard_group_uniq_array_of_int_array: [ OK ] 3.23 sec. 2025-10-03 23:22:08 02874_infer_objects_as_named_tuples: [ OK ] 0.22 sec. 2025-10-03 23:22:08 01944_insert_partition_by: [ OK ] 0.22 sec. 2025-10-03 23:22:09 02474_unhex_in_fix_string: [ OK ] 0.12 sec. 2025-10-03 23:22:09 02212_h3_get_res0_indexes: [ OK ] 0.12 sec. 2025-10-03 23:22:09 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.17 sec. 2025-10-03 23:22:09 02154_bit_slice_for_string: [ OK ] 0.62 sec. 2025-10-03 23:22:09 01674_unicode_asan: [ OK ] 0.17 sec. 2025-10-03 23:22:09 03006_correct_revoke_for_partial_rights: [ OK ] 1.27 sec. 2025-10-03 23:22:10 00041_big_array_join: [ OK ] 0.22 sec. 2025-10-03 23:22:10 00652_replicated_mutations_default_database_zookeeper: [ OK ] 0.77 sec. 2025-10-03 23:22:10 03132_sqlancer_union_all: [ OK ] 0.17 sec. 2025-10-03 23:22:10 03071_fix_short_circuit_logic: [ OK ] 0.17 sec. 2025-10-03 23:22:10 00974_full_outer_join: [ OK ] 0.12 sec. 2025-10-03 23:22:10 00534_functions_bad_arguments1: [ OK ] 4.03 sec. 2025-10-03 23:22:11 02002_global_subqueries_subquery_or_table_name: [ OK ] 0.12 sec. 2025-10-03 23:22:11 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 0.52 sec. 2025-10-03 23:22:11 02935_external_table_enum_type: [ OK ] 1.18 sec. 2025-10-03 23:22:11 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.17 sec. 2025-10-03 23:22:11 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.22 sec. 2025-10-03 23:22:11 00804_rollup_with_having: [ OK ] 0.17 sec. 2025-10-03 23:22:11 02920_alter_column_of_projections: [ OK ] 0.32 sec. 2025-10-03 23:22:11 00965_send_logs_level_concurrent_queries: [ OK ] 0.62 sec. 2025-10-03 23:22:11 01513_ilike_like_cache: [ OK ] 0.12 sec. 2025-10-03 23:22:12 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.09 sec. 2025-10-03 23:22:12 01599_multiline_input_and_singleline_comments: [ OK ] 1.12 sec. 2025-10-03 23:22:12 00900_long_parquet: [ OK ] 9.25 sec. 2025-10-03 23:22:12 01710_projection_fetch_long: [ OK ] 0.42 sec. 2025-10-03 23:22:12 02185_split_by_char: [ OK ] 0.12 sec. 2025-10-03 23:22:12 00853_join_with_nulls_crash: [ OK ] 0.22 sec. 2025-10-03 23:22:13 02798_substring_index: [ OK ] 0.47 sec. 2025-10-03 23:22:13 00357_to_string_complex_types: [ OK ] 0.17 sec. 2025-10-03 23:22:13 03210_lag_lead_inframe_types: [ OK ] 0.17 sec. 2025-10-03 23:22:13 01651_group_uniq_array_enum: [ OK ] 0.12 sec. 2025-10-03 23:22:13 00023_agg_select_agg_subquery: [ OK ] 0.12 sec. 2025-10-03 23:22:13 00366_multi_statements: [ OK ] 3.08 sec. 2025-10-03 23:22:13 02122_parallel_formatting_JSONCompactStringsEachRow: [ OK ] 1.37 sec. 2025-10-03 23:22:13 00915_tuple_orantius: [ OK ] 0.12 sec. 2025-10-03 23:22:13 01932_remote_sharding_key_column: [ OK ] 0.17 sec. 2025-10-03 23:22:13 03008_groupSortedArray_field: [ OK ] 0.12 sec. 2025-10-03 23:22:13 00132_sets: [ OK ] 0.17 sec. 2025-10-03 23:22:13 03229_json_structure_comparison: [ OK ] 0.17 sec. 2025-10-03 23:22:13 02716_parquet_invalid_date32: [ OK ] 0.52 sec. 2025-10-03 23:22:13 00288_empty_stripelog: [ OK ] 0.17 sec. 2025-10-03 23:22:13 02564_analyzer_cross_to_inner: [ OK ] 0.22 sec. 2025-10-03 23:22:14 00943_materialize_index: [ OK ] 2.23 sec. 2025-10-03 23:22:14 02962_max_joined_block_rows: [ OK ] 0.17 sec. 2025-10-03 23:22:14 02894_ast_depth_check: [ OK ] 0.47 sec. 2025-10-03 23:22:14 03036_udf_user_defined_directory_in_client: [ OK ] 0.67 sec. 2025-10-03 23:22:14 03172_bcrypt_validation: [ OK ] 0.12 sec. 2025-10-03 23:22:14 01831_max_streams: [ OK ] 0.12 sec. 2025-10-03 23:22:14 00049_any_left_join: [ OK ] 0.12 sec. 2025-10-03 23:22:14 02521_lightweight_delete_and_ttl: [ OK ] 0.32 sec. 2025-10-03 23:22:14 01457_int256_hashing: [ OK ] 0.22 sec. 2025-10-03 23:22:14 02844_subquery_timeout_with_break: [ OK ] 0.32 sec. 2025-10-03 23:22:14 00233_position_function_family: [ OK ] 1.67 sec. 2025-10-03 23:22:15 02940_variant_text_deserialization: [ OK ] 0.77 sec. 2025-10-03 23:22:15 01825_type_json_15: [ OK ] 0.97 sec. 2025-10-03 23:22:15 00566_enum_min_max: [ OK ] 0.12 sec. 2025-10-03 23:22:15 01018_insert_multiple_blocks_with_defaults: [ OK ] 0.77 sec. 2025-10-03 23:22:15 02030_rocksdb_race_long: [ OK ] 20.58 sec. 2025-10-03 23:22:15 00730_unicode_terminal_format: [ OK ] 0.22 sec. 2025-10-03 23:22:16 02346_fulltext_index_detach_attach: [ OK ] 0.17 sec. 2025-10-03 23:22:16 02221_parallel_replicas_bug: [ OK ] 1.47 sec. 2025-10-03 23:22:16 01623_constraints_column_swap: [ OK ] 0.67 sec. 2025-10-03 23:22:16 02841_tuple_modulo: [ OK ] 0.17 sec. 2025-10-03 23:22:16 02461_welch_t_test_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:22:16 02002_row_level_filter_bug: [ OK ] 1.77 sec. 2025-10-03 23:22:17 03082_analyzer_left_join_correct_column: [ OK ] 0.17 sec. 2025-10-03 23:22:17 03276_empty_variant_type: [ OK ] 0.12 sec. 2025-10-03 23:22:17 02163_shard_num: [ OK ] 0.22 sec. 2025-10-03 23:22:18 02451_order_by_monotonic: [ OK ] 1.97 sec. 2025-10-03 23:22:18 01041_h3_is_valid: [ OK ] 0.12 sec. 2025-10-03 23:22:18 02790_async_queries_in_query_log: [ OK ] 2.68 sec. 2025-10-03 23:22:18 02831_trash: [ OK ] 0.12 sec. 2025-10-03 23:22:18 01037_polygon_dicts_simple_functions: [ OK ] 2.13 sec. 2025-10-03 23:22:18 03036_with_numbers: [ OK ] 0.17 sec. 2025-10-03 23:22:18 00661_array_has_silviucpp: [ OK ] 0.17 sec. 2025-10-03 23:22:18 02812_csv_date_time_with_comma: [ OK ] 0.17 sec. 2025-10-03 23:22:19 02360_rename_table_along_with_log_name: [ OK ] 0.82 sec. 2025-10-03 23:22:19 02885_arg_min_max_combinator: [ OK ] 0.22 sec. 2025-10-03 23:22:19 02050_client_profile_events: [ OK ] 6.09 sec. 2025-10-03 23:22:19 02012_get_server_port: [ OK ] 0.17 sec. 2025-10-03 23:22:19 01145_with_fill_const: [ OK ] 0.12 sec. 2025-10-03 23:22:20 02982_create_mv_inner_extra: [ OK ] 0.17 sec. 2025-10-03 23:22:20 00565_enum_order: [ OK ] 1.07 sec. 2025-10-03 23:22:20 01913_quantile_deterministic: [ OK ] 3.08 sec. 2025-10-03 23:22:20 01825_type_json_mutations: [ OK ] 0.22 sec. 2025-10-03 23:22:20 01081_PartialSortingTransform_full_column: [ OK ] 0.17 sec. 2025-10-03 23:22:20 00422_hash_function_constexpr: [ OK ] 0.12 sec. 2025-10-03 23:22:20 02525_range_hashed_dictionary_update_field: [ OK ] 6.19 sec. 2025-10-03 23:22:20 00561_storage_join: [ OK ] 0.22 sec. 2025-10-03 23:22:20 02969_auto_format_detection: [ OK ] 3.58 sec. 2025-10-03 23:22:20 02998_projection_after_attach_partition: [ OK ] 0.22 sec. 2025-10-03 23:22:21 02724_mutliple_storage_join: [ OK ] 0.17 sec. 2025-10-03 23:22:21 02461_mullable_pk_monotonicity_bug: [ OK ] 0.37 sec. 2025-10-03 23:22:21 02932_punycode: [ OK ] 0.47 sec. 2025-10-03 23:22:21 02372_now_in_block: [ OK ] 1.02 sec. 2025-10-03 23:22:21 02189_join_type_conversion: [ OK ] 0.12 sec. 2025-10-03 23:22:21 02662_sparse_columns_mutations_4: [ OK ] 0.17 sec. 2025-10-03 23:22:21 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.17 sec. 2025-10-03 23:22:21 02480_interval_casting_and_subquery: [ OK ] 0.22 sec. 2025-10-03 23:22:21 02015_division_by_nullable: [ OK ] 0.42 sec. 2025-10-03 23:22:21 01472_many_rows_in_totals: [ OK ] 0.17 sec. 2025-10-03 23:22:21 02989_mysql_transaction_test: [ OK ] 0.42 sec. 2025-10-03 23:22:21 01950_kill_large_group_by_query: [ OK ] 0.87 sec. 2025-10-03 23:22:21 00688_case_without_else: [ OK ] 0.17 sec. 2025-10-03 23:22:21 01684_insert_specify_shard_id: [ OK ] 0.27 sec. 2025-10-03 23:22:21 00356_analyze_aggregations_and_union_all: [ OK ] 0.12 sec. 2025-10-03 23:22:21 01515_force_data_skipping_indices: [ OK ] 0.22 sec. 2025-10-03 23:22:22 02458_empty_hdfs_url: [ OK ] 0.12 sec. 2025-10-03 23:22:22 00453_cast_enum: [ OK ] 0.17 sec. 2025-10-03 23:22:22 00067_replicate_segfault: [ OK ] 0.12 sec. 2025-10-03 23:22:22 02517_uuid_parsing: [ OK ] 0.17 sec. 2025-10-03 23:22:22 02481_fix_parameters_parsing: [ OK ] 0.12 sec. 2025-10-03 23:22:22 02920_unary_operators_functions: [ OK ] 0.12 sec. 2025-10-03 23:22:22 03257_json_escape_file_names: [ OK ] 0.17 sec. 2025-10-03 23:22:22 00271_agg_state_and_totals: [ OK ] 0.12 sec. 2025-10-03 23:22:22 01392_column_resolve: [ OK ] 0.22 sec. 2025-10-03 23:22:22 02834_analyzer_with_statement_references: [ OK ] 0.17 sec. 2025-10-03 23:22:22 02423_insert_summary_behaviour: [ OK ] 1.07 sec. 2025-10-03 23:22:23 01661_extract_all_groups_throw_fast: [ OK ] 0.77 sec. 2025-10-03 23:22:23 00284_external_aggregation: [ OK ] 4.33 sec. 2025-10-03 23:22:23 01825_new_type_json_2: [ OK ] 0.37 sec. 2025-10-03 23:22:23 00857_global_joinsavel_table_alias: [ OK ] 0.32 sec. 2025-10-03 23:22:23 02561_null_as_default_more_formats: [ OK ] 5.49 sec. 2025-10-03 23:22:23 01760_ddl_dictionary_use_current_database_name: [ OK ] 0.17 sec. 2025-10-03 23:22:23 02943_exprs_order_in_group_by_with_rollup: [ OK ] 0.17 sec. 2025-10-03 23:22:24 00374_json_each_row_input_with_noisy_fields: [ OK ] 1.22 sec. 2025-10-03 23:22:24 01881_join_on_conditions_merge: [ OK ] 0.77 sec. 2025-10-03 23:22:24 02493_max_streams_for_merge_tree_reading: [ OK ] 1.57 sec. 2025-10-03 23:22:24 01594_storage_join_uuid: [ OK ] 0.17 sec. 2025-10-03 23:22:24 02884_string_distance_function: [ OK ] 0.37 sec. 2025-10-03 23:22:24 02421_exponential_join_rewrite_21557: [ OK ] 2.08 sec. 2025-10-03 23:22:24 03162_dynamic_type_nested: [ OK ] 0.13 sec. 2025-10-03 23:22:24 00201_array_uniq: [ OK ] 0.12 sec. 2025-10-03 23:22:24 01070_exception_code_in_query_log_table: [ OK ] 0.42 sec. 2025-10-03 23:22:24 01505_distributed_local_type_conversion_enum: [ OK ] 0.23 sec. 2025-10-03 23:22:24 03001_restore_from_old_backup_with_matview_inner_table_metadata: [ OK ] 0.97 sec. 2025-10-03 23:22:24 00578_merge_table_sampling: [ OK ] 0.22 sec. 2025-10-03 23:22:24 02477_age_datetime64: [ OK ] 0.27 sec. 2025-10-03 23:22:25 01451_detach_drop_part: [ OK ] 0.27 sec. 2025-10-03 23:22:25 02025_subcolumns_compact_parts: [ OK ] 0.17 sec. 2025-10-03 23:22:25 02505_forbid_paths_in_datetime_timezone: [ OK ] 0.17 sec. 2025-10-03 23:22:25 01355_alter_column_with_order: [ OK ] 0.22 sec. 2025-10-03 23:22:25 03150_dynamic_type_mv_insert: [ OK ] 0.32 sec. 2025-10-03 23:22:25 01635_nullable_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:22:25 00386_enum_in_pk: [ OK ] 0.37 sec. 2025-10-03 23:22:25 01326_build_id: [ OK ] 0.12 sec. 2025-10-03 23:22:25 01822_short_circuit: [ OK ] 0.72 sec. 2025-10-03 23:22:25 03156_nullable_number_tips: [ OK ] 0.22 sec. 2025-10-03 23:22:25 01802_toDateTime64_large_values: [ OK ] 0.17 sec. 2025-10-03 23:22:26 01019_materialized_view_select_extra_columns: [ OK ] 0.22 sec. 2025-10-03 23:22:26 00161_rounding_functions: [ OK ] 0.32 sec. 2025-10-03 23:22:26 01042_h3_k_ring: [ OK ] 0.22 sec. 2025-10-03 23:22:26 02240_asof_join_biginteger: [ OK ] 0.17 sec. 2025-10-03 23:22:26 01707_join_use_nulls: [ OK ] 0.17 sec. 2025-10-03 23:22:26 02124_insert_deduplication_token_multiple_blocks: [ OK ] 1.82 sec. 2025-10-03 23:22:26 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.12 sec. 2025-10-03 23:22:26 02861_index_set_incorrect_args: [ OK ] 0.17 sec. 2025-10-03 23:22:26 01300_read_wkt: [ OK ] 0.22 sec. 2025-10-03 23:22:26 02536_system_sync_file_cache: [ OK ] 0.22 sec. 2025-10-03 23:22:26 02381_setting_value_auto: [ OK ] 0.12 sec. 2025-10-03 23:22:27 00976_ttl_with_old_parts: [ OK ] 1.23 sec. 2025-10-03 23:22:27 02124_insert_deduplication_token_replica: [ OK ] 0.37 sec. 2025-10-03 23:22:27 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.27 sec. 2025-10-03 23:22:27 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.12 sec. 2025-10-03 23:22:27 01109_sc0rp10_string_hash_map_zero_bytes: [ OK ] 0.17 sec. 2025-10-03 23:22:27 03212_optimize_with_constraints_logical_error: [ OK ] 0.12 sec. 2025-10-03 23:22:27 00825_protobuf_format_array_of_arrays: [ OK ] 1.08 sec. 2025-10-03 23:22:27 01034_JSONCompactEachRow: [ OK ] 0.42 sec. 2025-10-03 23:22:27 02187_insert_values_with_mv: [ OK ] 0.92 sec. 2025-10-03 23:22:28 00042_set: [ OK ] 0.17 sec. 2025-10-03 23:22:28 01767_timezoneOf: [ OK ] 0.43 sec. 2025-10-03 23:22:28 00754_first_significant_subdomain_more: [ OK ] 0.12 sec. 2025-10-03 23:22:28 02318_template_schema_inference_bug: [ OK ] 0.17 sec. 2025-10-03 23:22:28 01173_transaction_control_queries: [ OK ] 0.52 sec. 2025-10-03 23:22:28 00679_uuid_in_key: [ OK ] 0.22 sec. 2025-10-03 23:22:29 02907_clickhouse_dictionary_bug: [ OK ] 0.47 sec. 2025-10-03 23:22:29 02421_json_decimals_as_strings: [ OK ] 0.12 sec. 2025-10-03 23:22:29 01710_projections_optimize_aggregation_in_order: [ OK ] 1.93 sec. 2025-10-03 23:22:29 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.17 sec. 2025-10-03 23:22:29 01062_window_view_event_hop_watch_asc: [ OK ] 1.33 sec. 2025-10-03 23:22:29 03050_select_one_one_one: [ OK ] 0.12 sec. 2025-10-03 23:22:29 03022_highlight_digit_groups: [ OK ] 0.12 sec. 2025-10-03 23:22:30 00352_external_sorting_and_constants: [ OK ] 0.37 sec. 2025-10-03 23:22:30 01271_optimize_arithmetic_operations_in_aggr_func_long: [ OK ] 0.87 sec. 2025-10-03 23:22:31 00598_create_as_select_http: [ OK ] 0.62 sec. 2025-10-03 23:22:31 00688_low_cardinality_dictionary_deserialization: [ OK ] 0.87 sec. 2025-10-03 23:22:31 03214_bitslice_argument_evaluation: [ OK ] 0.17 sec. 2025-10-03 23:22:31 01298_alter_merge: [ OK ] 0.22 sec. 2025-10-03 23:22:31 00900_long_parquet_decimal: [ OK ] 7.30 sec. 2025-10-03 23:22:31 00974_final_predicate_push_down: [ OK ] 0.17 sec. 2025-10-03 23:22:31 01666_date_lut_buffer_overflow: [ OK ] 0.12 sec. 2025-10-03 23:22:31 00834_limit_with_constant_expressions: [ OK ] 0.27 sec. 2025-10-03 23:22:31 02705_settings_check_changed_flag: [ OK ] 0.32 sec. 2025-10-03 23:22:31 01621_summap_check_types: [ OK ] 0.12 sec. 2025-10-03 23:22:31 00832_storage_file_lock: [ OK ] 0.17 sec. 2025-10-03 23:22:31 03001_block_offset_column_2: [ OK ] 0.22 sec. 2025-10-03 23:22:32 02420_final_setting_analyzer: [ OK ] 0.42 sec. 2025-10-03 23:22:32 00980_skip_unused_shards_without_sharding_key: [ OK ] 0.17 sec. 2025-10-03 23:22:32 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.22 sec. 2025-10-03 23:22:32 01611_string_to_low_cardinality_key_alter: [ OK ] 0.27 sec. 2025-10-03 23:22:32 01571_window_functions: [ OK ] 0.22 sec. 2025-10-03 23:22:32 00700_decimal_round: [ OK ] 0.42 sec. 2025-10-03 23:22:32 01511_format_readable_timedelta: [ OK ] 0.12 sec. 2025-10-03 23:22:32 01825_type_json_16: [ OK ] 1.02 sec. 2025-10-03 23:22:32 01000_subquery_requires_alias: [ OK ] 0.17 sec. 2025-10-03 23:22:33 02790_client_max_opening_fd: [ OK ] 0.47 sec. 2025-10-03 23:22:33 02990_parts_splitter_invalid_ranges: [ OK ] 0.17 sec. 2025-10-03 23:22:33 02360_send_logs_level_colors: [ OK ] 0.67 sec. 2025-10-03 23:22:33 02184_ipv6_select_parsing: [ OK ] 0.17 sec. 2025-10-03 23:22:33 02661_read_from_archive_tarxz: [ OK ] 3.99 sec. 2025-10-03 23:22:33 00591_columns_removal_union_all: [ OK ] 0.12 sec. 2025-10-03 23:22:33 01548_uncomparable_columns_in_keys: [ OK ] 0.12 sec. 2025-10-03 23:22:33 00220_shard_with_totals_in_subquery_remote_and_limit: [ OK ] 0.17 sec. 2025-10-03 23:22:34 01079_order_by_pk: [ OK ] 1.33 sec. 2025-10-03 23:22:34 02539_generate_random_ip: [ OK ] 0.17 sec. 2025-10-03 23:22:34 02861_filter_pushdown_const_bug: [ OK ] 0.17 sec. 2025-10-03 23:22:34 03096_order_by_system_tables: [ OK ] 0.42 sec. 2025-10-03 23:22:34 02481_low_cardinality_with_short_circuit_functins_mutations: [ OK ] 0.17 sec. 2025-10-03 23:22:34 02911_analyzer_explain_estimate: [ OK ] 0.12 sec. 2025-10-03 23:22:34 00190_non_constant_array_of_constant_data: [ OK ] 0.17 sec. 2025-10-03 23:22:34 01527_materialized_view_stack_overflow: [ OK ] 0.72 sec. 2025-10-03 23:22:34 02751_match_constant_needle: [ OK ] 0.12 sec. 2025-10-03 23:22:35 01746_convert_type_with_default: [ OK ] 0.37 sec. 2025-10-03 23:22:35 01684_geohash_ubsan: [ OK ] 0.32 sec. 2025-10-03 23:22:35 01021_create_as_select: [ OK ] 0.12 sec. 2025-10-03 23:22:35 01012_show_tables_limit: [ OK ] 0.18 sec. 2025-10-03 23:22:35 02423_insert_stats_behaviour: [ OK ] 1.67 sec. 2025-10-03 23:22:35 00338_replicate_array_of_strings: [ OK ] 0.22 sec. 2025-10-03 23:22:36 02122_parallel_formatting_Markdown: [ OK ] 1.07 sec. 2025-10-03 23:22:36 02154_default_keyword_insert: [ OK ] 0.17 sec. 2025-10-03 23:22:36 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.12 sec. 2025-10-03 23:22:36 01848_partition_value_column: [ OK ] 0.23 sec. 2025-10-03 23:22:36 03052_query_hash_includes_aliases: [ OK ] 0.12 sec. 2025-10-03 23:22:36 01549_low_cardinality_materialized_view: [ OK ] 0.17 sec. 2025-10-03 23:22:36 02932_lwd_and_mutations: [ OK ] 0.42 sec. 2025-10-03 23:22:37 01710_projection_optimize_group_by_function_keys: [ OK ] 0.22 sec. 2025-10-03 23:22:37 00148_summing_merge_tree_aggregate_function: [ OK ] 1.37 sec. 2025-10-03 23:22:37 03008_deduplication_insert_into_partitioned_table: [ OK ] 0.62 sec. 2025-10-03 23:22:37 03231_pr_duplicate_announcement_2: [ OK ] 0.27 sec. 2025-10-03 23:22:38 01273_arrow_decimal: [ OK ] 0.87 sec. 2025-10-03 23:22:39 01019_alter_materialized_view_consistent: [ OK ] 1.47 sec. 2025-10-03 23:22:39 02382_query_parameters_post: [ OK ] 0.37 sec. 2025-10-03 23:22:40 00909_kill_not_initialized_query: [ OK ] 6.24 sec. 2025-10-03 23:22:40 02786_parquet_big_integer_compatibility: [ OK ] 0.52 sec. 2025-10-03 23:22:40 00861_decimal_quoted_csv: [ OK ] 0.17 sec. 2025-10-03 23:22:40 02111_json_column_name_encoding: [ OK ] 0.12 sec. 2025-10-03 23:22:40 02403_arrow_large_string: [ OK ] 0.42 sec. 2025-10-03 23:22:41 02834_add_sub_date_functions: [ OK ] 0.33 sec. 2025-10-03 23:22:41 02479_analyzer_aggregation_totals_rollup_crash_fix: [ OK ] 0.19 sec. 2025-10-03 23:22:41 00816_long_concurrent_alter_column: [ OK ] 20.74 sec. 2025-10-03 23:22:42 01750_parsing_exception: [ OK ] 0.44 sec. 2025-10-03 23:22:42 00910_decimal_group_array_crash_3783: [ OK ] 0.38 sec. 2025-10-03 23:22:42 02668_ulid_decoding: [ OK ] 0.33 sec. 2025-10-03 23:22:42 01411_from_unixtime: [ OK ] 0.48 sec. 2025-10-03 23:22:42 00328_long_case_construction: [ OK ] 17.65 sec. 2025-10-03 23:22:42 03111_inner_join_group_by: [ OK ] 0.13 sec. 2025-10-03 23:22:42 01655_plan_optimizations_optimize_read_in_window_order_long: [ OK ] 6.39 sec. 2025-10-03 23:22:42 01748_partition_id_pruning: [ OK ] 0.43 sec. 2025-10-03 23:22:43 02967_analyzer_fuzz: [ OK ] 0.27 sec. 2025-10-03 23:22:43 02473_prewhere_with_bigint: [ OK ] 0.48 sec. 2025-10-03 23:22:43 00826_cross_to_inner_join: [ OK ] 0.73 sec. 2025-10-03 23:22:44 02015_executable_user_defined_functions: [ OK ] 0.47 sec. 2025-10-03 23:22:44 00550_join_insert_select: [ OK ] 0.93 sec. 2025-10-03 23:22:44 02113_hdfs_assert: [ OK ] 0.60 sec. 2025-10-03 23:22:44 03039_dynamic_aggregating_merge_tree: [ OK ] 6.69 sec. 2025-10-03 23:22:44 01581_to_int_inf_nan: [ OK ] 0.23 sec. 2025-10-03 23:22:45 02495_analyzer_storage_join: [ OK ] 0.79 sec. 2025-10-03 23:22:45 02242_negative_datetime64: [ OK ] 0.18 sec. 2025-10-03 23:22:45 01017_tuplehamming_distance: [ OK ] 0.22 sec. 2025-10-03 23:22:45 02169_fix_view_offset_limit_setting: [ OK ] 0.28 sec. 2025-10-03 23:22:45 03001_parallel_parsing_deadlock: [ SKIPPED ] 0.00 sec. 2025-10-03 23:22:45 Reason: not running for current build 2025-10-03 23:22:45 01429_empty_arrow_and_parquet: [ OK ] 2.58 sec. 2025-10-03 23:22:45 02111_function_mapExtractKeyLike: [ OK ] 0.34 sec. 2025-10-03 23:22:45 01774_tuple_null_in: [ OK ] 0.12 sec. 2025-10-03 23:22:45 03205_hashing_empty_tuples: [ OK ] 0.33 sec. 2025-10-03 23:22:46 03080_incorrect_join_with_merge: [ OK ] 0.43 sec. 2025-10-03 23:22:46 01600_quota_by_forwarded_ip: [ OK ] 0.83 sec. 2025-10-03 23:22:46 01582_move_to_prewhere_compact_parts: [ OK ] 0.23 sec. 2025-10-03 23:22:46 02160_h3_cell_area_m2: [ OK ] 0.28 sec. 2025-10-03 23:22:46 03207_json_read_subcolumns_2_wide_merge_tree: [ OK ] 48.32 sec. 2025-10-03 23:22:47 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.78 sec. 2025-10-03 23:22:47 00804_test_zstd_qat_codec_compression: [ SKIPPED ] 0.00 sec. 2025-10-03 23:22:47 Reason: not running for current build 2025-10-03 23:22:47 01032_cityHash64_for_decimal: [ OK ] 0.17 sec. 2025-10-03 23:22:47 02561_sorting_constants_and_distinct_crash: [ OK ] 1.03 sec. 2025-10-03 23:22:47 02586_generate_random_structure: [ OK ] 0.27 sec. 2025-10-03 23:22:47 02731_replace_partition_from_temporary_table: [ OK ] 1.49 sec. 2025-10-03 23:22:47 01914_index_bgranvea: [ OK ] 0.27 sec. 2025-10-03 23:22:47 03156_dynamic_type_concurrent_inserts: [ OK ] 0.62 sec. 2025-10-03 23:22:47 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.88 sec. 2025-10-03 23:22:48 02680_instr_alias_for_position_case_insensitive: [ OK ] 0.18 sec. 2025-10-03 23:22:48 02931_rewrite_sum_column_and_constant: [ OK ] 2.10 sec. 2025-10-03 23:22:48 01254_dict_create_without_db: [ OK ] 0.22 sec. 2025-10-03 23:22:49 00076_ip_coding_functions: [ OK ] 0.89 sec. 2025-10-03 23:22:49 02710_aggregation_nested_map_ip_uuid: [ OK ] 0.38 sec. 2025-10-03 23:22:49 02374_analyzer_join_using: [ OK ] 1.83 sec. 2025-10-03 23:22:49 00682_empty_parts_merge: [ OK ] 6.15 sec. 2025-10-03 23:22:49 02890_untuple_column_names: [ OK ] 0.38 sec. 2025-10-03 23:22:49 03002_int_div_decimal_with_date_bug: [ OK ] 0.17 sec. 2025-10-03 23:22:49 03157_negative_positional_arguments_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:22:50 02381_client_prints_server_side_time: [ OK ] 1.28 sec. 2025-10-03 23:22:50 00109_shard_totals_after_having: [ OK ] 0.78 sec. 2025-10-03 23:22:50 02875_show_functions: [ OK ] 0.68 sec. 2025-10-03 23:22:50 01645_system_table_engines: [ OK ] 0.12 sec. 2025-10-03 23:22:50 01412_group_array_moving_shard: [ OK ] 0.54 sec. 2025-10-03 23:22:51 02884_parallel_window_functions_bug: [ OK ] 0.38 sec. 2025-10-03 23:22:51 03102_prefer_column_name_to_alias: [ OK ] 0.22 sec. 2025-10-03 23:22:51 02313_displayname: [ OK ] 0.13 sec. 2025-10-03 23:22:51 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.17 sec. 2025-10-03 23:22:52 01057_window_view_event_tumble_to_strict_asc: [ OK ] 1.08 sec. 2025-10-03 23:22:52 02125_query_views_log: [ OK ] 2.94 sec. 2025-10-03 23:22:52 01283_max_threads_simple_query_optimization: [ OK ] 1.83 sec. 2025-10-03 23:22:52 01664_ntoa_aton_mysql_compatibility: [ OK ] 0.17 sec. 2025-10-03 23:22:52 01825_new_type_json_partitions: [ OK ] 0.17 sec. 2025-10-03 23:22:52 02050_clickhouse_client_local_exception: [ OK ] 0.42 sec. 2025-10-03 23:22:52 02346_into_outfile_and_stdout: [ OK ] 1.03 sec. 2025-10-03 23:22:52 02920_fix_json_merge_patch: [ OK ] 0.13 sec. 2025-10-03 23:22:53 01665_merge_tree_min_for_concurrent_read: [ OK ] 0.18 sec. 2025-10-03 23:22:53 02046_remote_table_function_named_collections: [ OK ] 0.28 sec. 2025-10-03 23:22:53 01710_projections_group_by_no_key: [ OK ] 0.18 sec. 2025-10-03 23:22:53 00731_long_merge_tree_select_opened_files: [ OK ] 5.71 sec. 2025-10-03 23:22:53 02494_parser_string_binary_literal: [ OK ] 0.22 sec. 2025-10-03 23:22:53 02809_prewhere_and_in: [ OK ] 0.32 sec. 2025-10-03 23:22:53 02681_aggregation_by_partitions_bug: [ OK ] 0.27 sec. 2025-10-03 23:22:53 03254_uniq_exact_two_level_negative_zero: [ OK ] 0.22 sec. 2025-10-03 23:22:53 02888_system_tables_with_inaccessible_table_function: [ OK ] 0.27 sec. 2025-10-03 23:22:53 01497_extract_all_groups_empty_match: [ OK ] 0.12 sec. 2025-10-03 23:22:53 01852_cast_operator_bad_cases: [ OK ] 1.73 sec. 2025-10-03 23:22:53 00860_unknown_identifier_bug: [ OK ] 0.17 sec. 2025-10-03 23:22:53 02158_interval_length_sum: [ OK ] 0.12 sec. 2025-10-03 23:22:54 02021_map_has: [ OK ] 0.17 sec. 2025-10-03 23:22:54 00374_any_last_if_merge: [ OK ] 0.12 sec. 2025-10-03 23:22:54 01273_arrow_nested_arrays_load: [ OK ] 0.93 sec. 2025-10-03 23:22:54 01102_distributed_local_in_bug: [ OK ] 0.22 sec. 2025-10-03 23:22:54 00334_column_aggregate_function_limit: [ OK ] 0.18 sec. 2025-10-03 23:22:54 01504_compression_multiple_streams: [ OK ] 0.57 sec. 2025-10-03 23:22:55 01566_negate_formatting: [ OK ] 0.12 sec. 2025-10-03 23:22:55 03155_in_nested_subselects: [ OK ] 0.17 sec. 2025-10-03 23:22:55 03214_count_distinct_null_key_memory_leak: [ OK ] 1.43 sec. 2025-10-03 23:22:55 03230_subcolumns_mv: [ OK ] 0.17 sec. 2025-10-03 23:22:55 02893_bad_sample_view: [ OK ] 0.12 sec. 2025-10-03 23:22:55 02763_row_policy_storage_merge: [ OK ] 1.07 sec. 2025-10-03 23:22:55 02578_ipv4_codec_t64: [ OK ] 0.17 sec. 2025-10-03 23:22:56 02998_analyzer_secret_args_tree_node: [ OK ] 0.23 sec. 2025-10-03 23:22:56 02319_quantile_interpolated_weighted: [ OK ] 0.27 sec. 2025-10-03 23:22:56 00879_cast_to_decimal_crash: [ OK ] 0.12 sec. 2025-10-03 23:22:56 00754_distributed_optimize_skip_select_on_unused_shards_with_prewhere: [ OK ] 3.08 sec. 2025-10-03 23:22:56 01600_select_in_different_types: [ OK ] 0.32 sec. 2025-10-03 23:22:56 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.12 sec. 2025-10-03 23:22:57 03204_index_hint_fuzzer: [ OK ] 0.17 sec. 2025-10-03 23:22:57 01422_map_skip_null: [ OK ] 0.22 sec. 2025-10-03 23:22:57 02861_uuid_format_serialization: [ OK ] 0.17 sec. 2025-10-03 23:22:57 02969_analyzer_eliminate_injective_functions: [ OK ] 0.17 sec. 2025-10-03 23:22:57 02552_siphash128_reference: [ OK ] 1.23 sec. 2025-10-03 23:22:57 02790_keyed_hash_bug: [ OK ] 0.12 sec. 2025-10-03 23:22:58 01825_type_json_partitions: [ OK ] 0.17 sec. 2025-10-03 23:22:58 01664_decimal_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:22:58 02564_read_in_order_final_desc: [ OK ] 0.28 sec. 2025-10-03 23:22:58 00763_long_lock_buffer_alter_destination_table: [ OK ] 30.24 sec. 2025-10-03 23:22:58 01903_correct_block_size_prediction_with_default: [ OK ] 10.36 sec. 2025-10-03 23:22:58 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.22 sec. 2025-10-03 23:22:58 02589_bson_invalid_document_size: [ OK ] 0.18 sec. 2025-10-03 23:22:58 00159_whitespace_in_columns_list: [ OK ] 0.17 sec. 2025-10-03 23:22:58 00229_prewhere_column_missing: [ OK ] 0.27 sec. 2025-10-03 23:22:58 01231_markdown_format: [ OK ] 0.17 sec. 2025-10-03 23:22:58 03274_grace_hash_max_joined_block_size_rows_bug: [ OK ] 0.22 sec. 2025-10-03 23:22:58 02941_any_RESPECT_NULL_sparse_column: [ OK ] 0.12 sec. 2025-10-03 23:22:58 00685_output_format_json_escape_forward_slashes: [ OK ] 0.17 sec. 2025-10-03 23:22:58 02883_zookeeper_finalize_stress: [ OK ] 3.59 sec. 2025-10-03 23:22:59 02706_array_map_tuples: [ OK ] 0.17 sec. 2025-10-03 23:22:59 00697_in_subquery_shard: [ OK ] 0.27 sec. 2025-10-03 23:22:59 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.47 sec. 2025-10-03 23:22:59 01098_sum: [ OK ] 0.17 sec. 2025-10-03 23:22:59 02128_apply_lambda_parsing: [ OK ] 0.12 sec. 2025-10-03 23:22:59 01324_if_transform_strings_to_enum: [ OK ] 0.17 sec. 2025-10-03 23:22:59 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.12 sec. 2025-10-03 23:22:59 01665_substring_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:22:59 03109_ast_too_big: [ OK ] 0.17 sec. 2025-10-03 23:22:59 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.22 sec. 2025-10-03 23:22:59 00754_alter_modify_order_by: [ OK ] 0.22 sec. 2025-10-03 23:22:59 01088_window_view_default_column: [ OK ] 1.02 sec. 2025-10-03 23:22:59 00804_test_custom_compression_codes_log_storages: [ OK ] 0.47 sec. 2025-10-03 23:23:00 00938_test_retention_function: [ OK ] 0.17 sec. 2025-10-03 23:23:00 02725_alias_with_restricted_keywords: [ OK ] 0.12 sec. 2025-10-03 23:23:00 02475_join_bug_42832: [ OK ] 0.17 sec. 2025-10-03 23:23:00 01610_client_spawn_editor: [ OK ] 0.12 sec. 2025-10-03 23:23:00 02695_logical_optimizer_alias_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:00 01720_country_perimeter_and_area: [ OK ] 1.78 sec. 2025-10-03 23:23:00 00284_external_aggregation_2: [ OK ] 4.74 sec. 2025-10-03 23:23:00 02950_part_offset_as_primary_key: [ OK ] 0.22 sec. 2025-10-03 23:23:00 03013_position_const_start_pos: [ OK ] 0.17 sec. 2025-10-03 23:23:00 00203_full_join: [ OK ] 0.27 sec. 2025-10-03 23:23:00 00392_enum_nested_alter: [ OK ] 0.37 sec. 2025-10-03 23:23:00 01044_h3_edge_angle: [ OK ] 0.12 sec. 2025-10-03 23:23:01 03003_codec_multiple_buffer_overflow: [ OK ] 0.37 sec. 2025-10-03 23:23:01 03207_json_read_subcolumns_1_memory: [ OK ] 0.72 sec. 2025-10-03 23:23:01 01477_lc_in_merge_join_left_key: [ OK ] 0.47 sec. 2025-10-03 23:23:01 03213_deep_json: [ OK ] 0.17 sec. 2025-10-03 23:23:01 02504_regexp_dictionary_ua_parser: [ OK ] 1.37 sec. 2025-10-03 23:23:01 01277_convert_field_to_type_logical_error: [ OK ] 0.12 sec. 2025-10-03 23:23:01 01517_select_final_distributed: [ OK ] 0.17 sec. 2025-10-03 23:23:01 00982_low_cardinality_setting_in_mv: [ OK ] 0.17 sec. 2025-10-03 23:23:01 01922_client_param: [ OK ] 0.52 sec. 2025-10-03 23:23:01 01632_max_partitions_to_read: [ OK ] 0.17 sec. 2025-10-03 23:23:02 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.47 sec. 2025-10-03 23:23:02 02125_many_mutations: [ OK ] 21.65 sec. 2025-10-03 23:23:02 02477_analyzer_array_join_with_join: [ OK ] 0.43 sec. 2025-10-03 23:23:02 03246_alter_update_dynamic_hung: [ OK ] 0.22 sec. 2025-10-03 23:23:02 02864_restore_table_with_broken_part: [ OK ] 0.92 sec. 2025-10-03 23:23:02 03046_column_in_block_array_join: [ OK ] 0.17 sec. 2025-10-03 23:23:02 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 1.04 sec. 2025-10-03 23:23:02 03036_join_filter_push_down_equivalent_sets: [ OK ] 0.32 sec. 2025-10-03 23:23:02 02260_alter_compact_part_drop_nested_column: [ OK ] 0.27 sec. 2025-10-03 23:23:03 02353_order_by_tuple: [ OK ] 0.52 sec. 2025-10-03 23:23:03 02818_memory_profiler_sample_min_max_allocation_size: [ OK ] 0.77 sec. 2025-10-03 23:23:03 02459_materialized_view_default_value: [ OK ] 0.22 sec. 2025-10-03 23:23:03 02915_analyzer_fuzz_5: [ OK ] 0.17 sec. 2025-10-03 23:23:04 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.17 sec. 2025-10-03 23:23:04 02681_comparsion_tuple_elimination_ast: [ OK ] 0.17 sec. 2025-10-03 23:23:04 02354_vector_search_detach_attach: [ OK ] 0.17 sec. 2025-10-03 23:23:04 02842_mutations_replace_non_deterministic: [ OK ] 0.77 sec. 2025-10-03 23:23:04 02327_try_infer_integers_schema_inference: [ OK ] 0.22 sec. 2025-10-03 23:23:04 02429_low_cardinality_trash: [ OK ] 0.32 sec. 2025-10-03 23:23:04 03201_variant_null_map_subcolumn: [ OK ] 4.38 sec. 2025-10-03 23:23:04 01097_one_more_range_reader_test_wide_part: [ OK ] 0.17 sec. 2025-10-03 23:23:05 00150_with_totals_and_join: [ OK ] 0.17 sec. 2025-10-03 23:23:05 02697_alter_dependencies: [ OK ] 0.32 sec. 2025-10-03 23:23:05 00613_shard_distributed_max_execution_time: [ OK ] 0.17 sec. 2025-10-03 23:23:05 02531_storage_join_null_44940: [ OK ] 0.17 sec. 2025-10-03 23:23:05 01492_array_join_crash_13829: [ OK ] 0.12 sec. 2025-10-03 23:23:05 03032_save_bad_json_escape_sequences: [ OK ] 0.12 sec. 2025-10-03 23:23:05 01201_read_single_thread_in_order: [ OK ] 1.23 sec. 2025-10-03 23:23:05 02460_prewhere_row_level_policy: [ OK ] 0.17 sec. 2025-10-03 23:23:05 02469_fix_aliases_parser: [ OK ] 0.12 sec. 2025-10-03 23:23:06 01903_csvwithnames_subset_of_columns: [ OK ] 12.01 sec. 2025-10-03 23:23:06 01915_json_extract_raw_string: [ OK ] 0.17 sec. 2025-10-03 23:23:06 03040_dynamic_type_alters_1_memory: [ OK ] 0.32 sec. 2025-10-03 23:23:06 01011_group_uniq_array_memsan: [ OK ] 0.12 sec. 2025-10-03 23:23:06 02480_suspicious_lowcard_in_key: [ OK ] 0.17 sec. 2025-10-03 23:23:06 02383_arrow_dict_special_cases: [ OK ] 1.32 sec. 2025-10-03 23:23:06 02996_index_compaction_counterexample: [ OK ] 0.17 sec. 2025-10-03 23:23:06 02243_arrow_read_null_type_to_nullable_column: [ OK ] 0.78 sec. 2025-10-03 23:23:06 01910_memory_tracking_topk: [ OK ] 0.12 sec. 2025-10-03 23:23:06 02345_implicit_transaction: [ OK ] 0.47 sec. 2025-10-03 23:23:06 00034_fixed_string_to_number: [ OK ] 0.12 sec. 2025-10-03 23:23:07 02990_format_select_from_explain: [ OK ] 0.32 sec. 2025-10-03 23:23:07 01062_max_parser_depth: [ OK ] 0.32 sec. 2025-10-03 23:23:07 02366_kql_tabular: [ OK ] 0.37 sec. 2025-10-03 23:23:07 02422_insert_different_granularity: [ OK ] 0.37 sec. 2025-10-03 23:23:07 02293_selected_rows_and_merges: [ OK ] 1.37 sec. 2025-10-03 23:23:07 00487_if_array_fixed_string: [ OK ] 0.12 sec. 2025-10-03 23:23:07 01072_json_each_row_data_in_square_brackets: [ OK ] 0.17 sec. 2025-10-03 23:23:08 03037_zero_step_in_numbers_table_function: [ OK ] 0.17 sec. 2025-10-03 23:23:08 02029_quantile_sanitizer: [ OK ] 0.17 sec. 2025-10-03 23:23:08 02317_distinct_in_order_optimization_explain: [ OK ] 5.79 sec. 2025-10-03 23:23:08 00700_decimal_aggregates: [ OK ] 0.52 sec. 2025-10-03 23:23:08 01373_summing_merge_tree_exclude_partition_key: [ OK ] 0.47 sec. 2025-10-03 23:23:08 02515_analyzer_null_for_empty: [ OK ] 0.13 sec. 2025-10-03 23:23:08 02500_bson_read_object_id: [ OK ] 0.52 sec. 2025-10-03 23:23:08 01037_polygon_dicts_correctness_all: [ OK ] 1.87 sec. 2025-10-03 23:23:08 02887_tuple_element_distributed: [ OK ] 0.12 sec. 2025-10-03 23:23:08 01701_if_tuple_segfault: [ OK ] 0.27 sec. 2025-10-03 23:23:08 01803_untuple_subquery: [ OK ] 0.12 sec. 2025-10-03 23:23:08 01284_port: [ OK ] 0.37 sec. 2025-10-03 23:23:09 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.52 sec. 2025-10-03 23:23:09 01771_datetime64_no_time_part: [ OK ] 0.12 sec. 2025-10-03 23:23:09 03150_url_hash_non_constant_level: [ OK ] 0.17 sec. 2025-10-03 23:23:09 00131_set_hashed: [ OK ] 0.12 sec. 2025-10-03 23:23:09 01259_datetime64_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:23:09 02721_parquet_field_not_found: [ OK ] 0.57 sec. 2025-10-03 23:23:10 02250_hints_for_projections: [ OK ] 1.03 sec. 2025-10-03 23:23:10 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.45 sec. 2025-10-03 23:23:10 01710_projection_pk_trivial_count: [ OK ] 0.33 sec. 2025-10-03 23:23:10 03173_distinct_combinator_alignment: [ OK ] 0.17 sec. 2025-10-03 23:23:10 02531_semi_join_null_const_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:11 01455_time_zones: [ OK ] 0.12 sec. 2025-10-03 23:23:11 02235_remote_fs_cache_stress: [ OK ] 2.18 sec. 2025-10-03 23:23:11 03143_parallel_replicas_mat_view_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:11 02223_insert_select_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:23:11 01220_scalar_optimization_in_alter: [ OK ] 0.12 sec. 2025-10-03 23:23:11 03203_grpc_protocol: [ OK ] 0.67 sec. 2025-10-03 23:23:11 02828_create_as_table_function_rename: [ OK ] 0.17 sec. 2025-10-03 23:23:11 02389_analyzer_nested_lambda: [ OK ] 2.73 sec. 2025-10-03 23:23:12 02151_invalid_setting_with_hints_in_query: [ OK ] 0.42 sec. 2025-10-03 23:23:12 01507_multiversion_storage_for_storagememory: [ OK ] 0.12 sec. 2025-10-03 23:23:12 02725_parquet_preserve_order: [ OK ] 9.56 sec. 2025-10-03 23:23:12 00752_low_cardinality_mv_2: [ OK ] 0.22 sec. 2025-10-03 23:23:12 01710_projection_optimize_materialize: [ OK ] 0.37 sec. 2025-10-03 23:23:12 02559_multiple_read_steps_in_prewhere_reuse_computation: [ OK ] 0.17 sec. 2025-10-03 23:23:12 01815_with_mergeable_state_after_aggregation_and_limit: [ OK ] 0.42 sec. 2025-10-03 23:23:12 02378_part_log_profile_events: [ OK ] 0.52 sec. 2025-10-03 23:23:12 00505_shard_secure: [ OK ] 1.02 sec. 2025-10-03 23:23:12 03277_analyzer_array_join_fix: [ OK ] 0.17 sec. 2025-10-03 23:23:13 02100_replaceRegexpAll_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:13 02513_prewhere_combine_step_filters: [ OK ] 0.22 sec. 2025-10-03 23:23:13 03173_row_binary_and_native_with_binary_encoded_types: [ OK ] 11.21 sec. 2025-10-03 23:23:13 03151_dynamic_type_scale_max_types: [ OK ] 0.27 sec. 2025-10-03 23:23:13 02004_invalid_partition_mutation_stuck: [ OK ] 0.22 sec. 2025-10-03 23:23:13 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.62 sec. 2025-10-03 23:23:13 01016_simhash_minhash: [ OK ] 0.47 sec. 2025-10-03 23:23:13 02317_functions_with_nothing: [ OK ] 0.17 sec. 2025-10-03 23:23:13 01373_summing_merge_tree_explicit_columns_definition: [ OK ] 0.12 sec. 2025-10-03 23:23:13 00831_quantile_weighted_parameter_check: [ OK ] 0.17 sec. 2025-10-03 23:23:13 02791_final_block_structure_mismatch_bug: [ OK ] 0.32 sec. 2025-10-03 23:23:14 01763_max_distributed_depth: [ OK ] 0.12 sec. 2025-10-03 23:23:14 01825_type_json_order_by: [ OK ] 0.17 sec. 2025-10-03 23:23:14 02911_add_index_and_materialize_index: [ OK ] 0.12 sec. 2025-10-03 23:23:14 02457_filesystem_function: [ OK ] 0.17 sec. 2025-10-03 23:23:14 00640_endsWith: [ OK ] 0.22 sec. 2025-10-03 23:23:14 00700_decimal_casts_2: [ OK ] 0.97 sec. 2025-10-03 23:23:14 01823_array_low_cardinality_KuliginStepan: [ OK ] 0.17 sec. 2025-10-03 23:23:14 01441_array_combinator: [ OK ] 0.12 sec. 2025-10-03 23:23:15 02149_read_in_order_fixed_prefix: [ OK ] 0.47 sec. 2025-10-03 23:23:15 00753_with_with_single_alias: [ OK ] 0.12 sec. 2025-10-03 23:23:15 02845_group_by_constant_keys: [ OK ] 0.22 sec. 2025-10-03 23:23:15 02295_global_with_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:23:15 02429_groupBitmap_chain_state: [ OK ] 0.17 sec. 2025-10-03 23:23:15 02835_join_step_explain: [ OK ] 0.17 sec. 2025-10-03 23:23:15 02864_profile_event_part_lock: [ OK ] 0.12 sec. 2025-10-03 23:23:15 01046_trivial_count_query_distributed: [ OK ] 0.17 sec. 2025-10-03 23:23:16 00957_format_with_clashed_aliases: [ OK ] 0.32 sec. 2025-10-03 23:23:16 01915_for_each_crakjie: [ OK ] 0.17 sec. 2025-10-03 23:23:16 02320_alter_columns_with_dots: [ OK ] 0.17 sec. 2025-10-03 23:23:16 01085_simdjson_uint64: [ OK ] 0.12 sec. 2025-10-03 23:23:16 00732_base64_functions: [ OK ] 0.17 sec. 2025-10-03 23:23:17 01413_rows_events: [ OK ] 0.52 sec. 2025-10-03 23:23:17 02184_ipv6_cast_test: [ OK ] 0.12 sec. 2025-10-03 23:23:17 01652_ignore_and_low_cardinality: [ OK ] 0.17 sec. 2025-10-03 23:23:17 00726_length_aliases: [ OK ] 0.12 sec. 2025-10-03 23:23:17 00411_long_accurate_number_comparison_int3: [ OK ] 3.53 sec. 2025-10-03 23:23:17 02585_query_status_deadlock: [ OK ] 9.69 sec. 2025-10-03 23:23:17 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 7.52 sec. 2025-10-03 23:23:17 00500_point_in_polygon_bug_3_linestring_rotation_precision: [ OK ] 0.17 sec. 2025-10-03 23:23:17 02003_bug_from_23515: [ OK ] 0.22 sec. 2025-10-03 23:23:18 01660_system_parts_smoke: [ OK ] 0.27 sec. 2025-10-03 23:23:18 00439_fixed_string_filter: [ OK ] 0.12 sec. 2025-10-03 23:23:18 00800_versatile_storage_join: [ OK ] 0.32 sec. 2025-10-03 23:23:18 02128_wait_end_of_query_fix: [ OK ] 0.32 sec. 2025-10-03 23:23:18 03250_json_group_by_sub_object_subcolumn: [ OK ] 0.17 sec. 2025-10-03 23:23:18 01014_count_of_merges_metrics: [ OK ] 0.17 sec. 2025-10-03 23:23:18 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.17 sec. 2025-10-03 23:23:19 01273_extractGroups: [ OK ] 0.22 sec. 2025-10-03 23:23:19 01085_regexp_input_format: [ OK ] 1.07 sec. 2025-10-03 23:23:19 03033_set_index_in: [ OK ] 0.22 sec. 2025-10-03 23:23:19 01591_window_functions: [ OK ] 0.82 sec. 2025-10-03 23:23:19 03100_analyzer_constants_in_multiif: [ OK ] 0.12 sec. 2025-10-03 23:23:19 02886_binary_like: [ OK ] 0.22 sec. 2025-10-03 23:23:19 00091_union_race_conditions_2: [ OK ] 7.00 sec. 2025-10-03 23:23:19 00999_join_not_nullable_types: [ OK ] 0.17 sec. 2025-10-03 23:23:19 01213_alter_rename_with_default_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:23:20 03031_tuple_elimination_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:23:20 01903_http_fields: [ OK ] 0.67 sec. 2025-10-03 23:23:20 02733_fix_distinct_in_order_bug_49622: [ OK ] 0.12 sec. 2025-10-03 23:23:20 00689_join_table_function: [ OK ] 0.12 sec. 2025-10-03 23:23:20 03002_sample_factor_where: [ OK ] 0.17 sec. 2025-10-03 23:23:20 03020_output_format_client: [ OK ] 0.97 sec. 2025-10-03 23:23:20 00862_decimal_in: [ OK ] 0.22 sec. 2025-10-03 23:23:20 00149_function_url_hash: [ OK ] 0.17 sec. 2025-10-03 23:23:20 01513_optimize_aggregation_in_order_memory_long: [ OK ] 1.67 sec. 2025-10-03 23:23:20 02792_drop_projection_lwd: [ OK ] 0.17 sec. 2025-10-03 23:23:20 02674_and_consistency: [ OK ] 0.12 sec. 2025-10-03 23:23:20 02676_analyzer_limit_offset: [ OK ] 0.22 sec. 2025-10-03 23:23:20 01910_client_replxx_container_overflow_long: [ OK ] 0.47 sec. 2025-10-03 23:23:21 03010_sum_to_to_count_if_nullable: [ OK ] 0.17 sec. 2025-10-03 23:23:21 01033_dictionaries_lifetime: [ OK ] 0.22 sec. 2025-10-03 23:23:21 03099_analyzer_multi_join: [ OK ] 0.12 sec. 2025-10-03 23:23:21 02025_having_filter_column: [ OK ] 0.17 sec. 2025-10-03 23:23:21 02911_cte_invalid_query_analysis: [ OK ] 0.17 sec. 2025-10-03 23:23:21 01021_tuple_parser: [ OK ] 0.17 sec. 2025-10-03 23:23:22 02946_parallel_replicas_force_primary_key: [ OK ] 0.32 sec. 2025-10-03 23:23:22 02346_aggregation_in_order_fixed_prefix: [ OK ] 1.17 sec. 2025-10-03 23:23:22 01710_projection_optimize_aggregators_of_group_by_keys: [ OK ] 0.17 sec. 2025-10-03 23:23:22 03144_aggregate_states_with_different_types: [ OK ] 0.12 sec. 2025-10-03 23:23:22 02789_set_index_nullable_condition_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:22 02242_case_insensitive_nested: [ OK ] 1.42 sec. 2025-10-03 23:23:22 01866_view_persist_settings: [ OK ] 0.37 sec. 2025-10-03 23:23:22 00974_fix_join_on: [ OK ] 0.32 sec. 2025-10-03 23:23:23 02981_insert_select_resize_to_max_insert_threads: [ OK ] 0.62 sec. 2025-10-03 23:23:23 02876_sort_union_of_sorted: [ OK ] 0.17 sec. 2025-10-03 23:23:23 01134_max_rows_to_group_by: [ OK ] 0.18 sec. 2025-10-03 23:23:23 02896_multiple_OR: [ OK ] 0.17 sec. 2025-10-03 23:23:23 02932_non_ready_set_stuck: [ OK ] 0.12 sec. 2025-10-03 23:23:23 02813_array_concat_agg: [ OK ] 0.17 sec. 2025-10-03 23:23:23 02448_clone_replica_lost_part: [ OK ] 24.39 sec. 2025-10-03 23:23:24 02896_illegal_sampling: [ OK ] 0.12 sec. 2025-10-03 23:23:24 00807_regexp_quote_meta: [ OK ] 0.17 sec. 2025-10-03 23:23:24 00113_shard_group_array: [ OK ] 1.62 sec. 2025-10-03 23:23:24 02568_array_map_const_low_cardinality: [ OK ] 0.12 sec. 2025-10-03 23:23:24 00427_alter_primary_key: [ OK ] 1.37 sec. 2025-10-03 23:23:24 02816_check_projection_metadata: [ OK ] 0.12 sec. 2025-10-03 23:23:24 01940_pad_string: [ OK ] 0.27 sec. 2025-10-03 23:23:24 02543_alter_update_rename_stuck: [ OK ] 4.23 sec. 2025-10-03 23:23:24 01300_client_save_history_when_terminated_long: [ OK ] 0.82 sec. 2025-10-03 23:23:24 02560_regexp_denial_of_service: [ OK ] 0.42 sec. 2025-10-03 23:23:24 02888_obsolete_settings: [ OK ] 0.12 sec. 2025-10-03 23:23:25 03114_analyzer_cte_with_join: [ OK ] 0.17 sec. 2025-10-03 23:23:25 02098_date32_comparison: [ OK ] 0.17 sec. 2025-10-03 23:23:25 03096_text_log_format_string_args_not_empty: [ OK ] 0.32 sec. 2025-10-03 23:23:25 01582_deterministic_function_with_predicate: [ OK ] 0.12 sec. 2025-10-03 23:23:25 02416_rocksdb_delete_update: [ OK ] 0.27 sec. 2025-10-03 23:23:25 03096_largest_triangle_3b_crash: [ OK ] 0.12 sec. 2025-10-03 23:23:25 01071_in_array: [ OK ] 0.17 sec. 2025-10-03 23:23:25 00500_point_in_polygon_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:25 02131_row_policies_combination: [ OK ] 0.27 sec. 2025-10-03 23:23:25 02933_local_system_setting: [ OK ] 0.37 sec. 2025-10-03 23:23:25 03173_parallel_replicas_join_bug: [ OK ] 0.67 sec. 2025-10-03 23:23:26 01337_mysql_global_variables: [ OK ] 0.17 sec. 2025-10-03 23:23:26 02193_async_insert_tcp_client_2: [ OK ] 10.70 sec. 2025-10-03 23:23:26 02845_arrayShiftRotate: [ OK ] 0.32 sec. 2025-10-03 23:23:26 00233_position_function_sql_comparibilty: [ OK ] 0.17 sec. 2025-10-03 23:23:26 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.17 sec. 2025-10-03 23:23:26 02715_or_null: [ OK ] 0.12 sec. 2025-10-03 23:23:26 03215_udf_with_union: [ OK ] 0.12 sec. 2025-10-03 23:23:26 01752_distributed_query_sigsegv: [ OK ] 0.17 sec. 2025-10-03 23:23:26 00597_push_down_predicate_long: [ OK ] 0.72 sec. 2025-10-03 23:23:26 00707_float_csv_delimiter: [ OK ] 0.12 sec. 2025-10-03 23:23:26 01901_in_literal_shard_prune: [ OK ] 0.17 sec. 2025-10-03 23:23:27 02047_log_family_data_file_dumps: [ OK ] 2.23 sec. 2025-10-03 23:23:27 03006_join_on_inequal_expression_2: [ OK ] 0.67 sec. 2025-10-03 23:23:27 02968_sumMap_with_nan: [ OK ] 0.12 sec. 2025-10-03 23:23:27 02152_csv_tuple: [ OK ] 0.22 sec. 2025-10-03 23:23:27 00758_array_reverse: [ OK ] 0.17 sec. 2025-10-03 23:23:27 00406_tuples_with_nulls: [ OK ] 0.12 sec. 2025-10-03 23:23:27 02763_mutate_compact_part_with_skip_indices_and_projections: [ OK ] 0.92 sec. 2025-10-03 23:23:27 01890_cross_join_explain_crash: [ OK ] 0.12 sec. 2025-10-03 23:23:27 00815_left_join_on_stepanel: [ OK ] 0.12 sec. 2025-10-03 23:23:27 01096_zeros: [ OK ] 0.17 sec. 2025-10-03 23:23:28 00295_global_in_one_shard_rows_before_limit: [ OK ] 0.17 sec. 2025-10-03 23:23:28 03161_ipv4_ipv6_equality: [ OK ] 0.17 sec. 2025-10-03 23:23:28 01114_clear_column_compact_parts: [ OK ] 0.17 sec. 2025-10-03 23:23:28 02722_line_as_string_consistency: [ OK ] 0.77 sec. 2025-10-03 23:23:28 00312_position_case_insensitive_utf8: [ OK ] 2.17 sec. 2025-10-03 23:23:28 00579_virtual_column_and_lazy: [ OK ] 0.22 sec. 2025-10-03 23:23:28 00962_visit_param_various: [ OK ] 0.22 sec. 2025-10-03 23:23:29 00174_compare_date_time_with_constant_string_in_in: [ OK ] 0.17 sec. 2025-10-03 23:23:29 01791_dist_INSERT_block_structure_mismatch: [ OK ] 0.47 sec. 2025-10-03 23:23:29 03037_dynamic_merges_1_vertical_compact_merge_tree: [ OK ] 2.33 sec. 2025-10-03 23:23:29 01784_parallel_formatting_memory: [ OK ] 0.17 sec. 2025-10-03 23:23:29 00061_merge_tree_alter: [ OK ] 0.37 sec. 2025-10-03 23:23:29 02240_protobuflist_format_persons: [ OK ] 5.44 sec. 2025-10-03 23:23:29 01916_low_cardinality_interval: [ OK ] 0.17 sec. 2025-10-03 23:23:29 00333_parser_number_bug: [ OK ] 0.12 sec. 2025-10-03 23:23:29 01308_orc_output_format_arrays: [ OK ] 0.77 sec. 2025-10-03 23:23:29 02669_alter_modify_to_nullable: [ OK ] 0.42 sec. 2025-10-03 23:23:29 01668_avg_weighted_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:23:30 03213_array_element_msan: [ OK ] 0.12 sec. 2025-10-03 23:23:30 02124_encrypt_decrypt_nullable: [ OK ] 0.22 sec. 2025-10-03 23:23:30 02477_s3_request_throttler: [ OK ] 1.57 sec. 2025-10-03 23:23:30 00399_group_uniq_array_date_datetime: [ OK ] 0.17 sec. 2025-10-03 23:23:30 02382_analyzer_matcher_join_using: [ OK ] 0.32 sec. 2025-10-03 23:23:30 00700_to_decimal_or_something: [ OK ] 0.37 sec. 2025-10-03 23:23:30 03198_dictionary_validate_primary_key_type: [ OK ] 0.17 sec. 2025-10-03 23:23:30 02018_multiple_with_fill_for_the_same_column: [ OK ] 0.12 sec. 2025-10-03 23:23:30 02597_column_update_and_replication: [ OK ] 1.22 sec. 2025-10-03 23:23:30 00753_quantile_format: [ OK ] 0.27 sec. 2025-10-03 23:23:30 02904_distributed_settings_background_insert_compatibility: [ OK ] 0.32 sec. 2025-10-03 23:23:31 01764_prefer_column_name_to_alias: [ OK ] 0.22 sec. 2025-10-03 23:23:31 00505_secure: [ OK ] 0.77 sec. 2025-10-03 23:23:31 03039_dynamic_versioned_collapsing_merge_tree: [ OK ] 3.78 sec. 2025-10-03 23:23:31 03163_dynamic_as_supertype: [ OK ] 0.17 sec. 2025-10-03 23:23:31 02901_predicate_pushdown_cte_stateful: [ OK ] 0.17 sec. 2025-10-03 23:23:31 02158_ztest_cmp: [ OK ] 1.68 sec. 2025-10-03 23:23:31 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:23:31 02973_dictionary_table_exception_fix: [ OK ] 0.12 sec. 2025-10-03 23:23:31 02406_try_read_datetime64_bug: [ OK ] 0.12 sec. 2025-10-03 23:23:31 01710_projection_with_alter_conversions: [ OK ] 0.17 sec. 2025-10-03 23:23:31 01614_with_fill_with_limit: [ OK ] 0.12 sec. 2025-10-03 23:23:31 02293_ilike_on_fixed_strings: [ OK ] 0.17 sec. 2025-10-03 23:23:32 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.37 sec. 2025-10-03 23:23:32 Reason: return code: 134, result: 2025-10-03 23:23:32 2025-10-03 23:23:32 2025-10-03 23:23:32 2025-10-03 23:23:32 stdout: 2025-10-03 23:23:32 2025-10-03 23:23:32 2025-10-03 23:23:32 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 6519209 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 5476863 --max_read_buffer_size 572842 --prefer_localhost_replica 1 --max_block_size 82065 --max_joined_block_size_rows 93831 --max_threads 1 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 91 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 24131376 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 7862910788 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 16 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2078271528 --min_compress_block_size 179994 --max_compress_block_size 2511030 --merge_tree_compact_parts_min_granules_to_multibuffer_read 109 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 10231595 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.33 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 1 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1 2025-10-03 23:23:32 2025-10-03 23:23:32 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 5428764024 --vertical_merge_algorithm_min_rows_to_activate 466268 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 323822 --merge_max_block_size 6930 --index_granularity 11309 --min_bytes_for_wide_part 432328612 --marks_compress_block_size 95276 --primary_key_compress_block_size 97034 --replace_long_file_name_to_hash 0 --max_file_name_length 15 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 289551189 --compact_parts_max_granules_to_buffer 10 --compact_parts_merge_max_bytes_to_prefetch_part 32602021 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 72 --old_parts_lifetime 143 2025-10-03 23:23:32 2025-10-03 23:23:32 Database: test_htcbpczj 2025-10-03 23:23:32 01660_sum_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:23:32 00825_protobuf_format_nested_in_nested: [ OK ] 1.68 sec. 2025-10-03 23:23:32 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 0.72 sec. 2025-10-03 23:23:32 01528_clickhouse_local_prepare_parts: [ OK ] 1.93 sec. 2025-10-03 23:23:32 00875_join_right_nulls: [ OK ] 0.27 sec. 2025-10-03 23:23:32 02354_vector_search_multiple_indexes: [ OK ] 0.17 sec. 2025-10-03 23:23:32 02187_test_final_and_limit_modifier: [ OK ] 0.17 sec. 2025-10-03 23:23:33 02233_set_enable_with_statement_cte_perf: [ OK ] 0.47 sec. 2025-10-03 23:23:33 00612_http_max_query_size_for_distributed: [ OK ] 0.17 sec. 2025-10-03 23:23:33 01663_test_toDate_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:23:33 00087_math_functions: [ OK ] 0.77 sec. 2025-10-03 23:23:33 00103_ipv4_num_to_string_class_c: [ OK ] 0.17 sec. 2025-10-03 23:23:33 01554_interpreter_integer_float: [ OK ] 0.17 sec. 2025-10-03 23:23:33 02264_format_insert_infile: [ OK ] 0.12 sec. 2025-10-03 23:23:33 02244_casewithexpression_return_type: [ OK ] 0.12 sec. 2025-10-03 23:23:33 03151_external_cross_join: [ OK ] 1.02 sec. 2025-10-03 23:23:34 01202_array_auc_special: [ OK ] 0.22 sec. 2025-10-03 23:23:34 02458_insert_select_progress_tcp: [ OK ] 2.63 sec. 2025-10-03 23:23:34 00692_if_exception_code: [ OK ] 0.12 sec. 2025-10-03 23:23:34 02206_clickhouse_local_use_database: [ OK ] 0.42 sec. 2025-10-03 23:23:34 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.17 sec. 2025-10-03 23:23:34 02788_fix_logical_error_in_sorting: [ OK ] 0.27 sec. 2025-10-03 23:23:34 02008_test_union_distinct_in_subquery: [ OK ] 0.17 sec. 2025-10-03 23:23:34 02457_s3_cluster_schema_inference: [ OK ] 0.77 sec. 2025-10-03 23:23:34 00938_template_input_format: [ OK ] 2.08 sec. 2025-10-03 23:23:34 02680_mysql_ast_logical_err: [ OK ] 0.17 sec. 2025-10-03 23:23:34 02736_bit_count_big_int: [ OK ] 0.17 sec. 2025-10-03 23:23:34 01925_join_materialized_columns: [ OK ] 0.32 sec. 2025-10-03 23:23:35 02493_inconsistent_hex_and_binary_number: [ OK ] 0.92 sec. 2025-10-03 23:23:35 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.17 sec. 2025-10-03 23:23:35 02514_analyzer_drop_join_on: [ OK ] 0.22 sec. 2025-10-03 23:23:35 01825_type_json_empty_string: [ OK ] 0.12 sec. 2025-10-03 23:23:35 00544_insert_with_select: [ OK ] 0.17 sec. 2025-10-03 23:23:35 01031_mutations_interpreter_and_context: [ OK ] 0.92 sec. 2025-10-03 23:23:35 02321_nested_short_circuit_functions: [ OK ] 0.12 sec. 2025-10-03 23:23:35 02043_query_obfuscator_embedded_dictionaries: [ OK ] 0.32 sec. 2025-10-03 23:23:35 01032_cityHash64_for_UUID: [ OK ] 0.17 sec. 2025-10-03 23:23:35 02004_max_hyperscan_regex_length: [ OK ] 0.52 sec. 2025-10-03 23:23:35 02358_file_default_value: [ OK ] 0.52 sec. 2025-10-03 23:23:35 00384_column_aggregate_function_insert_from: [ OK ] 0.17 sec. 2025-10-03 23:23:35 03094_named_tuple_bug24607: [ OK ] 0.12 sec. 2025-10-03 23:23:35 02155_create_table_w_timezone: [ OK ] 0.12 sec. 2025-10-03 23:23:36 02910_object-json-crash-add-column: [ OK ] 0.22 sec. 2025-10-03 23:23:36 02243_make_date32: [ OK ] 0.42 sec. 2025-10-03 23:23:36 02675_predicate_push_down_filled_join_fix: [ OK ] 0.17 sec. 2025-10-03 23:23:36 01399_http_request_headers: [ OK ] 0.47 sec. 2025-10-03 23:23:36 02131_materialize_column_cast: [ OK ] 0.22 sec. 2025-10-03 23:23:36 03215_analyzer_materialized_constants_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:36 00479_date_and_datetime_to_number: [ OK ] 0.12 sec. 2025-10-03 23:23:37 02490_benchmark_max_consecutive_errors: [ OK ] 0.57 sec. 2025-10-03 23:23:37 01276_system_licenses: [ OK ] 0.12 sec. 2025-10-03 23:23:37 02343_analyzer_lambdas_issue_36677: [ OK ] 0.12 sec. 2025-10-03 23:23:37 02476_analyzer_identifier_hints: [ OK ] 5.49 sec. 2025-10-03 23:23:37 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.17 sec. 2025-10-03 23:23:37 00375_shard_group_uniq_array_of_string: [ OK ] 2.07 sec. 2025-10-03 23:23:37 01015_array_split: [ OK ] 0.17 sec. 2025-10-03 23:23:37 00259_hashing_tuples: [ OK ] 0.17 sec. 2025-10-03 23:23:37 01475_fix_bigint_shift: [ OK ] 0.12 sec. 2025-10-03 23:23:37 01533_sum_if_nullable_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:37 03003_database_filesystem_format_detection: [ OK ] 0.47 sec. 2025-10-03 23:23:37 00953_indices_alter_exceptions: [ OK ] 0.72 sec. 2025-10-03 23:23:38 02240_get_type_serialization_streams: [ OK ] 0.17 sec. 2025-10-03 23:23:38 00135_duplicate_group_by_keys_segfault: [ OK ] 0.12 sec. 2025-10-03 23:23:38 02020_exponential_smoothing_cross_block: [ OK ] 0.12 sec. 2025-10-03 23:23:38 00419_show_sql_queries: [ OK ] 0.92 sec. 2025-10-03 23:23:38 00191_aggregating_merge_tree_and_final: [ OK ] 0.17 sec. 2025-10-03 23:23:38 02875_parallel_replicas_remote: [ OK ] 0.27 sec. 2025-10-03 23:23:38 03031_clickhouse_local_input: [ OK ] 0.62 sec. 2025-10-03 23:23:38 01602_array_aggregation: [ OK ] 0.32 sec. 2025-10-03 23:23:39 02250_ON_CLUSTER_grant: [ OK ] 0.82 sec. 2025-10-03 23:23:39 01474_decimal_scale_bug: [ OK ] 0.17 sec. 2025-10-03 23:23:39 01671_ddl_hang_timeout_long: [ OK ] 21.39 sec. 2025-10-03 23:23:39 02833_local_udf_options: [ OK ] 0.42 sec. 2025-10-03 23:23:39 02346_position_countsubstrings_zero_byte: [ OK ] 0.22 sec. 2025-10-03 23:23:39 02995_index_2: [ OK ] 26.14 sec. 2025-10-03 23:23:39 00742_require_join_strictness: [ OK ] 0.12 sec. 2025-10-03 23:23:39 01747_transform_empty_arrays: [ OK ] 0.12 sec. 2025-10-03 23:23:39 02455_extract_fixed_string_from_nested_json: [ OK ] 0.17 sec. 2025-10-03 23:23:40 02128_cast_nullable: [ OK ] 0.12 sec. 2025-10-03 23:23:40 00421_storage_merge__table_index: [ OK ] 4.33 sec. 2025-10-03 23:23:40 02911_arrow_large_list: [ OK ] 0.37 sec. 2025-10-03 23:23:40 02202_use_skip_indexes_if_final: [ OK ] 0.22 sec. 2025-10-03 23:23:40 02703_storage_s3_race: [ OK ] 0.97 sec. 2025-10-03 23:23:40 01142_merge_join_lc_and_nullable_in_key: [ OK ] 0.27 sec. 2025-10-03 23:23:41 02922_analyzer_aggregate_nothing_type: [ OK ] 0.97 sec. 2025-10-03 23:23:41 00504_insert_miss_columns: [ OK ] 0.97 sec. 2025-10-03 23:23:41 02812_from_to_utc_timestamp: [ OK ] 0.97 sec. 2025-10-03 23:23:41 03033_parts_splitter_bug_and_index_loading: [ OK ] 0.17 sec. 2025-10-03 23:23:42 02677_analyzer_compound_expressions: [ OK ] 0.22 sec. 2025-10-03 23:23:42 02115_map_contains_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:23:42 01230_join_get_truncate: [ OK ] 0.17 sec. 2025-10-03 23:23:43 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 4.48 sec. 2025-10-03 23:23:43 00931_low_cardinality_read_with_empty_array: [ OK ] 0.27 sec. 2025-10-03 23:23:44 01121_remote_scalar_subquery: [ OK ] 0.17 sec. 2025-10-03 23:23:44 02241_array_first_last_or_null: [ OK ] 0.22 sec. 2025-10-03 23:23:44 00754_distributed_optimize_skip_select_on_unused_shards: [ OK ] 2.93 sec. 2025-10-03 23:23:44 00800_low_cardinality_array_group_by_arg: [ OK ] 0.17 sec. 2025-10-03 23:23:44 02522_different_types_in_storage_merge: [ OK ] 0.17 sec. 2025-10-03 23:23:44 00800_low_cardinality_merge_join: [ OK ] 0.52 sec. 2025-10-03 23:23:44 02509_h3_arguments: [ OK ] 0.17 sec. 2025-10-03 23:23:45 02122_join_group_by_timeout: [ OK ] 4.94 sec. 2025-10-03 23:23:45 01043_h3_edge_length_m: [ OK ] 0.12 sec. 2025-10-03 23:23:45 01375_output_format_tsv_csv_with_names: [ OK ] 0.72 sec. 2025-10-03 23:23:45 00078_string_concat: [ OK ] 0.72 sec. 2025-10-03 23:23:46 02982_json_columns_with_metadata_http: [ OK ] 0.72 sec. 2025-10-03 23:23:46 00960_eval_ml_method_const: [ OK ] 0.13 sec. 2025-10-03 23:23:47 00715_json_each_row_input_nested: [ OK ] 1.57 sec. 2025-10-03 23:23:47 02703_row_policy_for_database: [ OK ] 1.07 sec. 2025-10-03 23:23:47 01514_tid_function: [ OK ] 0.12 sec. 2025-10-03 23:23:48 03015_peder1001: [ OK ] 0.17 sec. 2025-10-03 23:23:48 02480_every_asynchronous_metric_must_have_documentation: [ OK ] 0.12 sec. 2025-10-03 23:23:48 03224_json_merges_new_type_in_shared_data: [ OK ] 0.22 sec. 2025-10-03 23:23:48 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.32 sec. 2025-10-03 23:23:48 03155_explain_current_transaction: [ OK ] 0.12 sec. 2025-10-03 23:23:49 00560_float_leading_plus_in_exponent: [ OK ] 0.12 sec. 2025-10-03 23:23:49 02661_read_from_archive_targz: [ OK ] 3.98 sec. 2025-10-03 23:23:49 02812_subquery_operators: [ OK ] 0.18 sec. 2025-10-03 23:23:49 03014_invalid_utf8_client: [ OK ] 0.42 sec. 2025-10-03 23:23:49 03093_special_column_errors: [ OK ] 0.32 sec. 2025-10-03 23:23:49 00559_filter_array_generic: [ OK ] 0.12 sec. 2025-10-03 23:23:49 02123_MySQLWire_regression: [ OK ] 0.17 sec. 2025-10-03 23:23:49 02952_binary: [ OK ] 0.32 sec. 2025-10-03 23:23:50 02337_check_translate_qualified_names_matcher: [ OK ] 0.12 sec. 2025-10-03 23:23:50 00579_merge_tree_partition_and_primary_keys_using_same_expression: [ OK ] 0.17 sec. 2025-10-03 23:23:50 00145_empty_likes: [ OK ] 0.17 sec. 2025-10-03 23:23:50 01351_parse_date_time_best_effort_us: [ OK ] 0.12 sec. 2025-10-03 23:23:50 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.22 sec. 2025-10-03 23:23:50 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.22 sec. 2025-10-03 23:23:50 03165_string_functions_with_token_text_indexes: [ OK ] 0.47 sec. 2025-10-03 23:23:50 02990_format_not_precedence: [ OK ] 0.12 sec. 2025-10-03 23:23:51 00942_dataparts_500: [ OK ] 0.32 sec. 2025-10-03 23:23:51 03198_group_array_intersect: [ OK ] 0.17 sec. 2025-10-03 23:23:51 00286_format_long_negative_float: [ OK ] 0.12 sec. 2025-10-03 23:23:51 03149_variant_pop_back_typo: [ OK ] 0.12 sec. 2025-10-03 23:23:51 01213_alter_table_rename_nested: [ OK ] 0.22 sec. 2025-10-03 23:23:51 00953_zookeeper_suetin_deduplication_bug: [ OK ] 13.06 sec. 2025-10-03 23:23:51 01420_logical_functions_materialized_null: [ OK ] 0.17 sec. 2025-10-03 23:23:51 02496_format_datetime_in_joda_syntax: [ OK ] 0.57 sec. 2025-10-03 23:23:51 02998_ipv6_hashing: [ OK ] 0.12 sec. 2025-10-03 23:23:52 01746_extract_text_from_html: [ OK ] 0.27 sec. 2025-10-03 23:23:52 01055_minmax_index_compact_parts: [ OK ] 1.07 sec. 2025-10-03 23:23:52 03208_inconsistent_formatting_of_not_subquery: [ OK ] 0.32 sec. 2025-10-03 23:23:52 02346_read_in_order_fixed_prefix: [ OK ] 5.53 sec. 2025-10-03 23:23:52 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.72 sec. 2025-10-03 23:23:52 02771_if_constant_folding: [ OK ] 0.12 sec. 2025-10-03 23:23:52 01247_some_msan_crashs_from_22517: [ OK ] 0.17 sec. 2025-10-03 23:23:52 03130_analyzer_array_join_prefer_column: [ OK ] 0.12 sec. 2025-10-03 23:23:52 01521_global_in_prewhere_15792: [ OK ] 0.22 sec. 2025-10-03 23:23:53 01355_defaultValueOfArgumentType_bug: [ OK ] 0.12 sec. 2025-10-03 23:23:53 00690_insert_select_converting_exception_message: [ OK ] 0.82 sec. 2025-10-03 23:23:53 02426_low_cardinality_fixed_string_insert_field: [ OK ] 0.42 sec. 2025-10-03 23:23:53 01292_optimize_data_skip_idx_order_by_expr: [ OK ] 0.17 sec. 2025-10-03 23:23:53 01001_rename_merge_race_condition: [ OK ] 10.70 sec. 2025-10-03 23:23:53 02270_errors_in_files_s3: [ OK ] 0.57 sec. 2025-10-03 23:23:53 00481_reading_from_last_granula: [ OK ] 0.17 sec. 2025-10-03 23:23:53 02476_fuse_sum_count: [ OK ] 0.22 sec. 2025-10-03 23:23:53 01631_date_overflow_as_partition_key: [ OK ] 0.17 sec. 2025-10-03 23:23:53 02706_kolmogorov_smirnov_test: [ OK ] 0.22 sec. 2025-10-03 23:23:53 02306_part_types_profile_events: [ OK ] 0.42 sec. 2025-10-03 23:23:53 00801_daylight_saving_time_hour_underflow: [ OK ] 0.12 sec. 2025-10-03 23:23:53 02842_suggest_http_page_in_error_message: [ OK ] 0.37 sec. 2025-10-03 23:23:53 02015_async_inserts_2: [ OK ] 0.58 sec. 2025-10-03 23:23:53 00052_all_left_join: [ OK ] 0.12 sec. 2025-10-03 23:23:54 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.27 sec. 2025-10-03 23:23:54 01402_cast_nullable_string_to_enum: [ OK ] 0.17 sec. 2025-10-03 23:23:54 01754_clickhouse_format_backslash: [ OK ] 0.37 sec. 2025-10-03 23:23:54 00740_database_in_nested_view: [ OK ] 0.22 sec. 2025-10-03 23:23:54 01277_fromUnixTimestamp64: [ OK ] 0.22 sec. 2025-10-03 23:23:54 02497_source_part_is_intact_when_mutation: [ OK ] 0.22 sec. 2025-10-03 23:23:54 02139_MV_with_scalar_subquery: [ OK ] 0.27 sec. 2025-10-03 23:23:54 01753_system_zookeeper_query_param_path_long: [ OK ] 0.72 sec. 2025-10-03 23:23:54 01063_create_column_set: [ OK ] 0.17 sec. 2025-10-03 23:23:55 02713_ip4_uint_compare: [ OK ] 0.12 sec. 2025-10-03 23:23:55 00497_whitespaces_in_insert: [ OK ] 1.62 sec. 2025-10-03 23:23:55 03213_distributed_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:23:55 02944_variant_as_common_type: [ FAIL ] 0.32 sec. 2025-10-03 23:23:55 Reason: result differs with reference: 2025-10-03 23:23:55 --- /usr/share/clickhouse-test/queries/0_stateless/02944_variant_as_common_type.reference 2025-10-03 23:13:23.375414432 +0100 2025-10-03 23:23:55 +++ /tmp/clickhouse-test/0_stateless/02944_variant_as_common_type.stdout 2025-10-03 23:23:55.371708511 +0100 2025-10-03 23:23:55 @@ -1,51 +1,51 @@ 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -Array(UInt8) [1,2,3] 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 -String str_0 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -String str_2 2025-10-03 23:23:55 -String str_3 2025-10-03 23:23:55 -Nullable(String) str_0 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -Nullable(String) str_2 2025-10-03 23:23:55 -Nullable(String) str_3 2025-10-03 23:23:55 -Array(UInt64) [0] 2025-10-03 23:23:55 -Array(UInt64) [0,1] 2025-10-03 23:23:55 -Array(UInt64) [0,1,2] 2025-10-03 23:23:55 -Array(UInt64) [0,1,2,3] 2025-10-03 23:23:55 -Array(UInt64) [0] 2025-10-03 23:23:55 -Array(UInt64) [0,1] 2025-10-03 23:23:55 -Array(UInt64) [0,1,2] 2025-10-03 23:23:55 -Array(UInt64) [0,1,2,3] 2025-10-03 23:23:55 -String str_0 2025-10-03 23:23:55 -String str_1 2025-10-03 23:23:55 -String str_2 2025-10-03 23:23:55 -String str_3 2025-10-03 23:23:55 -Nullable(String) str_0 2025-10-03 23:23:55 -Nullable(String) str_1 2025-10-03 23:23:55 -Nullable(String) str_2 2025-10-03 23:23:55 -Nullable(String) str_3 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) [1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt8), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_0 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_2 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_3 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_0 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_2 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_3 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1,2] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1,2] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) [0,1,2,3] 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_0 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_2 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_3 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_0 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_1 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_2 2025-10-03 23:23:55 +Variant(Array(UInt64), String) str_3 2025-10-03 23:23:55 Variant(Array(UInt64), String) str_0 2025-10-03 23:23:55 Variant(Array(UInt64), String) str_1 2025-10-03 23:23:55 Variant(Array(UInt64), String) str_2 2025-10-03 23:23:55 2025-10-03 23:23:55 2025-10-03 23:23:55 Settings used in the test: --max_insert_threads 12 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 32813337 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 5222729 --max_read_buffer_size 745764 --prefer_localhost_replica 0 --max_block_size 60520 --max_joined_block_size_rows 97052 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 82 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 7325045 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 27 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1330523231 --min_compress_block_size 872930 --max_compress_block_size 999336 --merge_tree_compact_parts_min_granules_to_multibuffer_read 64 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 9195512 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone America/Mazatlan --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.68 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 1 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2025-10-03 23:23:55 2025-10-03 23:23:55 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1619269429 --index_granularity_bytes 5167800 --merge_max_block_size 5742 --index_granularity 11689 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 19792 --primary_key_compress_block_size 54242 --replace_long_file_name_to_hash 1 --max_file_name_length 128 --min_bytes_for_full_part_storage 180021142 --compact_parts_max_bytes_to_buffer 36759683 --compact_parts_max_granules_to_buffer 256 --compact_parts_merge_max_bytes_to_prefetch_part 21965486 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 14 --old_parts_lifetime 246 2025-10-03 23:23:55 2025-10-03 23:23:55 Database: test_hrml5uiu 2025-10-03 23:23:55 01065_array_zip_mixed_const: [ OK ] 0.17 sec. 2025-10-03 23:23:55 00266_read_overflow_mode: [ OK ] 0.12 sec. 2025-10-03 23:23:55 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.12 sec. 2025-10-03 23:23:55 02731_zero_objects_in_metadata: [ OK ] 1.22 sec. 2025-10-03 23:23:55 01520_client_print_query_id: [ OK ] 0.42 sec. 2025-10-03 23:23:56 02845_join_on_cond_sparse: [ OK ] 0.17 sec. 2025-10-03 23:23:56 02943_positional_arguments_bugs: [ OK ] 0.17 sec. 2025-10-03 23:23:56 03274_format_inference_create_query_file: [ OK ] 0.47 sec. 2025-10-03 23:23:57 02234_cast_to_ip_address: [ OK ] 2.02 sec. 2025-10-03 23:23:57 01825_new_type_json_11: [ OK ] 1.37 sec. 2025-10-03 23:23:57 02122_parallel_formatting_Vertical: [ OK ] 1.57 sec. 2025-10-03 23:23:57 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.17 sec. 2025-10-03 23:23:58 02354_vector_search_default_granularity: [ OK ] 0.17 sec. 2025-10-03 23:23:58 03164_create_as_default: [ OK ] 0.17 sec. 2025-10-03 23:23:58 03197_storage_join_strictness_type_restriction: [ OK ] 0.12 sec. 2025-10-03 23:23:58 00851_http_insert_json_defaults: [ OK ] 0.67 sec. 2025-10-03 23:23:58 00429_long_http_bufferization: [ OK ] 17.06 sec. 2025-10-03 23:23:58 00084_summing_merge_tree: [ OK ] 0.28 sec. 2025-10-03 23:23:58 03248_invalid_where: [ OK ] 0.12 sec. 2025-10-03 23:23:58 01710_normal_projection_join_plan_fix: [ OK ] 0.17 sec. 2025-10-03 23:23:58 03148_query_log_used_dictionaries: [ OK ] 0.57 sec. 2025-10-03 23:23:58 02905_system_logs_hostname: [ OK ] 0.17 sec. 2025-10-03 23:23:58 02375_scalar_lc_cte: [ OK ] 0.12 sec. 2025-10-03 23:23:58 02131_remove_columns_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:23:59 02541_lightweight_delete_on_cluster: [ OK ] 0.27 sec. 2025-10-03 23:23:59 01271_optimize_arithmetic_operations_in_aggr_func_with_alias: [ OK ] 0.17 sec. 2025-10-03 23:23:59 00914_replicate: [ OK ] 0.12 sec. 2025-10-03 23:23:59 02518_merge_engine_nullable_43324: [ OK ] 0.17 sec. 2025-10-03 23:23:59 02024_join_on_or_long: [ OK ] 0.87 sec. 2025-10-03 23:23:59 00432_aggregate_function_scalars_and_constants: [ OK ] 0.27 sec. 2025-10-03 23:23:59 01683_codec_encrypted: [ OK ] 0.17 sec. 2025-10-03 23:23:59 02474_timeDiff_UTCTimestamp: [ OK ] 0.17 sec. 2025-10-03 23:23:59 02236_explain_pipeline_join: [ OK ] 0.12 sec. 2025-10-03 23:23:59 01576_alias_column_rewrite: [ OK ] 0.42 sec. 2025-10-03 23:23:59 01061_alter_codec_with_type: [ OK ] 0.17 sec. 2025-10-03 23:23:59 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.22 sec. 2025-10-03 23:23:59 02519_monotonicity_fuzz: [ OK ] 0.17 sec. 2025-10-03 23:23:59 02346_fulltext_index_old_name: [ OK ] 0.22 sec. 2025-10-03 23:23:59 02716_int256_arrayfunc: [ OK ] 0.17 sec. 2025-10-03 23:23:59 00142_parse_timestamp_as_datetime: [ OK ] 0.27 sec. 2025-10-03 23:23:59 00534_functions_bad_arguments8: [ OK ] 5.58 sec. 2025-10-03 23:24:00 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.12 sec. 2025-10-03 23:24:00 00098_8_union_all: [ OK ] 0.12 sec. 2025-10-03 23:24:00 02560_analyzer_materialized_view: [ OK ] 0.27 sec. 2025-10-03 23:24:00 01017_uniqCombined_memory_usage: [ OK ] 0.57 sec. 2025-10-03 23:24:00 02443_detach_attach_partition: [ OK ] 5.99 sec. 2025-10-03 23:24:00 00941_to_custom_week: [ OK ] 0.22 sec. 2025-10-03 23:24:00 01442_h3kring_range_check: [ OK ] 0.17 sec. 2025-10-03 23:24:00 02834_alter_exception: [ OK ] 0.12 sec. 2025-10-03 23:24:00 01605_key_condition_enum_int: [ OK ] 0.17 sec. 2025-10-03 23:24:00 00541_to_start_of_fifteen_minutes: [ OK ] 0.12 sec. 2025-10-03 23:24:00 02790_url_multiple_tsv_files: [ OK ] 0.57 sec. 2025-10-03 23:24:00 01073_window_view_event_tumble_to_asc_populate: [ OK ] 1.17 sec. 2025-10-03 23:24:01 02125_dict_get_type_nullable_fix: [ OK ] 0.17 sec. 2025-10-03 23:24:12 00913_many_threads: [ OK ] 11.49 sec. 2025-10-03 23:24:12 02844_max_backup_bandwidth_s3: [ OK ] 37.11 sec. 2025-10-03 23:24:12 02476_analyzer_join_with_unused_columns: [ OK ] 0.17 sec. 2025-10-03 23:24:12 00305_http_and_readonly: [ OK ] 11.79 sec. 2025-10-03 23:24:12 02813_system_licenses_base: [ OK ] 0.12 sec. 2025-10-03 23:24:12 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.12 sec. 2025-10-03 23:24:12 01290_max_execution_speed_distributed: [ OK ] 11.99 sec. 2025-10-03 23:24:12 01353_topk_enum: [ OK ] 0.12 sec. 2025-10-03 23:24:12 01710_projections: [ OK ] 0.27 sec. 2025-10-03 23:24:12 02366_kql_mvexpand: [ OK ] 0.17 sec. 2025-10-03 23:24:12 02812_bug_with_unused_join_columns: [ OK ] 0.12 sec. 2025-10-03 23:24:13 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.17 sec. 2025-10-03 23:24:13 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.37 sec. 2025-10-03 23:24:13 01300_svg: [ OK ] 0.37 sec. 2025-10-03 23:24:13 01958_partial_hour_timezone: [ OK ] 0.12 sec. 2025-10-03 23:24:13 01825_type_json_7: [ OK ] 0.82 sec. 2025-10-03 23:24:13 01518_nullable_aggregate_states2: [ OK ] 12.84 sec. 2025-10-03 23:24:13 00725_memory_tracking: [ OK ] 0.27 sec. 2025-10-03 23:24:14 02869_unicode_minus: [ OK ] 0.12 sec. 2025-10-03 23:24:14 00916_create_or_replace_view: [ OK ] 0.18 sec. 2025-10-03 23:24:14 02380_insert_mv_race: [ OK ] 0.92 sec. 2025-10-03 23:24:14 02708_dotProduct: [ OK ] 0.37 sec. 2025-10-03 23:24:14 02473_functions_in_readonly_mode: [ OK ] 0.87 sec. 2025-10-03 23:24:14 01179_insert_values_semicolon: [ OK ] 0.47 sec. 2025-10-03 23:24:14 03195_group_concat_deserialization_fix: [ OK ] 0.17 sec. 2025-10-03 23:24:14 02871_clickhouse_client_restart_pager: [ OK ] 0.47 sec. 2025-10-03 23:24:14 02421_decimal_in_precision_issue_41125: [ OK ] 0.22 sec. 2025-10-03 23:24:14 02734_sparse_columns_short_circuit: [ OK ] 0.17 sec. 2025-10-03 23:24:14 03003_compatibility_setting_bad_value: [ OK ] 0.12 sec. 2025-10-03 23:24:14 01000_bad_size_of_marks_skip_idx: [ OK ] 0.27 sec. 2025-10-03 23:24:14 03000_too_big_max_execution_time_setting: [ OK ] 0.12 sec. 2025-10-03 23:24:15 02953_slow_create_view: [ OK ] 0.12 sec. 2025-10-03 23:24:15 01470_test_insert_select_asterisk: [ OK ] 0.22 sec. 2025-10-03 23:24:15 03003_count_asterisk_filter: [ OK ] 0.17 sec. 2025-10-03 23:24:15 00972_geohashesInBox: [ OK ] 0.52 sec. 2025-10-03 23:24:15 02152_short_circuit_throw_if: [ OK ] 0.12 sec. 2025-10-03 23:24:15 00646_weird_mmx: [ OK ] 0.17 sec. 2025-10-03 23:24:15 01769_extended_range_2: [ OK ] 0.17 sec. 2025-10-03 23:24:15 00980_full_join_crash_fancyqlx: [ OK ] 0.17 sec. 2025-10-03 23:24:15 02364_window_case: [ OK ] 0.12 sec. 2025-10-03 23:24:15 00552_logical_functions_uint8_as_bool: [ OK ] 0.12 sec. 2025-10-03 23:24:15 00017_in_subquery_with_empty_result: [ OK ] 0.12 sec. 2025-10-03 23:24:15 01017_tsv_empty_as_default: [ OK ] 0.77 sec. 2025-10-03 23:24:16 00534_functions_bad_arguments10: [ OK ] 16.15 sec. 2025-10-03 23:24:16 03166_skip_indexes_vertical_merge_1: [ OK ] 0.52 sec. 2025-10-03 23:24:16 02970_visible_width_behavior: [ OK ] 0.17 sec. 2025-10-03 23:24:16 01763_long_ttl_group_by: [ OK ] 0.72 sec. 2025-10-03 23:24:16 00968_file_engine_in_subquery: [ OK ] 0.27 sec. 2025-10-03 23:24:17 02428_index_analysis_with_null_literal: [ OK ] 0.47 sec. 2025-10-03 23:24:17 00725_join_on_bug_2: [ OK ] 0.22 sec. 2025-10-03 23:24:17 02900_union_schema_inference_mode: [ OK ] 1.07 sec. 2025-10-03 23:24:17 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.27 sec. 2025-10-03 23:24:18 02811_ip_dict_attribute: [ OK ] 0.17 sec. 2025-10-03 23:24:18 01825_type_json_ghdata: [ OK ] 2.48 sec. 2025-10-03 23:24:18 00718_format_datetime: [ OK ] 0.52 sec. 2025-10-03 23:24:18 02207_ttl_move_if_exists: [ OK ] 0.17 sec. 2025-10-03 23:24:18 03246_range_literal_replacement_works: [ OK ] 0.17 sec. 2025-10-03 23:24:18 01902_table_function_merge_db_params: [ OK ] 0.17 sec. 2025-10-03 23:24:18 02426_to_string_nullable_fixedstring: [ OK ] 0.12 sec. 2025-10-03 23:24:18 02559_add_parts: [ OK ] 0.17 sec. 2025-10-03 23:24:18 01376_null_logical: [ OK ] 0.17 sec. 2025-10-03 23:24:18 02513_analyzer_duplicate_alias_crash_fix: [ OK ] 0.12 sec. 2025-10-03 23:24:18 01916_multiple_join_view_optimize_predicate_chertus: [ OK ] 0.17 sec. 2025-10-03 23:24:18 03217_datetime64_constant_to_ast: [ OK ] 0.12 sec. 2025-10-03 23:24:18 02567_and_consistency: [ OK ] 0.22 sec. 2025-10-03 23:24:18 00662_has_nullable: [ OK ] 0.22 sec. 2025-10-03 23:24:19 02591_bson_long_tuple: [ OK ] 0.12 sec. 2025-10-03 23:24:19 00920_multiply_aggregate_states_constants: [ OK ] 0.12 sec. 2025-10-03 23:24:19 01902_self_aliases_in_columns: [ OK ] 0.12 sec. 2025-10-03 23:24:19 02982_changeDate: [ OK ] 0.62 sec. 2025-10-03 23:24:19 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.32 sec. 2025-10-03 23:24:19 00563_shard_insert_into_remote: [ OK ] 0.17 sec. 2025-10-03 23:24:19 01655_plan_optimizations: [ OK ] 4.93 sec. 2025-10-03 23:24:20 01323_add_scalars_in_time: [ OK ] 0.22 sec. 2025-10-03 23:24:20 02402_merge_engine_with_view: [ OK ] 0.17 sec. 2025-10-03 23:24:20 02137_mv_into_join: [ OK ] 0.22 sec. 2025-10-03 23:24:20 00616_final_single_part: [ OK ] 0.22 sec. 2025-10-03 23:24:20 01603_insert_select_too_many_parts: [ OK ] 4.19 sec. 2025-10-03 23:24:20 02016_order_by_with_fill_monotonic_functions_removal: [ OK ] 0.12 sec. 2025-10-03 23:24:20 01312_case_insensitive_regexp: [ OK ] 0.17 sec. 2025-10-03 23:24:20 00240_replace_substring_loop: [ OK ] 0.57 sec. 2025-10-03 23:24:21 02770_async_buffer_ignore: [ OK ] 0.82 sec. 2025-10-03 23:24:21 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:24:21 01926_union_all_schmak: [ OK ] 0.12 sec. 2025-10-03 23:24:21 01891_partition_hash_no_long_int: [ OK ] 0.17 sec. 2025-10-03 23:24:21 00974_primary_key_for_lowCardinality: [ OK ] 1.17 sec. 2025-10-03 23:24:22 02047_client_exception: [ OK ] 0.47 sec. 2025-10-03 23:24:22 02750_settings_alias_tcp_protocol: [ OK ] 0.42 sec. 2025-10-03 23:24:22 01676_clickhouse_client_autocomplete: [ OK ] 3.18 sec. 2025-10-03 23:24:22 03036_test_parquet_bloom_filter_push_down: [ OK ] 2.93 sec. 2025-10-03 23:24:22 01801_distinct_group_by_shard: [ OK ] 0.12 sec. 2025-10-03 23:24:22 01851_clear_column_referenced_by_mv: [ OK ] 0.17 sec. 2025-10-03 23:24:22 03209_functions_json_msan_fuzzer_issue: [ OK ] 0.12 sec. 2025-10-03 23:24:22 01825_type_json_schema_race_long: [ OK ] 22.12 sec. 2025-10-03 23:24:22 01766_todatetime64_no_timezone_arg: [ OK ] 0.12 sec. 2025-10-03 23:24:22 01710_aggregate_projection_with_hashing: [ OK ] 0.17 sec. 2025-10-03 23:24:22 02356_insert_query_log_metrics: [ OK ] 0.22 sec. 2025-10-03 23:24:22 01016_macros: [ OK ] 0.12 sec. 2025-10-03 23:24:23 00986_materialized_view_stack_overflow: [ OK ] 0.43 sec. 2025-10-03 23:24:23 00423_storage_log_single_thread: [ OK ] 0.17 sec. 2025-10-03 23:24:23 02016_aggregation_spark_bar: [ OK ] 0.42 sec. 2025-10-03 23:24:23 00274_shard_group_array: [ OK ] 0.17 sec. 2025-10-03 23:24:23 00748_insert_array_with_null: [ OK ] 0.17 sec. 2025-10-03 23:24:23 01114_mysql_database_engine_segfault: [ OK ] 0.12 sec. 2025-10-03 23:24:23 02252_reset_non_existing_setting: [ OK ] 0.12 sec. 2025-10-03 23:24:23 00701_context_use_after_free: [ OK ] 0.17 sec. 2025-10-03 23:24:23 02006_h3_to_geo_boundary: [ OK ] 0.17 sec. 2025-10-03 23:24:23 02351_Map_combinator_dist: [ OK ] 0.22 sec. 2025-10-03 23:24:23 03006_join_on_inequal_expression_fast: [ OK ] 1.52 sec. 2025-10-03 23:24:23 03005_input_function_in_join: [ OK ] 0.17 sec. 2025-10-03 23:24:23 02180_insert_into_values_settings: [ OK ] 0.12 sec. 2025-10-03 23:24:23 03144_asof_join_ddb_doubles: [ OK ] 0.17 sec. 2025-10-03 23:24:23 02100_low_cardinality_nullable_null_default: [ OK ] 2.68 sec. 2025-10-03 23:24:23 02338_analyzer_constants_basic: [ OK ] 0.22 sec. 2025-10-03 23:24:23 02882_primary_key_index_in_function_different_types: [ OK ] 0.17 sec. 2025-10-03 23:24:24 00173_compare_date_time_with_constant_string: [ OK ] 0.37 sec. 2025-10-03 23:24:24 02007_join_use_nulls: [ OK ] 0.17 sec. 2025-10-03 23:24:24 03271_dynamic_variant_in_min_max: [ OK ] 0.22 sec. 2025-10-03 23:24:24 02556_local_with_totals_and_extremes: [ OK ] 0.42 sec. 2025-10-03 23:24:24 01851_s2_to_geo: [ OK ] 0.12 sec. 2025-10-03 23:24:24 02514_bad_index_granularity: [ OK ] 0.12 sec. 2025-10-03 23:24:24 02152_invalid_setting_with_hints_in_http_request: [ OK ] 0.37 sec. 2025-10-03 23:24:24 02184_storage_add_support_ttl: [ OK ] 0.22 sec. 2025-10-03 23:24:24 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.17 sec. 2025-10-03 23:24:24 03144_alter_column_and_read: [ OK ] 0.17 sec. 2025-10-03 23:24:24 02814_age_datediff: [ OK ] 0.32 sec. 2025-10-03 23:24:24 03013_fuzz_arrayPartialReverseSort: [ OK ] 0.12 sec. 2025-10-03 23:24:24 00448_replicate_nullable_tuple_generic: [ OK ] 0.12 sec. 2025-10-03 23:24:24 00424_shard_aggregate_functions_of_nullable: [ OK ] 0.17 sec. 2025-10-03 23:24:24 02235_check_table_sparse_serialization: [ OK ] 0.17 sec. 2025-10-03 23:24:24 01673_test_toMinute_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:24:24 02911_join_on_nullsafe_optimization: [ OK ] 0.38 sec. 2025-10-03 23:24:24 01514_input_format_tsv_enum_as_number_setting: [ OK ] 0.17 sec. 2025-10-03 23:24:25 01633_limit_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:24:25 01357_result_rows: [ OK ] 0.32 sec. 2025-10-03 23:24:25 01552_alter_name_collision: [ OK ] 0.18 sec. 2025-10-03 23:24:25 01867_fix_storage_memory_mutation: [ OK ] 0.17 sec. 2025-10-03 23:24:25 01015_attach_part: [ OK ] 0.17 sec. 2025-10-03 23:24:25 02293_compatibility_ignore_auto_increment_in_create_table: [ OK ] 0.28 sec. 2025-10-03 23:24:25 02995_index_9: [ OK ] 3.54 sec. 2025-10-03 23:24:25 02324_compatibility_setting: [ OK ] 1.17 sec. 2025-10-03 23:24:25 02458_datediff_date32: [ OK ] 0.37 sec. 2025-10-03 23:24:25 01356_initialize_aggregation: [ OK ] 0.17 sec. 2025-10-03 23:24:26 01796_Log_rwlock_ub: [ OK ] 0.17 sec. 2025-10-03 23:24:26 02144_avg_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:24:26 03198_orc_read_time_zone: [ OK ] 0.72 sec. 2025-10-03 23:24:26 02866_size_of_marks_skip_idx_explain: [ OK ] 0.17 sec. 2025-10-03 23:24:26 01558_ttest_scipy: [ OK ] 1.72 sec. 2025-10-03 23:24:26 02280_add_query_level_settings: [ OK ] 0.17 sec. 2025-10-03 23:24:26 03120_analyzer_param_in_CTE_alias: [ OK ] 0.12 sec. 2025-10-03 23:24:26 01799_long_uniq_theta_sketch: [ OK ] 1.53 sec. 2025-10-03 23:24:26 02383_array_signed_const_positive_index: [ OK ] 0.22 sec. 2025-10-03 23:24:26 01560_merge_distributed_join: [ OK ] 0.22 sec. 2025-10-03 23:24:26 03215_varian_as_common_type_tuple_map: [ OK ] 0.12 sec. 2025-10-03 23:24:26 01071_http_header_exception_code: [ OK ] 0.32 sec. 2025-10-03 23:24:26 02885_ephemeral_columns_from_file: [ OK ] 0.92 sec. 2025-10-03 23:24:26 03164_materialize_skip_index: [ OK ] 0.37 sec. 2025-10-03 23:24:26 03151_pmj_join_non_procssed_clash: [ OK ] 0.17 sec. 2025-10-03 23:24:26 00098_j_union_all: [ OK ] 0.12 sec. 2025-10-03 23:24:26 01495_subqueries_in_with_statement_4: [ OK ] 0.12 sec. 2025-10-03 23:24:27 03008_optimize_equal_ranges: [ OK ] 0.27 sec. 2025-10-03 23:24:27 02916_set_formatting: [ OK ] 0.17 sec. 2025-10-03 23:24:27 01012_reset_running_accumulate: [ OK ] 0.12 sec. 2025-10-03 23:24:27 02566_analyzer_limit_settings_distributed: [ OK ] 0.17 sec. 2025-10-03 23:24:27 00980_shard_aggregation_state_deserialization: [ OK ] 0.17 sec. 2025-10-03 23:24:27 02409_url_format_detection: [ OK ] 0.12 sec. 2025-10-03 23:24:27 01115_join_with_dictionary: [ OK ] 0.47 sec. 2025-10-03 23:24:27 02367_analyzer_table_alias_columns: [ OK ] 0.22 sec. 2025-10-03 23:24:27 01701_clear_projection_and_part_remove: [ OK ] 0.22 sec. 2025-10-03 23:24:27 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.17 sec. 2025-10-03 23:24:27 03041_recursive_cte_postgres_7: [ OK ] 0.32 sec. 2025-10-03 23:24:27 02497_if_transform_strings_to_enum: [ OK ] 0.32 sec. 2025-10-03 23:24:27 03089_analyzer_alias_replacement: [ OK ] 0.12 sec. 2025-10-03 23:24:27 01778_where_with_column_name: [ OK ] 0.17 sec. 2025-10-03 23:24:28 00974_distributed_join_on: [ OK ] 0.32 sec. 2025-10-03 23:24:28 02011_http_parsing: [ OK ] 0.37 sec. 2025-10-03 23:24:28 01655_sleep_infinite_float: [ OK ] 0.12 sec. 2025-10-03 23:24:28 02346_fulltext_index_search: [ OK ] 1.02 sec. 2025-10-03 23:24:28 03129_low_cardinality_nullable_non_first_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:24:28 02296_ttl_non_deterministic: [ OK ] 0.27 sec. 2025-10-03 23:24:28 00564_initial_column_values_with_default_expression: [ OK ] 0.17 sec. 2025-10-03 23:24:28 01937_nested_chinese: [ OK ] 0.12 sec. 2025-10-03 23:24:28 01586_replicated_mutations_empty_partition: [ OK ] 0.32 sec. 2025-10-03 23:24:28 02763_jit_compare_functions_nan: [ OK ] 0.22 sec. 2025-10-03 23:24:28 00433_ifnull: [ OK ] 0.17 sec. 2025-10-03 23:24:28 02704_storage_merge_explain_graph_crash: [ OK ] 0.17 sec. 2025-10-03 23:24:28 00946_ml_test: [ OK ] 0.18 sec. 2025-10-03 23:24:29 02125_lz4_compression_bug_JSONStringsEachRow: [ OK ] 2.98 sec. 2025-10-03 23:24:29 00059_shard_global_in_mergetree: [ OK ] 0.27 sec. 2025-10-03 23:24:29 01562_agg_null_for_empty_ahead: [ OK ] 0.22 sec. 2025-10-03 23:24:29 03174_projection_deduplicate: [ OK ] 0.17 sec. 2025-10-03 23:24:29 00488_column_name_primary: [ OK ] 0.17 sec. 2025-10-03 23:24:29 02916_joinget_dependency: [ OK ] 0.62 sec. 2025-10-03 23:24:29 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.12 sec. 2025-10-03 23:24:29 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.12 sec. 2025-10-03 23:24:30 03203_fill_missed_subcolumns: [ OK ] 0.27 sec. 2025-10-03 23:24:30 01814_distributed_push_down_limit: [ OK ] 1.22 sec. 2025-10-03 23:24:30 00900_long_parquet_load: [ OK ] 17.68 sec. 2025-10-03 23:24:30 01212_empty_join_and_totals: [ OK ] 0.12 sec. 2025-10-03 23:24:30 02560_tuple_format: [ OK ] 0.37 sec. 2025-10-03 23:24:30 01706_optimize_normalize_count_variants: [ OK ] 0.12 sec. 2025-10-03 23:24:30 01896_jit_aggregation_function_if_long: [ OK ] 0.67 sec. 2025-10-03 23:24:31 03243_check_for_nullable_nothing_in_alter: [ OK ] 0.17 sec. 2025-10-03 23:24:31 00990_metric_log_table_not_empty: [ OK ] 2.22 sec. 2025-10-03 23:24:31 00185_array_literals: [ OK ] 0.22 sec. 2025-10-03 23:24:31 01213_alter_rename_column_zookeeper_long: [ OK ] 1.72 sec. 2025-10-03 23:24:31 01259_combinator_distinct: [ OK ] 0.17 sec. 2025-10-03 23:24:31 02475_date_time_schema_inference_bug: [ OK ] 0.12 sec. 2025-10-03 23:24:31 03210_convert_outer_join_to_inner_join_any_join: [ OK ] 0.17 sec. 2025-10-03 23:24:31 01254_dict_load_after_detach_attach: [ OK ] 0.17 sec. 2025-10-03 23:24:31 01526_param_uuid: [ OK ] 0.42 sec. 2025-10-03 23:24:31 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.17 sec. 2025-10-03 23:24:32 00534_functions_bad_arguments2: [ OK ] 4.43 sec. 2025-10-03 23:24:32 00990_function_current_user: [ OK ] 0.12 sec. 2025-10-03 23:24:32 00481_create_view_for_null: [ OK ] 0.17 sec. 2025-10-03 23:24:32 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 1.98 sec. 2025-10-03 23:24:32 01031_new_any_join: [ OK ] 0.27 sec. 2025-10-03 23:24:32 01716_drop_rename_sign_column: [ OK ] 0.12 sec. 2025-10-03 23:24:32 00670_truncate_temporary_table: [ OK ] 0.17 sec. 2025-10-03 23:24:32 02702_allow_skip_errors_enum: [ OK ] 0.67 sec. 2025-10-03 23:24:32 00114_float_type_result_of_division: [ OK ] 0.12 sec. 2025-10-03 23:24:32 01710_projection_mutation: [ OK ] 0.17 sec. 2025-10-03 23:24:33 01114_database_atomic: [ OK ] 55.01 sec. 2025-10-03 23:24:33 01253_subquery_in_aggregate_function_JustStranger: [ OK ] 0.17 sec. 2025-10-03 23:24:33 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 1.47 sec. 2025-10-03 23:24:33 01059_storage_file_compression: [ OK ] 6.54 sec. 2025-10-03 23:24:33 02386_set_columns_order: [ OK ] 0.17 sec. 2025-10-03 23:24:34 02354_tuple_element_with_default: [ OK ] 0.17 sec. 2025-10-03 23:24:34 02497_storage_join_right_assert: [ OK ] 0.17 sec. 2025-10-03 23:24:34 02968_file_log_multiple_read: [ OK ] 3.78 sec. 2025-10-03 23:24:34 01926_order_by_desc_limit: [ OK ] 1.67 sec. 2025-10-03 23:24:34 02125_lz4_compression_bug_Values: [ OK ] 2.28 sec. 2025-10-03 23:24:34 03209_json_type_merges_small: [ OK ] 2.42 sec. 2025-10-03 23:24:34 02112_delayed_clickhouse_local_with_queries_file: [ OK ] 0.42 sec. 2025-10-03 23:24:34 01453_fixsed_string_sort: [ OK ] 0.22 sec. 2025-10-03 23:24:34 00057_join_aliases: [ OK ] 0.12 sec. 2025-10-03 23:24:35 01327_decimal_cut_extra_digits_after_point: [ OK ] 0.17 sec. 2025-10-03 23:24:35 02693_multiple_joins_in: [ OK ] 0.12 sec. 2025-10-03 23:24:35 02316_values_table_func_bug: [ OK ] 0.12 sec. 2025-10-03 23:24:35 01774_case_sensitive_connection_id: [ OK ] 0.12 sec. 2025-10-03 23:24:35 01033_function_substring: [ OK ] 0.52 sec. 2025-10-03 23:24:35 00619_extract: [ OK ] 0.17 sec. 2025-10-03 23:24:35 00954_client_prepared_statements: [ OK ] 1.83 sec. 2025-10-03 23:24:35 01895_jit_aggregation_function_avg_long: [ OK ] 0.57 sec. 2025-10-03 23:24:35 02246_is_secure_query_log: [ OK ] 1.47 sec. 2025-10-03 23:24:35 02462_number_to_datetype: [ OK ] 0.22 sec. 2025-10-03 23:24:35 03076_analyzer_multiple_joins_alias: [ OK ] 0.12 sec. 2025-10-03 23:24:36 02868_operator_is_not_distinct_from_priority: [ OK ] 0.17 sec. 2025-10-03 23:24:36 00950_default_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:24:36 02474_create_user_query_fuzzer_bug: [ OK ] 0.12 sec. 2025-10-03 23:24:36 02267_output_format_prometheus: [ OK ] 0.17 sec. 2025-10-03 23:24:42 02306_rowbinary_has_no_bom: [ OK ] 0.37 sec. 2025-10-03 23:24:42 02995_index_8: [ OK ] 11.45 sec. 2025-10-03 23:24:43 03199_join_with_materialized_column: [ OK ] 6.79 sec. 2025-10-03 23:24:43 03036_schema_inference_cache_s3_archives: [ OK ] 7.29 sec. 2025-10-03 23:24:43 02473_map_element_nullable: [ OK ] 0.17 sec. 2025-10-03 23:24:43 00273_quantiles: [ OK ] 0.22 sec. 2025-10-03 23:24:43 02962_analyzer_constant_set: [ OK ] 0.17 sec. 2025-10-03 23:24:43 01825_type_json_missed_values: [ OK ] 0.22 sec. 2025-10-03 23:24:43 03303_alias_inverse_order: [ OK ] 0.17 sec. 2025-10-03 23:24:43 00276_sample: [ OK ] 7.64 sec. 2025-10-03 23:24:43 01010_partial_merge_join_negative: [ OK ] 0.27 sec. 2025-10-03 23:24:43 00379_system_processes_port: [ OK ] 0.32 sec. 2025-10-03 23:24:43 00466_comments_in_keyword: [ OK ] 0.17 sec. 2025-10-03 23:24:43 03205_parallel_replicas_alter_select_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:24:43 01449_json_compact_strings: [ OK ] 0.12 sec. 2025-10-03 23:24:43 03039_dynamic_collapsing_merge_tree: [ OK ] 10.35 sec. 2025-10-03 23:24:44 00262_alter_alias: [ OK ] 0.22 sec. 2025-10-03 23:24:44 02332_dist_insert_send_logs_level: [ OK ] 0.52 sec. 2025-10-03 23:24:44 00003_reinterpret_as_string: [ OK ] 0.12 sec. 2025-10-03 23:24:44 03157_dynamic_type_json: [ OK ] 0.17 sec. 2025-10-03 23:24:44 00538_datediff_plural_units: [ OK ] 0.17 sec. 2025-10-03 23:24:44 00823_capnproto_input: [ OK ] 0.77 sec. 2025-10-03 23:24:44 00395_nullable: [ OK ] 9.19 sec. 2025-10-03 23:24:44 03095_group_by_server_constants_bug: [ OK ] 0.17 sec. 2025-10-03 23:24:44 03124_analyzer_nested_CTE_dist_in: [ OK ] 0.17 sec. 2025-10-03 23:24:44 00712_prewhere_with_alias: [ OK ] 0.32 sec. 2025-10-03 23:24:44 00965_logs_level_bugfix: [ OK ] 0.77 sec. 2025-10-03 23:24:44 02122_parallel_formatting_JSON: [ OK ] 1.52 sec. 2025-10-03 23:24:44 00041_aggregation_remap: [ OK ] 0.17 sec. 2025-10-03 23:24:44 00668_compare_arrays_silviucpp: [ OK ] 0.17 sec. 2025-10-03 23:24:44 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.37 sec. 2025-10-03 23:24:44 02831_ast_fuzz_asan_join: [ OK ] 0.12 sec. 2025-10-03 23:24:45 00098_f_union_all: [ OK ] 0.17 sec. 2025-10-03 23:24:45 01550_create_map_type: [ OK ] 0.62 sec. 2025-10-03 23:24:45 01268_mergine_sorted_limit: [ OK ] 0.17 sec. 2025-10-03 23:24:45 00315_quantile_off_by_one: [ OK ] 0.13 sec. 2025-10-03 23:24:45 02320_mapped_array_witn_const_nullable: [ OK ] 0.17 sec. 2025-10-03 23:24:45 02882_replicated_fetch_checksums_doesnt_match: [ OK ] 0.52 sec. 2025-10-03 23:24:45 01352_add_datetime_bad_get: [ OK ] 0.12 sec. 2025-10-03 23:24:45 01105_string_like: [ OK ] 0.22 sec. 2025-10-03 23:24:45 03051_many_ctes: [ OK ] 0.12 sec. 2025-10-03 23:24:45 00740_optimize_predicate_expression: [ OK ] 0.17 sec. 2025-10-03 23:24:45 02190_current_metrics_query: [ OK ] 0.12 sec. 2025-10-03 23:24:45 01585_use_index_for_global_in: [ OK ] 0.22 sec. 2025-10-03 23:24:45 00918_has_unsufficient_type_check: [ OK ] 0.17 sec. 2025-10-03 23:24:46 02028_system_data_skipping_indices_size: [ OK ] 0.17 sec. 2025-10-03 23:24:46 00752_low_cardinality_permute: [ OK ] 0.17 sec. 2025-10-03 23:24:46 02340_analyzer_functions: [ OK ] 0.17 sec. 2025-10-03 23:24:46 00025_implicitly_used_subquery_column: [ OK ] 0.12 sec. 2025-10-03 23:24:46 00562_in_subquery_merge_tree: [ OK ] 0.22 sec. 2025-10-03 23:24:46 02239_bzip2_bug: [ OK ] 1.77 sec. 2025-10-03 23:24:46 01091_query_profiler_does_not_hang: [ OK ] 0.37 sec. 2025-10-03 23:24:46 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 2.17 sec. 2025-10-03 23:24:46 02013_zlib_read_after_eof: [ OK ] 1.17 sec. 2025-10-03 23:24:47 01710_aggregate_projection_with_normalized_states: [ OK ] 0.22 sec. 2025-10-03 23:24:47 02803_backup_tmp_files: [ OK ] 0.87 sec. 2025-10-03 23:24:47 03203_drop_detached_partition_all: [ OK ] 0.17 sec. 2025-10-03 23:24:47 02834_apache_arrow_abort: [ OK ] 12.50 sec. 2025-10-03 23:24:47 01709_inactive_parts_to_throw_insert: [ OK ] 0.17 sec. 2025-10-03 23:24:47 03011_definitive_guide_to_cast: [ OK ] 0.57 sec. 2025-10-03 23:24:47 02971_analyzer_remote_id: [ OK ] 0.52 sec. 2025-10-03 23:24:47 03033_with_fill_interpolate: [ OK ] 0.17 sec. 2025-10-03 23:24:47 02881_system_detached_parts_modification_time: [ OK ] 0.17 sec. 2025-10-03 23:24:47 00260_like_and_curly_braces: [ OK ] 0.22 sec. 2025-10-03 23:24:47 02325_dates_schema_inference: [ OK ] 0.32 sec. 2025-10-03 23:24:47 00605_intersections_aggregate_functions: [ OK ] 0.12 sec. 2025-10-03 23:24:47 02006_test_positional_arguments_on_cluster: [ OK ] 0.52 sec. 2025-10-03 23:24:47 02223_h3_test_const_columns: [ OK ] 0.22 sec. 2025-10-03 23:24:48 03205_json_syntax: [ OK ] 0.32 sec. 2025-10-03 23:24:48 03282_memory_transaction_crash: [ OK ] 0.12 sec. 2025-10-03 23:24:48 02733_sparse_columns_reload: [ OK ] 0.22 sec. 2025-10-03 23:24:48 00619_union_highlite: [ OK ] 0.17 sec. 2025-10-03 23:24:48 00175_partition_by_ignore: [ OK ] 0.17 sec. 2025-10-03 23:24:48 02684_bson: [ OK ] 0.12 sec. 2025-10-03 23:24:48 00637_sessions_in_http_interface_and_settings: [ OK ] 0.32 sec. 2025-10-03 23:24:48 01232_json_as_string_format: [ OK ] 0.87 sec. 2025-10-03 23:24:48 01599_mutation_query_params: [ OK ] 0.82 sec. 2025-10-03 23:24:48 01772_to_start_of_hour_align: [ OK ] 0.22 sec. 2025-10-03 23:24:48 01323_bad_arg_in_arithmetic_operations: [ OK ] 0.12 sec. 2025-10-03 23:24:48 00675_shard_remote_with_table_function: [ OK ] 0.17 sec. 2025-10-03 23:24:48 02453_check_path_in_errors_logger: [ OK ] 0.17 sec. 2025-10-03 23:24:48 02366_kql_distinct: [ OK ] 0.17 sec. 2025-10-03 23:24:48 00066_group_by_in: [ OK ] 0.12 sec. 2025-10-03 23:24:48 02337_base58: [ OK ] 0.17 sec. 2025-10-03 23:24:48 01605_dictinct_two_level: [ OK ] 0.22 sec. 2025-10-03 23:24:49 01095_tpch_like_smoke: [ OK ] 0.52 sec. 2025-10-03 23:24:49 00578_merge_table_shadow_virtual_column: [ OK ] 0.17 sec. 2025-10-03 23:24:49 02417_repeat_input_commands: [ OK ] 0.47 sec. 2025-10-03 23:24:49 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 4.98 sec. 2025-10-03 23:24:49 02975_intdiv_with_decimal: [ OK ] 0.27 sec. 2025-10-03 23:24:49 00817_with_simple: [ OK ] 0.12 sec. 2025-10-03 23:24:49 02517_union_columns_order: [ OK ] 0.12 sec. 2025-10-03 23:24:50 02012_zookeeper_changed_enum_type: [ OK ] 0.27 sec. 2025-10-03 23:24:50 02884_async_insert_native_protocol_4: [ OK ] 0.82 sec. 2025-10-03 23:24:50 00083_create_merge_tree_zookeeper_long: [ OK ] 1.17 sec. 2025-10-03 23:24:50 02998_system_dns_cache_table: [ OK ] 0.12 sec. 2025-10-03 23:24:50 02868_no_merge_across_partitions_final_with_lonely: [ OK ] 1.52 sec. 2025-10-03 23:24:50 03127_window_functions_uint16: [ OK ] 0.17 sec. 2025-10-03 23:24:50 01320_optimize_skip_unused_shards_no_non_deterministic: [ OK ] 0.12 sec. 2025-10-03 23:24:50 00140_prewhere_column_order: [ OK ] 0.17 sec. 2025-10-03 23:24:50 02253_empty_part_checksums: [ OK ] 1.67 sec. 2025-10-03 23:24:50 01802_formatDateTime_DateTime64_century: [ OK ] 0.17 sec. 2025-10-03 23:24:50 02542_transform_new: [ OK ] 0.22 sec. 2025-10-03 23:24:50 00712_prewhere_with_missing_columns: [ OK ] 0.22 sec. 2025-10-03 23:24:50 01079_reinterpret_as_fixed_string: [ OK ] 0.12 sec. 2025-10-03 23:24:50 00124_shard_distributed_with_many_replicas: [ OK ] 0.17 sec. 2025-10-03 23:24:50 01849_geoToS2: [ OK ] 0.27 sec. 2025-10-03 23:24:50 02112_skip_index_set_and_or: [ OK ] 0.12 sec. 2025-10-03 23:24:50 02864_statistics_ddl: [ OK ] 1.52 sec. 2025-10-03 23:24:51 01262_low_cardinality_remove: [ OK ] 0.22 sec. 2025-10-03 23:24:51 00701_join_default_strictness: [ OK ] 0.17 sec. 2025-10-03 23:24:51 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.17 sec. 2025-10-03 23:24:51 03006_join_on_inequal_expression_3: [ OK ] 0.32 sec. 2025-10-03 23:24:51 01377_supertype_low_cardinality: [ OK ] 0.37 sec. 2025-10-03 23:24:51 01451_normalize_query: [ OK ] 0.22 sec. 2025-10-03 23:24:51 02517_executable_pool_bad_input_query: [ OK ] 0.12 sec. 2025-10-03 23:24:51 01825_new_type_json_btc: [ OK ] 1.47 sec. 2025-10-03 23:24:51 01710_aggregate_projection_with_grouping_set: [ OK ] 0.22 sec. 2025-10-03 23:24:52 02834_nulls_first_sort: [ OK ] 0.17 sec. 2025-10-03 23:24:52 00027_distinct_and_order_by: [ OK ] 0.17 sec. 2025-10-03 23:24:52 01710_aggregate_projections: [ OK ] 1.87 sec. 2025-10-03 23:24:52 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.17 sec. 2025-10-03 23:24:52 03007_column_nullable_uninitialzed_value: [ OK ] 0.13 sec. 2025-10-03 23:24:52 02581_parquet_arrow_orc_compressions: [ OK ] 1.72 sec. 2025-10-03 23:24:52 00926_adaptive_index_granularity_versioned_collapsing_merge_tree: [ OK ] 0.37 sec. 2025-10-03 23:24:52 02559_multiple_read_steps_in_prewhere: [ OK ] 0.27 sec. 2025-10-03 23:24:52 01273_arrow_nullable_arrays_load: [ OK ] 1.02 sec. 2025-10-03 23:24:52 02125_lz4_compression_bug_TSV: [ OK ] 2.17 sec. 2025-10-03 23:24:52 02867_nullable_primary_key_final: [ OK ] 0.27 sec. 2025-10-03 23:24:52 02554_log_faminy_support_storage_policy: [ OK ] 0.27 sec. 2025-10-03 23:24:52 03035_materialized_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:24:52 01314_position_in_system_columns: [ OK ] 0.17 sec. 2025-10-03 23:24:52 03088_analyzer_ambiguous_column_multi_call: [ OK ] 0.12 sec. 2025-10-03 23:24:52 03170_part_offset_as_table_column: [ OK ] 0.17 sec. 2025-10-03 23:24:52 02346_fulltext_index_bug59039: [ OK ] 0.12 sec. 2025-10-03 23:24:53 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.22 sec. 2025-10-03 23:24:53 02702_logical_optimizer_with_nulls: [ OK ] 0.17 sec. 2025-10-03 23:24:53 03215_multilinestring_geometry: [ OK ] 0.17 sec. 2025-10-03 23:24:53 03215_analyzer_replace_with_dummy_tables: [ OK ] 0.12 sec. 2025-10-03 23:24:53 02943_order_by_all: [ OK ] 0.32 sec. 2025-10-03 23:24:53 03204_storage_join_optimize: [ OK ] 0.17 sec. 2025-10-03 23:24:53 00725_join_on_bug_4: [ OK ] 0.17 sec. 2025-10-03 23:24:53 02579_fill_empty_chunk_analyzer: [ OK ] 0.12 sec. 2025-10-03 23:24:53 00098_b_union_all: [ OK ] 0.12 sec. 2025-10-03 23:24:53 01249_flush_interactive: [ OK ] 10.35 sec. 2025-10-03 23:24:53 00926_adaptive_index_granularity_pk: [ OK ] 0.52 sec. 2025-10-03 23:24:54 01669_columns_declaration_serde_long: [ OK ] 0.32 sec. 2025-10-03 23:24:54 02426_orc_bug: [ OK ] 0.42 sec. 2025-10-03 23:24:54 01651_bugs_from_15889: [ OK ] 0.97 sec. 2025-10-03 23:24:54 01825_type_json_11: [ OK ] 1.07 sec. 2025-10-03 23:24:54 02477_analyzer_ast_key_condition_crash: [ OK ] 0.17 sec. 2025-10-03 23:24:54 01710_projection_part_check: [ OK ] 0.22 sec. 2025-10-03 23:24:54 02385_analyzer_aliases_compound_expression: [ OK ] 0.17 sec. 2025-10-03 23:24:54 01670_test_repeat_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:24:54 02291_dictionary_scalar_subquery_reload: [ OK ] 0.22 sec. 2025-10-03 23:24:54 02480_analyzer_alias_nullptr: [ OK ] 0.12 sec. 2025-10-03 23:24:54 01732_alters_bad_conversions: [ OK ] 0.22 sec. 2025-10-03 23:24:54 02903_bug_43644: [ OK ] 0.17 sec. 2025-10-03 23:24:54 01548_with_totals_having: [ OK ] 0.12 sec. 2025-10-03 23:24:54 00838_system_tables_drop_table_race: [ OK ] 1.98 sec. 2025-10-03 23:24:55 03198_unload_primary_key_outdated: [ OK ] 2.68 sec. 2025-10-03 23:24:55 02561_with_fill_date_datetime_incompatible: [ OK ] 0.12 sec. 2025-10-03 23:24:55 01305_buffer_final_bug: [ OK ] 0.17 sec. 2025-10-03 23:24:55 02337_multiple_joins_original_names: [ OK ] 0.17 sec. 2025-10-03 23:24:55 01715_tuple_insert_null_as_default: [ OK ] 0.37 sec. 2025-10-03 23:24:55 01355_if_fixed_string: [ OK ] 0.17 sec. 2025-10-03 23:24:56 00557_remote_port: [ OK ] 1.22 sec. 2025-10-03 23:24:56 03035_dynamic_sorting: [ OK ] 0.27 sec. 2025-10-03 23:24:56 02910_rocksdb_optimize: [ OK ] 0.17 sec. 2025-10-03 23:24:57 01900_kill_mutation_parallel_long: [ OK ] 2.47 sec. 2025-10-03 23:24:57 02354_window_expression_with_aggregation_expression: [ OK ] 0.12 sec. 2025-10-03 23:24:57 00727_concat: [ OK ] 0.42 sec. 2025-10-03 23:24:57 02461_join_lc_issue_42380: [ OK ] 0.17 sec. 2025-10-03 23:24:58 00480_mac_addresses: [ OK ] 0.12 sec. 2025-10-03 23:24:58 01293_external_sorting_limit_bug: [ OK ] 0.22 sec. 2025-10-03 23:24:58 01077_window_view_alter_query_to_modify_source: [ OK ] 1.47 sec. 2025-10-03 23:24:58 03236_squashing_high_memory: [ OK ] 4.93 sec. 2025-10-03 23:24:58 00108_shard_totals_after_having: [ OK ] 0.22 sec. 2025-10-03 23:24:58 02421_formats_with_totals_and_extremes: [ OK ] 0.32 sec. 2025-10-03 23:24:59 02543_alter_rename_modify_stuck: [ OK ] 4.08 sec. 2025-10-03 23:24:59 01226_dist_on_dist_global_in: [ OK ] 0.27 sec. 2025-10-03 23:24:59 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 0.92 sec. 2025-10-03 23:24:59 02310_generate_multi_columns_with_uuid: [ OK ] 0.12 sec. 2025-10-03 23:24:59 01197_summing_enum: [ OK ] 0.17 sec. 2025-10-03 23:24:59 01101_literal_column_clash: [ OK ] 0.17 sec. 2025-10-03 23:25:00 02169_map_functions: [ OK ] 0.67 sec. 2025-10-03 23:25:00 01072_nullable_jit: [ OK ] 0.22 sec. 2025-10-03 23:25:00 00819_ast_refactoring_bugs: [ OK ] 0.17 sec. 2025-10-03 23:25:00 01043_geo_distance: [ OK ] 0.17 sec. 2025-10-03 23:25:00 00932_array_intersect_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:00 01106_const_fixed_string_like: [ OK ] 0.27 sec. 2025-10-03 23:25:00 03321_functions_to_subcolumns_skip_index: [ OK ] 0.17 sec. 2025-10-03 23:25:00 03108_describe_union_all: [ OK ] 0.12 sec. 2025-10-03 23:25:00 00364_java_style_denormals: [ OK ] 0.12 sec. 2025-10-03 23:25:00 01825_type_json_nbagames: [ OK ] 2.42 sec. 2025-10-03 23:25:00 01700_system_zookeeper_path_in: [ OK ] 0.22 sec. 2025-10-03 23:25:01 01710_minmax_count_projection_constant_query: [ OK ] 0.17 sec. 2025-10-03 23:25:01 01083_functional_index_in_mergetree: [ OK ] 0.22 sec. 2025-10-03 23:25:01 02354_numeric_literals_with_underscores: [ OK ] 0.12 sec. 2025-10-03 23:25:01 02570_fallback_from_async_insert: [ OK ] 6.24 sec. 2025-10-03 23:25:01 01463_resample_overflow: [ OK ] 0.12 sec. 2025-10-03 23:25:01 02945_blake3_msan: [ OK ] 0.12 sec. 2025-10-03 23:25:01 03084_analyzer_join_column_alias: [ OK ] 0.12 sec. 2025-10-03 23:25:01 03519_ttl_extended_data_types: [ OK ] 0.32 sec. 2025-10-03 23:25:01 01157_replace_table: [ OK ] 0.42 sec. 2025-10-03 23:25:02 02455_default_union_except_intersect: [ OK ] 0.37 sec. 2025-10-03 23:25:02 02285_executable_user_defined_function_group_by: [ OK ] 0.77 sec. 2025-10-03 23:25:02 01534_lambda_array_join: [ OK ] 0.17 sec. 2025-10-03 23:25:02 01852_cast_operator_2: [ OK ] 0.17 sec. 2025-10-03 23:25:02 01710_projection_aggregation_in_order: [ OK ] 0.22 sec. 2025-10-03 23:25:02 01606_merge_from_wide_to_compact: [ OK ] 0.32 sec. 2025-10-03 23:25:02 01063_window_view_event_tumble_to_bounded: [ OK ] 1.22 sec. 2025-10-03 23:25:02 02889_datetime64_from_string: [ OK ] 0.17 sec. 2025-10-03 23:25:03 03161_decimal_binary_math: [ OK ] 0.37 sec. 2025-10-03 23:25:03 01779_quantile_deterministic_msan: [ OK ] 0.12 sec. 2025-10-03 23:25:03 03148_mutations_virtual_columns: [ OK ] 0.22 sec. 2025-10-03 23:25:04 01361_fover_remote_num_tries: [ OK ] 0.42 sec. 2025-10-03 23:25:04 02992_analyzer_group_by_const: [ OK ] 0.32 sec. 2025-10-03 23:25:04 02161_addressToLineWithInlines: [ OK ] 17.73 sec. 2025-10-03 23:25:04 01678_great_circle_angle: [ OK ] 0.12 sec. 2025-10-03 23:25:04 02177_issue_31009_pt2: [ OK ] 3.38 sec. 2025-10-03 23:25:04 02029_test_options_requests: [ OK ] 0.32 sec. 2025-10-03 23:25:04 01660_second_extremes_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:05 00472_compare_uuid_with_constant_string: [ OK ] 0.17 sec. 2025-10-03 23:25:05 02963_msan_agg_addBatchLookupTable8: [ OK ] 0.12 sec. 2025-10-03 23:25:05 02450_kill_distributed_query_deadlock: [ OK ] 9.45 sec. 2025-10-03 23:25:05 00873_t64_codec_date: [ OK ] 0.22 sec. 2025-10-03 23:25:05 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.12 sec. 2025-10-03 23:25:05 01278_variance_nonnegative: [ OK ] 0.22 sec. 2025-10-03 23:25:05 01078_bloom_filter_operator_not_has: [ OK ] 0.22 sec. 2025-10-03 23:25:05 00612_pk_in_tuple_perf: [ OK ] 1.12 sec. 2025-10-03 23:25:05 03147_asof_join_ddb_missing: [ OK ] 0.47 sec. 2025-10-03 23:25:05 03009_storage_memory_circ_buffer_usage: [ OK ] 0.32 sec. 2025-10-03 23:25:06 03033_final_undefined_last_mark: [ OK ] 0.12 sec. 2025-10-03 23:25:06 02989_join_using_parent_scope: [ OK ] 0.37 sec. 2025-10-03 23:25:06 00080_show_tables_and_system_tables: [ OK ] 0.17 sec. 2025-10-03 23:25:06 02421_type_json_empty_parts: [ OK ] 7.49 sec. 2025-10-03 23:25:06 01396_inactive_replica_cleanup_nodes_zookeeper: [ OK ] 3.73 sec. 2025-10-03 23:25:06 00978_table_function_values_alias: [ OK ] 0.12 sec. 2025-10-03 23:25:06 01268_data_numeric_parameters: [ OK ] 0.22 sec. 2025-10-03 23:25:06 01077_mutations_index_consistency: [ OK ] 1.27 sec. 2025-10-03 23:25:06 01777_map_populate_series_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:25:06 01020_having_without_group_by: [ OK ] 0.12 sec. 2025-10-03 23:25:06 01762_datetime64_extended_parsing: [ OK ] 0.12 sec. 2025-10-03 23:25:06 00999_full_join_dup_keys_crash: [ OK ] 0.32 sec. 2025-10-03 23:25:06 01056_predicate_optimizer_bugs: [ OK ] 0.37 sec. 2025-10-03 23:25:06 00753_system_columns_and_system_tables_long: [ OK ] 0.52 sec. 2025-10-03 23:25:07 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.37 sec. 2025-10-03 23:25:07 02235_add_part_offset_virtual_column: [ OK ] 0.52 sec. 2025-10-03 23:25:07 02122_parallel_formatting_JSONStringsEachRow: [ OK ] 1.42 sec. 2025-10-03 23:25:07 03214_inconsistent_formatting_of_codecs_statistics: [ OK ] 0.37 sec. 2025-10-03 23:25:07 01326_fixed_string_comparison_denny_crane: [ OK ] 0.12 sec. 2025-10-03 23:25:07 01338_long_select_and_alter: [ OK ] 13.07 sec. 2025-10-03 23:25:07 01780_column_sparse_pk: [ OK ] 0.32 sec. 2025-10-03 23:25:07 01051_new_any_join_engine: [ OK ] 0.42 sec. 2025-10-03 23:25:07 01542_collate_in_array: [ OK ] 0.32 sec. 2025-10-03 23:25:07 02028_create_select_settings: [ OK ] 0.13 sec. 2025-10-03 23:25:07 01825_type_json_13: [ OK ] 1.03 sec. 2025-10-03 23:25:07 01114_materialize_clear_index_compact_parts: [ OK ] 0.32 sec. 2025-10-03 23:25:07 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.22 sec. 2025-10-03 23:25:08 02771_jit_functions_comparison_crash: [ OK ] 0.27 sec. 2025-10-03 23:25:08 02687_native_fuzz: [ OK ] 0.17 sec. 2025-10-03 23:25:08 00060_date_lut: [ OK ] 0.18 sec. 2025-10-03 23:25:08 00737_decimal_group_by: [ OK ] 0.23 sec. 2025-10-03 23:25:08 02315_readonly_create_function: [ OK ] 0.53 sec. 2025-10-03 23:25:08 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.23 sec. 2025-10-03 23:25:08 02584_range_ipv4: [ OK ] 0.18 sec. 2025-10-03 23:25:08 02400_create_table_on_cluster_normalization: [ OK ] 0.37 sec. 2025-10-03 23:25:08 00098_l_union_all: [ OK ] 0.17 sec. 2025-10-03 23:25:08 02426_create_suspicious_fixed_string: [ OK ] 0.18 sec. 2025-10-03 23:25:08 00414_time_zones_direct_conversion: [ OK ] 0.19 sec. 2025-10-03 23:25:08 01825_type_json_3: [ OK ] 0.53 sec. 2025-10-03 23:25:09 02907_filter_pushdown_crash: [ OK ] 0.28 sec. 2025-10-03 23:25:09 02113_format_row_bug: [ OK ] 0.18 sec. 2025-10-03 23:25:09 01050_engine_join_view_crash: [ OK ] 0.33 sec. 2025-10-03 23:25:09 02265_column_ttl: [ OK ] 0.79 sec. 2025-10-03 23:25:09 01214_test_storage_merge_aliases_with_where: [ OK ] 0.39 sec. 2025-10-03 23:25:09 00717_merge_and_distributed: [ OK ] 0.93 sec. 2025-10-03 23:25:10 01281_join_with_prewhere_fix: [ OK ] 0.27 sec. 2025-10-03 23:25:10 00725_join_on_bug_1: [ OK ] 0.22 sec. 2025-10-03 23:25:10 03209_json_type_vertical_merges: [ OK ] 7.50 sec. 2025-10-03 23:25:10 02946_materialize_column_must_not_override_past_values: [ OK ] 0.73 sec. 2025-10-03 23:25:10 02126_fix_filelog: [ OK ] 1.04 sec. 2025-10-03 23:25:10 02542_transform_old: [ OK ] 0.33 sec. 2025-10-03 23:25:10 01700_mod_negative_type_promotion: [ OK ] 0.18 sec. 2025-10-03 23:25:10 00436_convert_charset: [ OK ] 0.22 sec. 2025-10-03 23:25:10 03001_matview_columns_after_modify_query: [ OK ] 3.09 sec. 2025-10-03 23:25:10 01551_mergetree_read_in_order_spread: [ OK ] 0.28 sec. 2025-10-03 23:25:10 02921_fuzzbits_with_array_join: [ OK ] 0.17 sec. 2025-10-03 23:25:10 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.28 sec. 2025-10-03 23:25:10 02713_array_low_cardinality_string: [ OK ] 0.23 sec. 2025-10-03 23:25:10 03217_filtering_in_storage_merge: [ OK ] 0.17 sec. 2025-10-03 23:25:11 00700_decimal_in_keys: [ OK ] 0.33 sec. 2025-10-03 23:25:11 00686_client_exit_code: [ OK ] 0.52 sec. 2025-10-03 23:25:11 02052_last_granula_adjust_logical_error: [ OK ] 0.53 sec. 2025-10-03 23:25:11 03198_settings_in_csv_tsv_schema_cache: [ OK ] 1.03 sec. 2025-10-03 23:25:12 00575_illegal_column_exception_when_drop_depen_column: [ OK ] 1.63 sec. 2025-10-03 23:25:12 02714_async_inserts_empty_data: [ OK ] 1.69 sec. 2025-10-03 23:25:12 01521_distributed_query_hang: [ OK ] 0.18 sec. 2025-10-03 23:25:12 02126_url_auth: [ OK ] 1.07 sec. 2025-10-03 23:25:12 02353_ascii: [ OK ] 0.17 sec. 2025-10-03 23:25:12 03032_redundant_equals: [ OK ] 0.58 sec. 2025-10-03 23:25:12 02895_cast_operator_bug: [ OK ] 0.12 sec. 2025-10-03 23:25:13 02521_to_custom_day_of_week: [ OK ] 0.18 sec. 2025-10-03 23:25:13 02352_lightweight_delete_on_replicated_merge_tree: [ OK ] 1.34 sec. 2025-10-03 23:25:13 01457_order_by_nulls_first: [ OK ] 0.28 sec. 2025-10-03 23:25:13 02784_parallel_replicas_automatic_decision_join: [ OK ] 6.09 sec. 2025-10-03 23:25:13 01656_sequence_next_node_long: [ OK ] 3.18 sec. 2025-10-03 23:25:13 02354_parse_timedelta: [ OK ] 0.43 sec. 2025-10-03 23:25:13 01290_empty_array_index_analysis: [ OK ] 0.42 sec. 2025-10-03 23:25:13 02131_mv_many_chunks_bug: [ OK ] 0.33 sec. 2025-10-03 23:25:13 02481_pk_analysis_with_enum_to_string: [ OK ] 0.37 sec. 2025-10-03 23:25:13 01936_empty_function_support_uuid: [ OK ] 0.22 sec. 2025-10-03 23:25:13 02918_gorilla_invalid_file: [ OK ] 0.48 sec. 2025-10-03 23:25:14 02969_mysql_cast_type_aliases: [ OK ] 0.33 sec. 2025-10-03 23:25:14 03131_rewrite_sum_if_nullable: [ OK ] 0.33 sec. 2025-10-03 23:25:14 01039_row_policy_dcl: [ OK ] 0.58 sec. 2025-10-03 23:25:14 02988_join_using_prewhere_pushdown: [ OK ] 0.28 sec. 2025-10-03 23:25:14 01473_system_events_zeroes: [ OK ] 0.23 sec. 2025-10-03 23:25:14 02006_test_positional_arguments: [ OK ] 0.82 sec. 2025-10-03 23:25:14 03206_projection_merge_special_mergetree: [ OK ] 1.13 sec. 2025-10-03 23:25:14 01359_geodistance_loop: [ OK ] 0.18 sec. 2025-10-03 23:25:14 01557_field_infinite_convert_to_number: [ OK ] 0.17 sec. 2025-10-03 23:25:15 01037_zookeeper_check_table_empty_pk: [ OK ] 0.44 sec. 2025-10-03 23:25:15 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.88 sec. 2025-10-03 23:25:15 01083_cross_to_inner_with_like: [ OK ] 0.28 sec. 2025-10-03 23:25:15 01502_bar_overflow: [ OK ] 0.33 sec. 2025-10-03 23:25:15 02518_qualified_asterisks_alias_table_name: [ OK ] 0.54 sec. 2025-10-03 23:25:15 00642_cast: [ OK ] 0.36 sec. 2025-10-03 23:25:15 01051_same_name_alias_with_joins: [ OK ] 0.33 sec. 2025-10-03 23:25:15 03240_insert_select_named_tuple: [ OK ] 0.27 sec. 2025-10-03 23:25:15 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.33 sec. 2025-10-03 23:25:16 00413_least_greatest_new_behavior: [ OK ] 0.18 sec. 2025-10-03 23:25:16 02974_analyzer_array_join_subcolumn: [ OK ] 0.33 sec. 2025-10-03 23:25:16 01756_optimize_skip_unused_shards_rewrite_in: [ OK ] 1.59 sec. 2025-10-03 23:25:16 02680_datetime64_monotonic_check: [ OK ] 0.28 sec. 2025-10-03 23:25:16 00999_join_on_expression: [ OK ] 0.43 sec. 2025-10-03 23:25:16 01295_aggregation_bug_11413: [ OK ] 0.18 sec. 2025-10-03 23:25:17 02015_async_inserts_stress_long: [ OK ] 10.12 sec. 2025-10-03 23:25:17 02478_window_frame_type_groups: [ OK ] 0.17 sec. 2025-10-03 23:25:17 03105_table_aliases_in_mv: [ OK ] 0.22 sec. 2025-10-03 23:25:17 01168_mutations_isolation: [ OK ] 5.81 sec. 2025-10-03 23:25:17 01497_mutation_support_for_storage_memory: [ OK ] 0.17 sec. 2025-10-03 23:25:17 00380_client_break_at_exception_in_batch_mode: [ OK ] 0.42 sec. 2025-10-03 23:25:17 03147_datetime64_constant_index_analysis: [ OK ] 0.22 sec. 2025-10-03 23:25:17 01300_group_by_other_keys_having: [ OK ] 0.88 sec. 2025-10-03 23:25:17 02731_analyzer_join_resolve_nested: [ OK ] 2.29 sec. 2025-10-03 23:25:17 02410_csv_empty_fields_inference: [ OK ] 0.12 sec. 2025-10-03 23:25:17 02232_partition_pruner_single_point: [ OK ] 0.17 sec. 2025-10-03 23:25:17 01070_h3_to_string: [ OK ] 0.12 sec. 2025-10-03 23:25:17 03009_range_dict_get_or_default: [ OK ] 0.17 sec. 2025-10-03 23:25:17 02222_allow_experimental_projection_optimization__enable_global_with_statement: [ OK ] 0.17 sec. 2025-10-03 23:25:17 02421_simple_queries_for_opentelemetry: [ OK ] 2.43 sec. 2025-10-03 23:25:17 01679_format_readable_time_delta_inf: [ OK ] 0.12 sec. 2025-10-03 23:25:18 01532_clickhouse_local_tmp_folder: [ OK ] 0.42 sec. 2025-10-03 23:25:18 02685_decimal256_various: [ OK ] 0.32 sec. 2025-10-03 23:25:18 00825_protobuf_format_map: [ OK ] 0.87 sec. 2025-10-03 23:25:18 02558_system_processes_elapsed: [ OK ] 2.44 sec. 2025-10-03 23:25:18 00128_group_by_number_and_fixed_string: [ OK ] 0.17 sec. 2025-10-03 23:25:18 01519_topK_distributed_parametrized: [ OK ] 0.17 sec. 2025-10-03 23:25:18 01072_select_constant_limit: [ OK ] 0.12 sec. 2025-10-03 23:25:18 02048_clickhouse_local_stage: [ OK ] 0.67 sec. 2025-10-03 23:25:18 00296_url_parameters: [ OK ] 0.17 sec. 2025-10-03 23:25:18 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.17 sec. 2025-10-03 23:25:18 00765_sql_compatibility_aliases: [ OK ] 0.22 sec. 2025-10-03 23:25:19 02842_one_input_format: [ OK ] 1.17 sec. 2025-10-03 23:25:19 03268_empty_tuple_update: [ OK ] 0.17 sec. 2025-10-03 23:25:19 00990_hasToken_and_tokenbf: [ OK ] 0.42 sec. 2025-10-03 23:25:19 02267_insert_empty_data: [ OK ] 0.12 sec. 2025-10-03 23:25:19 01825_type_json_schema_inference: [ OK ] 1.27 sec. 2025-10-03 23:25:19 02428_partial_sort_optimization_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:19 00416_pocopatch_progress_in_http_headers: [ OK ] 0.52 sec. 2025-10-03 23:25:19 01549_low_cardinality_mv_fuzz: [ OK ] 0.17 sec. 2025-10-03 23:25:19 00556_remove_columns_from_subquery: [ OK ] 0.12 sec. 2025-10-03 23:25:19 01639_distributed_sync_insert_zero_rows: [ OK ] 0.22 sec. 2025-10-03 23:25:19 01523_interval_operator_support_string_literal: [ OK ] 0.22 sec. 2025-10-03 23:25:19 02970_generate_series: [ OK ] 0.17 sec. 2025-10-03 23:25:19 02813_func_today_and_alias: [ OK ] 0.12 sec. 2025-10-03 23:25:19 01866_datetime64_cmp_with_constant: [ OK ] 0.27 sec. 2025-10-03 23:25:19 01084_regexp_empty: [ OK ] 0.17 sec. 2025-10-03 23:25:20 02572_materialized_views_ignore_errors: [ OK ] 0.32 sec. 2025-10-03 23:25:20 02228_merge_tree_insert_memory_usage: [ OK ] 0.87 sec. 2025-10-03 23:25:20 01246_least_greatest_generic: [ OK ] 0.22 sec. 2025-10-03 23:25:20 02024_compression_in_query: [ OK ] 1.42 sec. 2025-10-03 23:25:20 00555_right_join_excessive_rows: [ OK ] 0.12 sec. 2025-10-03 23:25:20 03037_union_view: [ OK ] 0.17 sec. 2025-10-03 23:25:20 02155_nested_lc_defalut_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:20 02471_wrong_date_monotonicity: [ OK ] 0.12 sec. 2025-10-03 23:25:20 01455_default_compression: [ OK ] 0.17 sec. 2025-10-03 23:25:20 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.17 sec. 2025-10-03 23:25:21 02233_interpolate_1: [ OK ] 0.32 sec. 2025-10-03 23:25:21 02504_regexp_dictionary_table_source: [ OK ] 0.42 sec. 2025-10-03 23:25:21 00413_distinct: [ OK ] 0.17 sec. 2025-10-03 23:25:21 01016_input_null_as_default: [ OK ] 3.38 sec. 2025-10-03 23:25:21 00556_array_intersect: [ OK ] 0.22 sec. 2025-10-03 23:25:21 02916_glogal_in_cancel: [ OK ] 0.62 sec. 2025-10-03 23:25:21 00760_insert_json_with_defaults: [ OK ] 0.27 sec. 2025-10-03 23:25:21 00976_max_execution_speed: [ OK ] 3.13 sec. 2025-10-03 23:25:21 01866_bit_positions_to_array: [ OK ] 0.27 sec. 2025-10-03 23:25:21 01416_join_totals_header_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:21 03130_abs_in_key_condition_bug: [ OK ] 0.17 sec. 2025-10-03 23:25:22 02921_bit_hamming_distance_big_int: [ OK ] 0.17 sec. 2025-10-03 23:25:22 00477_parsing_data_types: [ OK ] 0.12 sec. 2025-10-03 23:25:22 00205_scalar_subqueries: [ OK ] 0.22 sec. 2025-10-03 23:25:22 02377_fix_file_virtual_column: [ OK ] 0.17 sec. 2025-10-03 23:25:22 02908_filesystem_cache_as_collection: [ OK ] 0.17 sec. 2025-10-03 23:25:22 01009_insert_select_nicelulu: [ OK ] 1.77 sec. 2025-10-03 23:25:22 00900_orc_arrays_load: [ OK ] 1.02 sec. 2025-10-03 23:25:22 01018_ddl_dictionaries_select: [ OK ] 0.37 sec. 2025-10-03 23:25:23 02569_order_by_aggregation_result: [ OK ] 0.17 sec. 2025-10-03 23:25:23 01518_select_in_null: [ OK ] 0.62 sec. 2025-10-03 23:25:23 01077_yet_another_prewhere_test: [ OK ] 0.17 sec. 2025-10-03 23:25:23 03156_default_multiquery_split: [ OK ] 0.57 sec. 2025-10-03 23:25:23 01710_force_use_projection: [ OK ] 0.17 sec. 2025-10-03 23:25:23 01002_alter_nullable_adaptive_granularity_long: [ OK ] 10.72 sec. 2025-10-03 23:25:23 01072_drop_temporary_table_with_same_name: [ OK ] 0.17 sec. 2025-10-03 23:25:23 02475_analysis_of_variance: [ OK ] 0.22 sec. 2025-10-03 23:25:23 02294_floating_point_second_in_settings: [ OK ] 3.83 sec. 2025-10-03 23:25:23 02030_quantiles_underflow: [ OK ] 0.12 sec. 2025-10-03 23:25:23 00800_function_java_hash: [ OK ] 0.17 sec. 2025-10-03 23:25:23 01851_hedged_connections_external_tables: [ OK ] 0.17 sec. 2025-10-03 23:25:23 00663_tiny_log_empty_insert: [ OK ] 0.17 sec. 2025-10-03 23:25:24 01710_normal_projection_format: [ OK ] 0.17 sec. 2025-10-03 23:25:24 00345_index_accurate_comparison: [ OK ] 0.17 sec. 2025-10-03 23:25:24 01418_index_analysis_bug: [ OK ] 0.22 sec. 2025-10-03 23:25:24 01890_materialized_distributed_join: [ OK ] 0.62 sec. 2025-10-03 23:25:24 01456_min_negative_decimal_formatting: [ OK ] 0.12 sec. 2025-10-03 23:25:24 03130_generateSnowflakeId: [ OK ] 0.22 sec. 2025-10-03 23:25:24 01430_fix_any_rewrite_aliases: [ OK ] 0.17 sec. 2025-10-03 23:25:24 00102_insert_into_temporary_table: [ OK ] 0.12 sec. 2025-10-03 23:25:24 00732_quorum_insert_have_data_before_quorum_zookeeper_long: [ OK ] 0.37 sec. 2025-10-03 23:25:24 01710_projection_query_plan_optimization_misc: [ OK ] 0.17 sec. 2025-10-03 23:25:24 00954_resample_combinator: [ OK ] 0.22 sec. 2025-10-03 23:25:24 01556_if_null: [ OK ] 0.12 sec. 2025-10-03 23:25:24 01920_not_chain_format: [ OK ] 0.12 sec. 2025-10-03 23:25:25 01440_to_date_monotonicity: [ OK ] 0.22 sec. 2025-10-03 23:25:25 02313_group_by_modifiers_with_non_default_types: [ OK ] 0.17 sec. 2025-10-03 23:25:25 03034_normalized_ast: [ OK ] 0.12 sec. 2025-10-03 23:25:25 02149_schema_inference: [ OK ] 5.84 sec. 2025-10-03 23:25:25 01117_greatest_least_case: [ OK ] 0.12 sec. 2025-10-03 23:25:25 02360_small_notation_h_for_hour_interval: [ OK ] 0.12 sec. 2025-10-03 23:25:25 01318_parallel_final_stuck: [ OK ] 0.17 sec. 2025-10-03 23:25:25 02337_join_analyze_stuck: [ OK ] 0.27 sec. 2025-10-03 23:25:25 00402_nan_and_extremes: [ OK ] 0.17 sec. 2025-10-03 23:25:25 00367_visible_width_of_array_tuple_enum: [ OK ] 0.12 sec. 2025-10-03 23:25:26 01945_system_warnings: [ OK ] 0.82 sec. 2025-10-03 23:25:26 01186_conversion_to_nullable: [ OK ] 0.17 sec. 2025-10-03 23:25:26 01783_parallel_formatting_memory: [ OK ] 0.37 sec. 2025-10-03 23:25:26 00945_bloom_filter_index: [ OK ] 2.03 sec. 2025-10-03 23:25:26 01074_window_view_event_tumble_asc_join_populate: [ OK ] 1.07 sec. 2025-10-03 23:25:27 02907_backup_restore_default_nullable: [ OK ] 0.92 sec. 2025-10-03 23:25:27 01825_type_json_12: [ OK ] 0.93 sec. 2025-10-03 23:25:27 01891_partition_by_uuid: [ OK ] 0.12 sec. 2025-10-03 23:25:27 02009_from_infile: [ OK ] 0.82 sec. 2025-10-03 23:25:27 00840_top_k_weighted: [ OK ] 0.12 sec. 2025-10-03 23:25:27 00974_query_profiler: [ OK ] 5.23 sec. 2025-10-03 23:25:27 00098_3_union_all: [ OK ] 0.17 sec. 2025-10-03 23:25:27 00270_views_query_processing_stage: [ OK ] 0.17 sec. 2025-10-03 23:25:27 01581_deduplicate_by_columns_local: [ OK ] 0.57 sec. 2025-10-03 23:25:27 01538_fuzz_aggregate: [ OK ] 0.12 sec. 2025-10-03 23:25:28 03096_variant_in_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:25:28 01495_subqueries_in_with_statement_3: [ OK ] 0.27 sec. 2025-10-03 23:25:28 03093_filter_push_down_crash: [ OK ] 0.17 sec. 2025-10-03 23:25:28 02295_GROUP_BY_AggregateFunction: [ OK ] 0.22 sec. 2025-10-03 23:25:28 02129_add_column_add_ttl: [ OK ] 0.27 sec. 2025-10-03 23:25:28 02802_clickhouse_disks_s3_copy: [ OK ] 0.82 sec. 2025-10-03 23:25:28 01656_ipv4_bad_formatting: [ OK ] 0.12 sec. 2025-10-03 23:25:28 02355_control_block_size_in_aggregator: [ OK ] 0.17 sec. 2025-10-03 23:25:28 01010_pmj_skip_blocks: [ OK ] 0.63 sec. 2025-10-03 23:25:28 02325_compatibility_setting_2: [ OK ] 0.22 sec. 2025-10-03 23:25:28 03201_sumIf_to_countIf_return_type: [ OK ] 0.12 sec. 2025-10-03 23:25:29 02802_with_cube_with_totals: [ OK ] 0.12 sec. 2025-10-03 23:25:29 02428_parameterized_view_param_in_select_section: [ OK ] 0.27 sec. 2025-10-03 23:25:29 00614_array_nullable: [ OK ] 0.17 sec. 2025-10-03 23:25:29 02156_storage_merge_prewhere: [ OK ] 0.32 sec. 2025-10-03 23:25:29 03155_test_move_to_prewhere: [ OK ] 0.72 sec. 2025-10-03 23:25:29 00210_insert_select_extremes_http: [ OK ] 0.42 sec. 2025-10-03 23:25:30 01821_to_date_time_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:25:30 00331_final_and_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:25:30 00574_empty_strings_deserialization: [ OK ] 0.97 sec. 2025-10-03 23:25:30 00030_alter_table: [ OK ] 0.32 sec. 2025-10-03 23:25:30 01174_select_insert_isolation: [ OK ] 7.65 sec. 2025-10-03 23:25:31 03247_object_column_copy: [ OK ] 0.17 sec. 2025-10-03 23:25:31 02984_form_format: [ OK ] 0.82 sec. 2025-10-03 23:25:31 03222_parallel_replicas_final_in_subquery: [ OK ] 0.17 sec. 2025-10-03 23:25:31 02014_storage_merge_order_by: [ OK ] 0.32 sec. 2025-10-03 23:25:31 02704_max_backup_bandwidth: [ OK ] 7.79 sec. 2025-10-03 23:25:31 03065_analyzer_cross_join_and_array_join: [ OK ] 0.12 sec. 2025-10-03 23:25:32 02159_left_right: [ OK ] 0.27 sec. 2025-10-03 23:25:32 01279_empty_external_table: [ OK ] 0.62 sec. 2025-10-03 23:25:32 00746_compile_non_deterministic_function: [ OK ] 6.18 sec. 2025-10-03 23:25:32 02428_combinators_with_over_statement: [ OK ] 0.17 sec. 2025-10-03 23:25:32 02916_csv_infer_numbers_from_strings: [ OK ] 0.12 sec. 2025-10-03 23:25:33 00647_histogram: [ OK ] 0.17 sec. 2025-10-03 23:25:33 00825_protobuf_format_skipped_column_in_nested: [ OK ] 1.07 sec. 2025-10-03 23:25:34 03325_distributed_join_json_array_subcolumns: [ OK ] 0.17 sec. 2025-10-03 23:25:35 03143_asof_join_ddb_long: [ OK ] 4.94 sec. 2025-10-03 23:25:35 03094_analyzer_fiddle_multiif: [ OK ] 0.17 sec. 2025-10-03 23:25:36 00534_functions_bad_arguments6: [ OK ] 4.93 sec. 2025-10-03 23:25:36 01620_fix_simple_state_arg_type: [ OK ] 0.17 sec. 2025-10-03 23:25:36 02001_compress_output_file: [ OK ] 0.47 sec. 2025-10-03 23:25:36 01710_projection_materialize_with_missing_columns: [ OK ] 0.17 sec. 2025-10-03 23:25:36 01852_s2_get_neighbours: [ OK ] 0.12 sec. 2025-10-03 23:25:36 01079_bad_alters_zookeeper_long: [ OK ] 4.53 sec. 2025-10-03 23:25:36 00054_join_string: [ OK ] 0.12 sec. 2025-10-03 23:25:36 01285_date_datetime_key_condition: [ OK ] 0.17 sec. 2025-10-03 23:25:36 00712_prewhere_with_sampling: [ OK ] 0.17 sec. 2025-10-03 23:25:36 02302_column_decl_null_before_defaul_value: [ OK ] 0.37 sec. 2025-10-03 23:25:37 02115_write_buffers_finalize: [ OK ] 2.98 sec. 2025-10-03 23:25:37 02711_soundex_function: [ OK ] 0.22 sec. 2025-10-03 23:25:37 00045_sorting_by_fixed_string_descending: [ OK ] 0.12 sec. 2025-10-03 23:25:37 01081_window_view_target_table_engine: [ OK ] 0.92 sec. 2025-10-03 23:25:37 03205_parallel_window_finctions_and_column_sparse_bug: [ OK ] 0.27 sec. 2025-10-03 23:25:38 01445_create_table_as_table_function: [ OK ] 0.62 sec. 2025-10-03 23:25:38 00609_mv_index_in_in: [ OK ] 0.22 sec. 2025-10-03 23:25:38 01686_event_time_microseconds_part_log: [ OK ] 1.83 sec. 2025-10-03 23:25:39 03093_bug_gcd_codec: [ OK ] 0.22 sec. 2025-10-03 23:25:39 02266_auto_add_nullable: [ OK ] 0.17 sec. 2025-10-03 23:25:40 03038_nested_dynamic_merges_compact_vertical: [ OK ] 2.33 sec. 2025-10-03 23:25:40 02833_tuple_concat: [ OK ] 0.22 sec. 2025-10-03 23:25:41 02981_nested_bad_types: [ OK ] 0.68 sec. 2025-10-03 23:25:41 00564_enum_order: [ OK ] 0.42 sec. 2025-10-03 23:25:41 02473_multistep_prewhere: [ OK ] 12.47 sec. 2025-10-03 23:25:42 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.17 sec. 2025-10-03 23:25:42 00087_distinct_of_empty_arrays: [ OK ] 0.18 sec. 2025-10-03 23:25:44 02003_memory_limit_in_client: [ OK ] 3.23 sec. 2025-10-03 23:25:45 00935_to_iso_week_first_year: [ OK ] 0.17 sec. 2025-10-03 23:25:45 01543_parse_datetime_besteffort_or_null_empty_string: [ OK ] 0.18 sec. 2025-10-03 23:25:45 01378_alter_rename_with_ttl_zookeeper: [ OK ] 0.27 sec. 2025-10-03 23:25:45 02809_has_subsequence: [ OK ] 0.37 sec. 2025-10-03 23:25:46 00411_long_accurate_number_comparison_int2: [ OK ] 6.76 sec. 2025-10-03 23:25:46 00405_pretty_formats: [ OK ] 0.27 sec. 2025-10-03 23:25:46 01427_pk_and_expression_with_different_type: [ OK ] 0.22 sec. 2025-10-03 23:25:46 00577_replacing_merge_tree_vertical_merge: [ OK ] 0.37 sec. 2025-10-03 23:25:46 03204_format_join_on: [ OK ] 0.47 sec. 2025-10-03 23:25:47 00626_in_syntax: [ OK ] 0.27 sec. 2025-10-03 23:25:47 01626_cnf_fuzz_long: [ OK ] 14.03 sec. 2025-10-03 23:25:47 01825_new_type_json_mutations: [ OK ] 0.22 sec. 2025-10-03 23:25:47 00921_datetime64_compatibility_long: [ OK ] 9.01 sec. 2025-10-03 23:25:47 00803_xxhash: [ OK ] 0.28 sec. 2025-10-03 23:25:47 03205_json_cast_from_string: [ OK ] 0.22 sec. 2025-10-03 23:25:47 00732_quorum_insert_select_with_old_data_and_without_quorum_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:25:47 01020_function_char: [ OK ] 0.12 sec. 2025-10-03 23:25:47 01825_type_json_1: [ OK ] 0.32 sec. 2025-10-03 23:25:48 00013_create_table_with_arrays: [ OK ] 0.18 sec. 2025-10-03 23:25:48 01813_distributed_scalar_subqueries_alias: [ OK ] 0.22 sec. 2025-10-03 23:25:48 01460_mark_inclusion_search_crash: [ OK ] 0.17 sec. 2025-10-03 23:25:48 02751_query_log_test_partitions: [ OK ] 0.37 sec. 2025-10-03 23:25:48 02122_parallel_formatting_TSKV: [ OK ] 1.22 sec. 2025-10-03 23:25:48 02030_function_mapContainsKeyLike: [ OK ] 0.22 sec. 2025-10-03 23:25:48 00964_os_thread_priority: [ OK ] 0.12 sec. 2025-10-03 23:25:48 02997_insert_select_too_many_parts_multithread: [ SKIPPED ] 0.00 sec. 2025-10-03 23:25:48 Reason: disabled 2025-10-03 23:25:48 02931_client_fuzzy_search_crash: [ OK ] 6.52 sec. 2025-10-03 23:25:49 01452_normalized_query_hash: [ OK ] 0.17 sec. 2025-10-03 23:25:49 00833_sleep_overflow: [ OK ] 0.12 sec. 2025-10-03 23:25:49 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 0.72 sec. 2025-10-03 23:25:49 00001_select_1: [ OK ] 0.17 sec. 2025-10-03 23:25:49 00026_shard_something_distributed: [ OK ] 0.17 sec. 2025-10-03 23:25:50 00838_unique_index: [ OK ] 1.68 sec. 2025-10-03 23:25:50 03171_condition_pushdown: [ OK ] 0.17 sec. 2025-10-03 23:25:50 01360_division_overflow: [ OK ] 0.17 sec. 2025-10-03 23:25:50 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. 2025-10-03 23:25:50 Reason: not running for current build 2025-10-03 23:25:50 01018_optimize_read_in_order_with_in_subquery: [ OK ] 0.24 sec. 2025-10-03 23:25:51 00975_indices_mutation_replicated_zookeeper_long: [ OK ] 1.93 sec. 2025-10-03 23:25:51 02130_parse_quoted_null: [ OK ] 2.24 sec. 2025-10-03 23:25:51 00541_kahan_sum: [ OK ] 0.12 sec. 2025-10-03 23:25:51 01390_remove_injective_in_uniq: [ OK ] 0.22 sec. 2025-10-03 23:25:52 03151_redundant_distinct_with_window: [ OK ] 0.17 sec. 2025-10-03 23:25:53 02101_empty_as_default_and_omitted_fields: [ OK ] 2.78 sec. 2025-10-03 23:25:53 02833_window_func_range_offset: [ OK ] 0.12 sec. 2025-10-03 23:25:53 01049_join_low_card_bug_long: [ OK ] 2.83 sec. 2025-10-03 23:25:53 01787_map_remote: [ OK ] 0.22 sec. 2025-10-03 23:25:54 01060_avro: [ OK ] 4.54 sec. 2025-10-03 23:25:54 01710_projection_array_join: [ OK ] 0.17 sec. 2025-10-03 23:25:54 01162_strange_mutations: [ OK ] 7.51 sec. 2025-10-03 23:25:54 02831_regexp_analyze_recursion: [ OK ] 0.17 sec. 2025-10-03 23:25:54 02096_join_unusual_identifier_begin: [ OK ] 0.22 sec. 2025-10-03 23:25:54 02477_exists_fuzz_43478: [ OK ] 0.17 sec. 2025-10-03 23:25:54 03118_analyzer_multi_join_prewhere: [ OK ] 0.18 sec. 2025-10-03 23:25:54 02785_date_predicate_optimizations_ast_query_tree_rewrite: [ OK ] 0.47 sec. 2025-10-03 23:25:54 01131_max_rows_to_sort: [ OK ] 0.12 sec. 2025-10-03 23:25:54 01638_div_mod_ambiguities: [ OK ] 0.17 sec. 2025-10-03 23:25:54 00491_shard_distributed_and_aliases_in_where_having: [ OK ] 0.17 sec. 2025-10-03 23:25:55 02009_mysql_client_empty_result: [ OK ] 0.54 sec. 2025-10-03 23:25:55 01592_toUnixTimestamp_Date: [ OK ] 0.19 sec. 2025-10-03 23:25:55 01030_storage_url_syntax: [ OK ] 33.14 sec. 2025-10-03 23:25:55 00378_json_quote_64bit_integers: [ OK ] 0.28 sec. 2025-10-03 23:25:55 00287_column_const_with_nan: [ OK ] 0.30 sec. 2025-10-03 23:25:55 01559_misplaced_codec_diagnostics: [ OK ] 0.13 sec. 2025-10-03 23:25:55 02313_cross_join_dup_col_names: [ OK ] 0.29 sec. 2025-10-03 23:25:55 01825_type_json_9: [ OK ] 0.24 sec. 2025-10-03 23:25:56 00239_type_conversion_in_in: [ OK ] 0.24 sec. 2025-10-03 23:25:56 00702_where_with_quailified_names: [ OK ] 0.17 sec. 2025-10-03 23:25:57 01679_incorrect_data_on_insert_collapsing: [ OK ] 1.15 sec. 2025-10-03 23:25:57 00609_distributed_with_case_when_then: [ OK ] 0.33 sec. 2025-10-03 23:25:58 02676_to_decimal_string: [ OK ] 0.53 sec. 2025-10-03 23:25:58 00634_performance_introspection_and_logging: [ OK ] 2.59 sec. 2025-10-03 23:25:58 02149_issue_32487: [ OK ] 0.17 sec. 2025-10-03 23:25:58 02046_low_cardinality_parallel_group_by: [ OK ] 4.19 sec. 2025-10-03 23:25:58 02307_join_get_array_null: [ OK ] 0.13 sec. 2025-10-03 23:25:58 02942_variant_cast: [ OK ] 0.27 sec. 2025-10-03 23:25:58 03144_fuzz_quoted_type_name: [ OK ] 0.17 sec. 2025-10-03 23:25:59 01553_settings_early_apply: [ OK ] 0.17 sec. 2025-10-03 23:25:59 02575_merge_prewhere_materialized: [ OK ] 0.27 sec. 2025-10-03 23:25:59 02489_analyzer_indexes: [ OK ] 0.34 sec. 2025-10-03 23:25:59 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.18 sec. 2025-10-03 23:25:59 00094_union_race_conditions_5: [ OK ] 7.50 sec. 2025-10-03 23:25:59 02876_yyyymmddtodate: [ OK ] 0.59 sec. 2025-10-03 23:25:59 00227_quantiles_timing_arbitrary_order: [ OK ] 0.17 sec. 2025-10-03 23:25:59 01353_low_cardinality_join_types: [ OK ] 0.37 sec. 2025-10-03 23:26:00 00166_functions_of_aggregation_states: [ OK ] 0.17 sec. 2025-10-03 23:26:00 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.37 sec. 2025-10-03 23:26:00 02152_bool_type: [ OK ] 0.28 sec. 2025-10-03 23:26:00 00184_shard_distributed_group_by_no_merge: [ OK ] 0.52 sec. 2025-10-03 23:26:00 00719_format_datetime_rand: [ OK ] 0.87 sec. 2025-10-03 23:26:01 02185_arraySlice_negative_offset_size: [ OK ] 0.23 sec. 2025-10-03 23:26:01 01894_jit_aggregation_function_max_long: [ OK ] 0.68 sec. 2025-10-03 23:26:01 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.22 sec. 2025-10-03 23:26:01 00238_removal_of_temporary_columns: [ OK ] 0.17 sec. 2025-10-03 23:26:01 02784_schema_inference_null_as_default: [ OK ] 0.17 sec. 2025-10-03 23:26:01 02888_attach_partition_from_different_tables: [ OK ] 0.28 sec. 2025-10-03 23:26:01 00522_multidimensional: [ OK ] 0.62 sec. 2025-10-03 23:26:01 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.23 sec. 2025-10-03 23:26:02 02999_scalar_subqueries_bug_1: [ OK ] 0.17 sec. 2025-10-03 23:26:02 01189_create_as_table_as_table_function: [ OK ] 0.22 sec. 2025-10-03 23:26:02 02898_input_format_values_allow_data_after_semicolon: [ OK ] 0.84 sec. 2025-10-03 23:26:03 02904_empty_order_by_with_setting_enabled: [ OK ] 0.97 sec. 2025-10-03 23:26:03 01940_point_in_polygon_ubsan: [ OK ] 0.18 sec. 2025-10-03 23:26:03 01357_version_collapsing_attach_detach_zookeeper: [ OK ] 0.22 sec. 2025-10-03 23:26:03 00489_pk_subexpression: [ OK ] 0.23 sec. 2025-10-03 23:26:04 01076_array_join_prewhere_const_folding: [ OK ] 0.83 sec. 2025-10-03 23:26:04 02884_create_view_with_sql_security_option: [ OK ] 9.12 sec. 2025-10-03 23:26:04 01159_combinators_with_parameters: [ OK ] 0.48 sec. 2025-10-03 23:26:04 02414_all_new_table_functions_must_be_documented: [ OK ] 0.17 sec. 2025-10-03 23:26:04 01312_skip_empty_params: [ OK ] 0.44 sec. 2025-10-03 23:26:05 00858_issue_4756: [ OK ] 0.28 sec. 2025-10-03 23:26:05 00343_array_element_generic: [ OK ] 0.22 sec. 2025-10-03 23:26:05 00981_in_subquery_with_tuple: [ OK ] 1.75 sec. 2025-10-03 23:26:05 02482_load_parts_refcounts: [ OK ] 1.14 sec. 2025-10-03 23:26:05 01681_bloom_filter_nullable_column: [ OK ] 0.44 sec. 2025-10-03 23:26:06 02100_limit_push_down_bug: [ OK ] 0.17 sec. 2025-10-03 23:26:06 00397_tsv_format_synonym: [ OK ] 0.17 sec. 2025-10-03 23:26:06 03228_dynamic_subcolumns_from_subquery: [ OK ] 0.22 sec. 2025-10-03 23:26:06 02784_parallel_replicas_automatic_decision: [ OK ] 5.28 sec. 2025-10-03 23:26:06 00542_materialized_view_and_time_zone_tag: [ OK ] 0.27 sec. 2025-10-03 23:26:06 02990_arrayFold_nullable_lc: [ OK ] 0.27 sec. 2025-10-03 23:26:06 02688_long_aggregate_function_names: [ OK ] 0.17 sec. 2025-10-03 23:26:08 02015_shard_crash_clang_12_build: [ OK ] 31.33 sec. 2025-10-03 23:26:08 00712_prewhere_with_alias_bug: [ OK ] 0.22 sec. 2025-10-03 23:26:08 03097_query_log_join_processes: [ OK ] 0.32 sec. 2025-10-03 23:26:09 01231_operator_null_in: [ OK ] 2.15 sec. 2025-10-03 23:26:09 01070_h3_to_parent: [ OK ] 0.17 sec. 2025-10-03 23:26:09 00653_running_difference: [ OK ] 0.22 sec. 2025-10-03 23:26:09 02918_join_pm_lc_crash: [ OK ] 0.19 sec. 2025-10-03 23:26:10 02158_proportions_ztest: [ OK ] 0.33 sec. 2025-10-03 23:26:10 01338_uuid_without_separator: [ OK ] 0.34 sec. 2025-10-03 23:26:10 02370_analyzer_in_function: [ OK ] 0.27 sec. 2025-10-03 23:26:11 02366_cancel_write_into_file: [ OK ] 4.64 sec. 2025-10-03 23:26:11 02457_morton_coding: [ OK ] 0.47 sec. 2025-10-03 23:26:11 00876_wrong_arraj_join_column: [ OK ] 0.22 sec. 2025-10-03 23:26:11 00420_null_in_scalar_subqueries: [ OK ] 0.17 sec. 2025-10-03 23:26:11 01324_settings_documentation: [ OK ] 0.18 sec. 2025-10-03 23:26:11 01194_http_query_id: [ OK ] 0.78 sec. 2025-10-03 23:26:12 00582_not_aliasing_functions: [ OK ] 0.12 sec. 2025-10-03 23:26:12 01069_materialized_view_alter_target_table_with_default_expression: [ OK ] 0.27 sec. 2025-10-03 23:26:12 00019_shard_quantiles_totals_distributed: [ OK ] 0.17 sec. 2025-10-03 23:26:12 02947_parallel_replicas_remote: [ OK ] 0.17 sec. 2025-10-03 23:26:12 01395_limit_more_cases: [ OK ] 14.15 sec. 2025-10-03 23:26:13 02985_shard_query_start_time: [ OK ] 0.37 sec. 2025-10-03 23:26:13 02122_parallel_formatting_PrettyCompact: [ OK ] 1.73 sec. 2025-10-03 23:26:13 01906_bigint_accurate_cast_ubsan: [ OK ] 0.27 sec. 2025-10-03 23:26:14 02908_table_ttl_dependency: [ OK ] 0.82 sec. 2025-10-03 23:26:14 01350_intdiv_nontrivial_fpe: [ OK ] 0.22 sec. 2025-10-03 23:26:14 00498_array_functions_concat_slice_push_pop: [ OK ] 1.64 sec. 2025-10-03 23:26:14 03001_block_offset_column: [ OK ] 0.37 sec. 2025-10-03 23:26:14 02496_from_unixtime_in_joda_syntax: [ OK ] 0.38 sec. 2025-10-03 23:26:14 01293_pretty_max_value_width: [ OK ] 0.28 sec. 2025-10-03 23:26:15 02265_limit_push_down_over_window_functions_bug: [ OK ] 0.77 sec. 2025-10-03 23:26:15 01732_race_condition_storage_join_long: [ OK ] 20.75 sec. 2025-10-03 23:26:15 01851_fix_row_policy_empty_result: [ OK ] 0.22 sec. 2025-10-03 23:26:15 02798_explain_settings_not_applied_bug: [ OK ] 0.17 sec. 2025-10-03 23:26:15 02021_h3_is_pentagon: [ OK ] 0.17 sec. 2025-10-03 23:26:15 01036_union_different_columns: [ OK ] 0.12 sec. 2025-10-03 23:26:15 00688_low_cardinality_defaults: [ OK ] 0.17 sec. 2025-10-03 23:26:15 00759_kodieg: [ OK ] 0.12 sec. 2025-10-03 23:26:16 00837_minmax_index: [ OK ] 1.27 sec. 2025-10-03 23:26:16 02999_variant_suspicious_types: [ OK ] 0.12 sec. 2025-10-03 23:26:16 02160_special_functions: [ OK ] 0.27 sec. 2025-10-03 23:26:16 02537_distributed_loosing_files_after_exception: [ OK ] 0.77 sec. 2025-10-03 23:26:17 01825_type_json_8: [ OK ] 1.43 sec. 2025-10-03 23:26:17 00603_system_parts_nonexistent_database: [ OK ] 0.12 sec. 2025-10-03 23:26:17 01093_cyclic_defaults_filimonov: [ OK ] 0.17 sec. 2025-10-03 23:26:17 03352_distinct_sorted_bug: [ OK ] 0.22 sec. 2025-10-03 23:26:17 00818_inner_join_bug_3567: [ OK ] 0.27 sec. 2025-10-03 23:26:17 00232_format_readable_size: [ OK ] 0.12 sec. 2025-10-03 23:26:18 00755_avg_value_size_hint_passing: [ OK ] 0.72 sec. 2025-10-03 23:26:19 00825_protobuf_format_table_default: [ OK ] 2.08 sec. 2025-10-03 23:26:19 01493_alter_remove_properties_zookeeper: [ OK ] 0.57 sec. 2025-10-03 23:26:19 01606_git_import: [ OK ] 13.90 sec. 2025-10-03 23:26:19 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.17 sec. 2025-10-03 23:26:19 01125_dict_ddl_cannot_add_column: [ OK ] 0.17 sec. 2025-10-03 23:26:19 00514_interval_operators: [ OK ] 0.27 sec. 2025-10-03 23:26:20 02226_async_insert_table_function: [ OK ] 0.22 sec. 2025-10-03 23:26:20 01672_actions_dag_merge_crash: [ OK ] 0.17 sec. 2025-10-03 23:26:20 00500_point_in_polygon_non_const_poly: [ OK ] 0.67 sec. 2025-10-03 23:26:20 02540_input_format_json_ignore_unknown_keys_in_named_tuple: [ OK ] 1.18 sec. 2025-10-03 23:26:20 02568_and_consistency: [ OK ] 0.22 sec. 2025-10-03 23:26:20 00577_full_join_segfault: [ OK ] 0.17 sec. 2025-10-03 23:26:20 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.17 sec. 2025-10-03 23:26:20 02715_bit_operations_float: [ OK ] 0.27 sec. 2025-10-03 23:26:20 01301_polygons_within: [ OK ] 0.17 sec. 2025-10-03 23:26:21 02716_create_direct_dict_with_lifetime_throws: [ OK ] 0.12 sec. 2025-10-03 23:26:21 02966_nested_offsets_subcolumn: [ OK ] 0.57 sec. 2025-10-03 23:26:21 00179_lambdas_with_common_expressions_and_filter: [ OK ] 0.12 sec. 2025-10-03 23:26:21 02268_json_wrong_root_type_in_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:26:21 00933_reserved_word: [ OK ] 0.17 sec. 2025-10-03 23:26:21 03205_system_sync_replica_format: [ OK ] 0.12 sec. 2025-10-03 23:26:21 02122_parallel_formatting_CustomSeparated: [ OK ] 1.23 sec. 2025-10-03 23:26:21 02423_json_quote_float64: [ OK ] 0.12 sec. 2025-10-03 23:26:22 02324_map_combinator_bug: [ OK ] 0.17 sec. 2025-10-03 23:26:22 01717_global_with_subquery_fix: [ OK ] 0.12 sec. 2025-10-03 23:26:22 00918_json_functions: [ OK ] 0.97 sec. 2025-10-03 23:26:22 02122_4letter_words_stress_zookeeper: [ OK ] 16.41 sec. 2025-10-03 23:26:23 01710_normal_projections: [ OK ] 2.48 sec. 2025-10-03 23:26:23 02741_hashed_dictionary_load_factor: [ OK ] 1.02 sec. 2025-10-03 23:26:24 02293_ttest_large_samples: [ OK ] 1.27 sec. 2025-10-03 23:26:24 02267_empty_arrays_read_reverse: [ OK ] 0.42 sec. 2025-10-03 23:26:24 01307_polygon_perimeter: [ OK ] 0.12 sec. 2025-10-03 23:26:24 03232_json_uniq_group_by: [ OK ] 0.27 sec. 2025-10-03 23:26:24 01672_test_toSecond_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:26:24 01413_if_array_uuid: [ OK ] 0.12 sec. 2025-10-03 23:26:24 02920_rename_column_of_skip_indices: [ OK ] 0.17 sec. 2025-10-03 23:26:24 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.48 sec. 2025-10-03 23:26:25 02151_http_s_structure_set_eof: [ OK ] 1.22 sec. 2025-10-03 23:26:25 02541_tuple_element_with_null: [ OK ] 0.17 sec. 2025-10-03 23:26:25 00425_count_nullable: [ OK ] 0.17 sec. 2025-10-03 23:26:25 03228_virtual_column_merge_dist: [ OK ] 0.22 sec. 2025-10-03 23:26:25 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.38 sec. 2025-10-03 23:26:25 03227_json_invalid_regexp: [ OK ] 0.12 sec. 2025-10-03 23:26:25 02111_global_context_temporary_tables: [ OK ] 0.12 sec. 2025-10-03 23:26:25 02860_distributed_flush_on_detach: [ OK ] 0.23 sec. 2025-10-03 23:26:25 00509_extended_storage_definition_syntax_zookeeper: [ OK ] 1.53 sec. 2025-10-03 23:26:25 00036_array_element: [ OK ] 0.27 sec. 2025-10-03 23:26:25 02553_type_object_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:26:26 01279_dist_group_by: [ OK ] 0.18 sec. 2025-10-03 23:26:26 02932_parallel_replicas_fuzzer: [ OK ] 0.22 sec. 2025-10-03 23:26:26 01412_row_from_totals: [ OK ] 0.22 sec. 2025-10-03 23:26:26 01674_where_prewhere_array_crash: [ OK ] 0.17 sec. 2025-10-03 23:26:26 02661_read_from_archive_7z: [ OK ] 4.18 sec. 2025-10-03 23:26:26 01285_engine_join_donmikel: [ OK ] 0.72 sec. 2025-10-03 23:26:26 00350_count_distinct: [ OK ] 0.17 sec. 2025-10-03 23:26:26 03008_deduplication_cases_from_docs: [ OK ] 0.62 sec. 2025-10-03 23:26:26 02129_window_functions_disable_optimizations: [ OK ] 0.18 sec. 2025-10-03 23:26:26 02411_legacy_geobase: [ OK ] 0.17 sec. 2025-10-03 23:26:26 02303_cast_nullable_to_custom_types: [ OK ] 0.27 sec. 2025-10-03 23:26:27 01881_total_bytes_storage_buffer: [ OK ] 0.19 sec. 2025-10-03 23:26:27 02909_settings_in_json_schema_cache: [ OK ] 0.47 sec. 2025-10-03 23:26:27 00698_validate_array_sizes_for_nested: [ OK ] 0.17 sec. 2025-10-03 23:26:27 01871_merge_tree_compile_expressions: [ OK ] 0.52 sec. 2025-10-03 23:26:27 01277_buffer_column_order: [ OK ] 0.22 sec. 2025-10-03 23:26:27 00226_zookeeper_deduplication_and_unexpected_parts_long: [ OK ] 0.32 sec. 2025-10-03 23:26:27 01668_test_toMonth_mysql_dialect: [ OK ] 0.17 sec. 2025-10-03 23:26:27 02354_with_statement_non_exist_column: [ OK ] 0.12 sec. 2025-10-03 23:26:27 02950_obfuscator_keywords_more: [ OK ] 0.37 sec. 2025-10-03 23:26:28 03149_numbers_max_block_size_zero: [ OK ] 0.42 sec. 2025-10-03 23:26:28 02011_tuple_vector_functions: [ OK ] 0.63 sec. 2025-10-03 23:26:29 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 1.47 sec. 2025-10-03 23:26:29 02563_async_insert_bad_data: [ OK ] 0.77 sec. 2025-10-03 23:26:30 00318_pk_tuple_order: [ OK ] 0.32 sec. 2025-10-03 23:26:30 02002_system_table_with_tuple: [ OK ] 0.47 sec. 2025-10-03 23:26:30 02276_full_sort_join_unsupported: [ OK ] 0.22 sec. 2025-10-03 23:26:31 01736_null_as_default: [ OK ] 0.17 sec. 2025-10-03 23:26:31 03013_test_part_level_is_reset_attach_from_disk_mt: [ OK ] 0.32 sec. 2025-10-03 23:26:31 00698_validate_array_sizes_for_nested_kshvakov: [ OK ] 0.17 sec. 2025-10-03 23:26:32 01651_lc_insert_tiny_log_3: [ OK ] 3.73 sec. 2025-10-03 23:26:32 00601_kill_running_query: [ OK ] 0.37 sec. 2025-10-03 23:26:32 00762_date_comparsion: [ OK ] 0.22 sec. 2025-10-03 23:26:32 03033_scalars_context_data_race: [ OK ] 0.27 sec. 2025-10-03 23:26:33 03036_dynamic_read_subcolumns_small: [ OK ] 0.77 sec. 2025-10-03 23:26:33 03273_format_inference_create_query_s3_url: [ OK ] 0.77 sec. 2025-10-03 23:26:33 01185_create_or_replace_table: [ OK ] 0.22 sec. 2025-10-03 23:26:33 01605_adaptive_granularity_block_borders: [ OK ] 8.41 sec. 2025-10-03 23:26:33 01262_fractional_timezone_near_start_of_epoch: [ OK ] 0.17 sec. 2025-10-03 23:26:34 02316_const_string_intersact: [ OK ] 0.12 sec. 2025-10-03 23:26:34 01818_case_float_value_fangyc: [ OK ] 0.12 sec. 2025-10-03 23:26:34 02737_sql_auto_is_null: [ OK ] 0.12 sec. 2025-10-03 23:26:34 00804_test_delta_codec_compression: [ OK ] 1.42 sec. 2025-10-03 23:26:34 02815_first_line: [ OK ] 0.17 sec. 2025-10-03 23:26:34 03101_analyzer_identifiers_4: [ OK ] 0.22 sec. 2025-10-03 23:26:34 01474_bad_global_join: [ OK ] 0.17 sec. 2025-10-03 23:26:35 02234_column_function_short_circuit: [ OK ] 0.27 sec. 2025-10-03 23:26:35 02949_parallel_replicas_in_subquery: [ OK ] 0.37 sec. 2025-10-03 23:26:35 02539_generate_random_map: [ OK ] 0.12 sec. 2025-10-03 23:26:35 02784_connection_string: [ OK ] 6.70 sec. 2025-10-03 23:26:35 01710_projections_in_distributed_query: [ OK ] 0.22 sec. 2025-10-03 23:26:35 01939_type_map_json: [ OK ] 0.17 sec. 2025-10-03 23:26:35 02310_profile_events_insert: [ OK ] 0.52 sec. 2025-10-03 23:26:35 02366_kql_datatype: [ OK ] 0.42 sec. 2025-10-03 23:26:36 03095_window_functions_qualify: [ OK ] 0.22 sec. 2025-10-03 23:26:36 02475_split_with_max_substrings: [ OK ] 0.72 sec. 2025-10-03 23:26:36 02428_delete_with_settings: [ OK ] 0.47 sec. 2025-10-03 23:26:36 01082_bit_test_out_of_bound: [ OK ] 0.22 sec. 2025-10-03 23:26:36 01674_filter_by_uint8: [ OK ] 0.17 sec. 2025-10-03 23:26:36 02725_agg_projection_resprect_PK: [ OK ] 0.23 sec. 2025-10-03 23:26:36 02176_dict_get_has_implicit_key_cast: [ OK ] 0.48 sec. 2025-10-03 23:26:36 00947_ml_test: [ OK ] 0.27 sec. 2025-10-03 23:26:36 02098_hashed_array_dictionary_simple_key: [ OK ] 3.53 sec. 2025-10-03 23:26:36 02974_if_with_map: [ OK ] 0.22 sec. 2025-10-03 23:26:37 00928_multi_match_constant_constant: [ OK ] 0.12 sec. 2025-10-03 23:26:37 00457_log_tinylog_stripelog_nullable: [ OK ] 0.27 sec. 2025-10-03 23:26:37 02012_changed_enum_type_non_replicated: [ OK ] 0.17 sec. 2025-10-03 23:26:37 01355_ilike: [ OK ] 0.28 sec. 2025-10-03 23:26:37 02921_database_filesystem_path_check: [ OK ] 0.12 sec. 2025-10-03 23:26:37 02010_array_index_bad_cast: [ OK ] 0.17 sec. 2025-10-03 23:26:38 01656_join_defaul_enum: [ OK ] 0.27 sec. 2025-10-03 23:26:38 00534_client_ignore_error: [ OK ] 0.63 sec. 2025-10-03 23:26:39 02444_async_broken_outdated_part_loading: [ OK ] 2.07 sec. 2025-10-03 23:26:39 02473_multistep_split_prewhere: [ OK ] 12.72 sec. 2025-10-03 23:26:39 00732_decimal_summing_merge_tree: [ OK ] 0.17 sec. 2025-10-03 23:26:39 02207_key_condition_floats: [ OK ] 0.22 sec. 2025-10-03 23:26:39 03015_optimize_final_rmt: [ OK ] 2.88 sec. 2025-10-03 23:26:39 00633_func_or_in: [ OK ] 0.17 sec. 2025-10-03 23:26:39 01825_new_type_json_13: [ OK ] 1.12 sec. 2025-10-03 23:26:40 01615_two_args_function_index_fix: [ OK ] 0.22 sec. 2025-10-03 23:26:40 01925_jit_aggregation_function_count_long: [ OK ] 0.22 sec. 2025-10-03 23:26:40 02379_analyzer_subquery_depth: [ OK ] 0.17 sec. 2025-10-03 23:26:40 01052_array_reduce_exception: [ OK ] 0.12 sec. 2025-10-03 23:26:40 01292_quantile_array_bug: [ OK ] 0.12 sec. 2025-10-03 23:26:40 02354_vector_search_unquoted_index_parameters: [ OK ] 0.18 sec. 2025-10-03 23:26:40 03201_avro_negative_block_size_arrays: [ OK ] 0.52 sec. 2025-10-03 23:26:40 01596_setting_limit_offset: [ OK ] 0.23 sec. 2025-10-03 23:26:41 01780_column_sparse_full: [ OK ] 0.62 sec. 2025-10-03 23:26:41 02791_predicate_pushdown_different_types: [ OK ] 0.12 sec. 2025-10-03 23:26:41 02680_illegal_type_of_filter_projection: [ OK ] 0.17 sec. 2025-10-03 23:26:41 02833_concurrent_sessions: [ OK ] 4.99 sec. 2025-10-03 23:26:41 02126_lc_window_functions: [ OK ] 0.32 sec. 2025-10-03 23:26:41 00678_murmurhash: [ OK ] 0.23 sec. 2025-10-03 23:26:41 00360_to_date_from_string_with_datetime: [ OK ] 0.12 sec. 2025-10-03 23:26:41 03207_json_read_subcolumns_2_compact_merge_tree: [ OK ] 74.37 sec. 2025-10-03 23:26:41 02381_parseDateTime64BestEffortUS: [ OK ] 0.17 sec. 2025-10-03 23:26:42 01646_rewrite_sum_if: [ OK ] 0.27 sec. 2025-10-03 23:26:42 01400_join_get_with_multi_keys: [ OK ] 0.17 sec. 2025-10-03 23:26:42 02518_delete_on_materialized_view: [ OK ] 0.22 sec. 2025-10-03 23:26:42 02286_parallel_final: [ OK ] 2.53 sec. 2025-10-03 23:26:42 00538_datediff: [ OK ] 0.37 sec. 2025-10-03 23:26:43 00753_alter_destination_for_storage_buffer: [ OK ] 0.40 sec. 2025-10-03 23:26:43 02959_system_database_engines: [ OK ] 0.12 sec. 2025-10-03 23:26:43 02923_hdfs_engine_size_virtual_column: [ OK ] 1.32 sec. 2025-10-03 23:26:43 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.22 sec. 2025-10-03 23:26:43 01244_optimize_distributed_group_by_sharding_key: [ OK ] 0.92 sec. 2025-10-03 23:26:43 01942_snowflakeToDateTime: [ OK ] 0.32 sec. 2025-10-03 23:26:43 01442_date_time_with_params: [ OK ] 0.62 sec. 2025-10-03 23:26:44 02133_distributed_queries_formatting: [ OK ] 0.17 sec. 2025-10-03 23:26:44 01556_accurate_cast_or_null: [ OK ] 0.32 sec. 2025-10-03 23:26:44 02807_default_date_time_nullable: [ OK ] 0.17 sec. 2025-10-03 23:26:44 01017_bithamming_distance: [ OK ] 0.22 sec. 2025-10-03 23:26:44 01550_query_identifier_parameters: [ OK ] 0.87 sec. 2025-10-03 23:26:44 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.22 sec. 2025-10-03 23:26:44 01596_null_as_default_nullable: [ OK ] 0.12 sec. 2025-10-03 23:26:45 02950_parallel_replicas_used_count: [ OK ] 0.77 sec. 2025-10-03 23:26:45 01949_clickhouse_local_with_remote_localhost: [ OK ] 1.02 sec. 2025-10-03 23:26:45 02117_custom_separated_with_names_and_types: [ OK ] 6.21 sec. 2025-10-03 23:26:45 03031_low_cardinality_logical_error: [ OK ] 0.13 sec. 2025-10-03 23:26:45 03150_trace_log_add_build_id: [ OK ] 1.12 sec. 2025-10-03 23:26:45 01825_new_type_json_add_column: [ OK ] 0.37 sec. 2025-10-03 23:26:45 02714_read_bytes_aggregateFunction: [ OK ] 0.32 sec. 2025-10-03 23:26:45 03103_positional_arguments: [ OK ] 0.17 sec. 2025-10-03 23:26:46 00975_sample_prewhere_distributed: [ OK ] 0.17 sec. 2025-10-03 23:26:46 02895_npy_format: [ OK ] 5.03 sec. 2025-10-03 23:26:46 01083_cross_to_inner_with_in_bug: [ OK ] 0.17 sec. 2025-10-03 23:26:46 01276_alter_rename_column_materialized_expr: [ OK ] 0.33 sec. 2025-10-03 23:26:46 01035_prewhere_with_alias: [ OK ] 0.17 sec. 2025-10-03 23:26:47 02302_clash_const_aggegate_join: [ OK ] 0.28 sec. 2025-10-03 23:26:47 02210_processors_profile_log_2: [ OK ] 1.02 sec. 2025-10-03 23:26:47 01825_new_type_json_7: [ OK ] 1.06 sec. 2025-10-03 23:26:47 02416_in_set_same_ast_diff_columns: [ OK ] 0.18 sec. 2025-10-03 23:26:47 01734_datetime64_from_float: [ OK ] 0.22 sec. 2025-10-03 23:26:47 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.17 sec. 2025-10-03 23:26:47 02804_intersect_bad_cast: [ OK ] 0.12 sec. 2025-10-03 23:26:47 03231_pr_duplicate_announcement: [ OK ] 0.27 sec. 2025-10-03 23:26:47 00127_group_by_concat: [ OK ] 0.12 sec. 2025-10-03 23:26:47 02982_minmax_nan_null_order: [ OK ] 0.27 sec. 2025-10-03 23:26:47 02485_zero_copy_commit_error: [ OK ] 5.59 sec. 2025-10-03 23:26:47 01070_h3_hex_area_m2: [ OK ] 0.12 sec. 2025-10-03 23:26:47 01291_unsupported_conversion_from_decimal: [ OK ] 0.17 sec. 2025-10-03 23:26:47 00272_union_all_and_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:26:47 02403_big_http_chunk_size: [ OK ] 0.42 sec. 2025-10-03 23:26:48 02045_like_function: [ OK ] 0.12 sec. 2025-10-03 23:26:48 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.17 sec. 2025-10-03 23:26:48 01158_zookeeper_log_long: [ OK ] 0.57 sec. 2025-10-03 23:26:48 02784_disable_async_with_dedup_correctly: [ OK ] 2.98 sec. 2025-10-03 23:26:48 02001_join_on_const_bs_long: [ OK ] 0.42 sec. 2025-10-03 23:26:48 02808_custom_disk_with_user_defined_name: [ OK ] 0.78 sec. 2025-10-03 23:26:48 03021_output_format_tty: [ OK ] 0.42 sec. 2025-10-03 23:26:48 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.32 sec. 2025-10-03 23:26:48 01721_constraints_constant_expressions: [ OK ] 0.27 sec. 2025-10-03 23:26:49 00473_output_format_json_quote_denormals: [ OK ] 1.03 sec. 2025-10-03 23:26:49 02305_schema_inference_with_globs: [ OK ] 1.37 sec. 2025-10-03 23:26:49 02496_remove_redundant_sorting: [ OK ] 4.55 sec. 2025-10-03 23:26:50 02426_pod_array_overflow_2: [ OK ] 0.12 sec. 2025-10-03 23:26:50 00979_yandex_consistent_hash_fpe: [ OK ] 0.13 sec. 2025-10-03 23:26:50 00760_url_functions_overflow: [ OK ] 0.12 sec. 2025-10-03 23:26:50 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.48 sec. 2025-10-03 23:26:50 02874_json_merge_patch_function_test: [ OK ] 0.23 sec. 2025-10-03 23:26:50 00540_bad_data_types: [ OK ] 1.88 sec. 2025-10-03 23:26:50 01710_projection_additional_filters: [ OK ] 0.22 sec. 2025-10-03 23:26:51 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.12 sec. 2025-10-03 23:26:51 00322_disable_checksumming: [ OK ] 0.37 sec. 2025-10-03 23:26:51 02423_ddl_for_opentelemetry: [ OK ] 3.59 sec. 2025-10-03 23:26:51 00825_protobuf_format_array_3dim: [ OK ] 1.43 sec. 2025-10-03 23:26:51 01655_plan_optimizations_optimize_read_in_window_order: [ OK ] 2.79 sec. 2025-10-03 23:26:51 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.57 sec. 2025-10-03 23:26:51 02312_is_not_null_prewhere: [ OK ] 0.17 sec. 2025-10-03 23:26:51 01070_h3_to_children: [ OK ] 0.17 sec. 2025-10-03 23:26:51 01943_non_deterministic_order_key: [ OK ] 0.17 sec. 2025-10-03 23:26:52 00919_histogram_merge: [ OK ] 0.17 sec. 2025-10-03 23:26:52 01084_defaults_on_aliases: [ OK ] 0.27 sec. 2025-10-03 23:26:52 01329_compare_tuple_string_constant: [ OK ] 0.17 sec. 2025-10-03 23:26:52 02521_merge_over_gap: [ OK ] 2.29 sec. 2025-10-03 23:26:52 02731_parallel_replicas_join_subquery: [ OK ] 0.62 sec. 2025-10-03 23:26:52 03225_alter_to_json_not_supported: [ OK ] 0.17 sec. 2025-10-03 23:26:52 03272_client_highlighting_bug: [ OK ] 0.47 sec. 2025-10-03 23:26:52 02797_read_subcolumns_from_files: [ OK ] 0.92 sec. 2025-10-03 23:26:53 00944_ml_test: [ OK ] 0.27 sec. 2025-10-03 23:26:53 02703_row_policies_for_asterisk: [ OK ] 0.62 sec. 2025-10-03 23:26:53 03146_create_index_compatibility: [ OK ] 0.22 sec. 2025-10-03 23:26:53 03153_trailing_comma_in_values_list_in_insert: [ OK ] 0.18 sec. 2025-10-03 23:26:53 00757_enum_defaults_const_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:26:53 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.32 sec. 2025-10-03 23:26:53 02292_hash_array_tuples: [ OK ] 0.22 sec. 2025-10-03 23:26:53 02454_set_parameters_formatting: [ OK ] 0.37 sec. 2025-10-03 23:26:53 02782_avro_decimals: [ OK ] 0.52 sec. 2025-10-03 23:26:54 02961_output_format_compress_params: [ OK ] 1.38 sec. 2025-10-03 23:26:54 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.17 sec. 2025-10-03 23:26:54 02113_format_row: [ OK ] 0.17 sec. 2025-10-03 23:26:54 03033_distinct_transform_const_columns: [ OK ] 0.17 sec. 2025-10-03 23:26:54 01045_order_by_pk_special_storages: [ OK ] 3.28 sec. 2025-10-03 23:26:54 02915_fpc_overflow: [ OK ] 0.38 sec. 2025-10-03 23:26:54 02180_group_by_lowcardinality: [ OK ] 0.12 sec. 2025-10-03 23:26:54 01938_joins_identifiers: [ OK ] 0.23 sec. 2025-10-03 23:26:54 02383_join_and_filtering_set: [ OK ] 1.48 sec. 2025-10-03 23:26:54 00951_ngram_search: [ OK ] 1.03 sec. 2025-10-03 23:26:54 01300_polygon_convex_hull: [ OK ] 0.14 sec. 2025-10-03 23:26:54 00405_PrettyCompactMonoBlock: [ OK ] 0.62 sec. 2025-10-03 23:26:54 02947_merge_tree_index_table_1: [ OK ] 0.17 sec. 2025-10-03 23:26:54 02142_http_with_query_parameters: [ OK ] 0.37 sec. 2025-10-03 23:26:54 00098_9_union_all: [ OK ] 0.12 sec. 2025-10-03 23:26:54 02469_interval_msan: [ OK ] 0.22 sec. 2025-10-03 23:26:54 02902_select_subcolumns_from_engine_null: [ OK ] 0.17 sec. 2025-10-03 23:26:55 02205_HTTP_user_agent: [ OK ] 0.43 sec. 2025-10-03 23:26:55 02809_has_token: [ OK ] 0.12 sec. 2025-10-03 23:26:55 01556_explain_select_with_union_query: [ OK ] 0.22 sec. 2025-10-03 23:26:55 01136_multiple_sets: [ OK ] 0.17 sec. 2025-10-03 23:26:55 02185_orc_corrupted_file: [ OK ] 0.42 sec. 2025-10-03 23:26:55 02539_generate_random_low_cardinality: [ OK ] 0.17 sec. 2025-10-03 23:26:55 03204_distributed_with_scalar_subquery: [ OK ] 0.17 sec. 2025-10-03 23:26:55 02286_quantile_tdigest_infinity: [ OK ] 0.57 sec. 2025-10-03 23:26:55 00988_constraints_replication_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:26:55 02691_drop_column_with_projections_replicated: [ OK ] 0.22 sec. 2025-10-03 23:26:55 02922_respect_nulls_parser: [ OK ] 0.22 sec. 2025-10-03 23:26:55 00714_alter_uuid: [ OK ] 0.22 sec. 2025-10-03 23:26:55 02354_vector_search_legacy_index_compatibility: [ OK ] 0.27 sec. 2025-10-03 23:26:55 01824_move_to_prewhere_many_columns: [ OK ] 0.22 sec. 2025-10-03 23:26:55 02892_SummingMergeTree_Nested: [ OK ] 0.22 sec. 2025-10-03 23:26:55 01861_explain_pipeline: [ OK ] 0.18 sec. 2025-10-03 23:26:55 01117_chain_finalize_bug: [ OK ] 0.17 sec. 2025-10-03 23:26:55 01254_array_of_unnamed_tuples: [ OK ] 0.17 sec. 2025-10-03 23:26:56 01518_filtering_aliased_materialized_column: [ OK ] 0.17 sec. 2025-10-03 23:26:56 01825_new_type_json_missed_values: [ OK ] 0.52 sec. 2025-10-03 23:26:56 01510_format_regexp_raw_low_cardinality: [ OK ] 0.62 sec. 2025-10-03 23:26:56 00829_bitmap_function: [ OK ] 0.82 sec. 2025-10-03 23:26:56 02897_alter_partition_parameters: [ OK ] 0.52 sec. 2025-10-03 23:26:56 02369_analyzer_array_join_function: [ OK ] 0.22 sec. 2025-10-03 23:26:56 02752_custom_separated_ignore_spaces_bug: [ OK ] 0.12 sec. 2025-10-03 23:26:56 03035_alias_column_bug_distributed: [ OK ] 0.22 sec. 2025-10-03 23:26:56 00974_adaptive_granularity_secondary_index: [ OK ] 0.67 sec. 2025-10-03 23:26:56 00172_constexprs_in_set: [ OK ] 0.12 sec. 2025-10-03 23:26:56 02524_fuzz_and_fuss: [ OK ] 0.12 sec. 2025-10-03 23:26:56 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.22 sec. 2025-10-03 23:26:56 03252_recursive_proto_with_skip_unsupported_fields: [ OK ] 0.57 sec. 2025-10-03 23:26:56 01499_log_deadlock: [ OK ] 0.27 sec. 2025-10-03 23:26:56 03165_order_by_duplicate: [ OK ] 0.17 sec. 2025-10-03 23:26:56 02006_use_constants_in_with_and_select: [ OK ] 0.17 sec. 2025-10-03 23:26:56 03037_dot_product_overflow: [ OK ] 0.12 sec. 2025-10-03 23:26:56 02865_array_join_with_max_block_size: [ OK ] 0.32 sec. 2025-10-03 23:26:56 02955_analyzer_using_functional_args: [ OK ] 0.77 sec. 2025-10-03 23:26:57 02554_invalid_create_view_syntax: [ OK ] 0.12 sec. 2025-10-03 23:26:57 01913_if_int_decimal: [ OK ] 0.12 sec. 2025-10-03 23:26:57 01114_alter_modify_compact_parts: [ OK ] 0.17 sec. 2025-10-03 23:26:57 02552_regression_crash: [ OK ] 0.12 sec. 2025-10-03 23:26:57 02002_parse_map_int_key: [ OK ] 0.17 sec. 2025-10-03 23:26:57 00344_row_number_in_all_blocks: [ OK ] 0.17 sec. 2025-10-03 23:26:57 02579_fill_empty_chunk: [ OK ] 0.12 sec. 2025-10-03 23:26:57 02922_respect_nulls_Nullable: [ OK ] 0.22 sec. 2025-10-03 23:26:57 00735_or_expr_optimize_bug: [ OK ] 0.12 sec. 2025-10-03 23:26:57 02868_select_support_from_keywords: [ OK ] 0.17 sec. 2025-10-03 23:26:58 01088_benchmark_query_id: [ OK ] 0.87 sec. 2025-10-03 23:26:58 01289_min_execution_speed_not_too_early: [ OK ] 0.77 sec. 2025-10-03 23:26:58 00687_top_and_offset: [ OK ] 1.98 sec. 2025-10-03 23:26:58 01268_procfs_metrics: [ OK ] 0.57 sec. 2025-10-03 23:26:59 02160_untuple_exponential_growth: [ OK ] 0.72 sec. 2025-10-03 23:26:59 01592_window_functions: [ OK ] 0.27 sec. 2025-10-03 23:26:59 00197_if_fixed_string: [ OK ] 0.18 sec. 2025-10-03 23:26:59 02907_preferred_optimize_projection_name: [ OK ] 2.33 sec. 2025-10-03 23:26:59 01166_truncate_multiple_partitions: [ OK ] 0.57 sec. 2025-10-03 23:26:59 00554_nested_and_table_engines: [ OK ] 0.37 sec. 2025-10-03 23:26:59 01124_view_bad_types: [ OK ] 0.22 sec. 2025-10-03 23:26:59 02554_fix_grouping_sets_predicate_push_down: [ OK ] 0.22 sec. 2025-10-03 23:27:00 02518_parquet_arrow_orc_boolean_value: [ OK ] 0.63 sec. 2025-10-03 23:27:00 01319_optimize_skip_unused_shards_nesting: [ OK ] 0.62 sec. 2025-10-03 23:27:01 02479_race_condition_between_insert_and_droppin_mv: [ OK ] 51.99 sec. 2025-10-03 23:27:01 02421_type_json_async_insert: [ OK ] 1.28 sec. 2025-10-03 23:27:01 03133_help_message_verbosity: [ OK ] 0.52 sec. 2025-10-03 23:27:01 00501_http_head: [ OK ] 0.37 sec. 2025-10-03 23:27:01 03169_time_virtual_column: [ OK ] 1.43 sec. 2025-10-03 23:27:01 01511_prewhere_with_virtuals: [ OK ] 0.17 sec. 2025-10-03 23:27:01 01783_merge_engine_join_key_condition: [ OK ] 0.27 sec. 2025-10-03 23:27:01 03261_json_hints_types_check: [ OK ] 0.17 sec. 2025-10-03 23:27:01 03104_create_view_join: [ OK ] 0.17 sec. 2025-10-03 23:27:01 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.22 sec. 2025-10-03 23:27:01 01960_lambda_precedence: [ OK ] 0.17 sec. 2025-10-03 23:27:01 02893_trash_optimization: [ OK ] 0.12 sec. 2025-10-03 23:27:01 02804_clusterAllReplicas_insert: [ OK ] 0.17 sec. 2025-10-03 23:27:01 02481_aggregation_in_order_plan: [ OK ] 0.17 sec. 2025-10-03 23:27:02 01762_deltasumtimestamp: [ OK ] 0.17 sec. 2025-10-03 23:27:02 02922_server_exit_code: [ OK ] 0.42 sec. 2025-10-03 23:27:02 00624_length_utf8: [ OK ] 0.12 sec. 2025-10-03 23:27:02 00267_tuple_array_access_operators_priority: [ OK ] 0.12 sec. 2025-10-03 23:27:02 00306_insert_values_and_expressions: [ OK ] 0.17 sec. 2025-10-03 23:27:02 00761_lower_utf8_bug: [ OK ] 0.12 sec. 2025-10-03 23:27:02 02841_group_array_sorted: [ OK ] 0.57 sec. 2025-10-03 23:27:02 00592_union_all_different_aliases: [ OK ] 0.12 sec. 2025-10-03 23:27:03 00927_asof_join_long: [ OK ] 6.95 sec. 2025-10-03 23:27:03 02582_async_reading_with_small_limit: [ OK ] 0.29 sec. 2025-10-03 23:27:04 03168_read_in_order_buffering_2: [ OK ] 2.73 sec. 2025-10-03 23:27:05 01943_query_id_check: [ OK ] 1.14 sec. 2025-10-03 23:27:06 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 2.21 sec. 2025-10-03 23:27:06 03208_array_of_json_read_subcolumns_1: [ OK ] 3.63 sec. 2025-10-03 23:27:06 00214_primary_key_order: [ OK ] 0.38 sec. 2025-10-03 23:27:06 01543_toModifiedJulianDay: [ OK ] 0.43 sec. 2025-10-03 23:27:07 02017_bit_shift_left_for_string_integer: [ OK ] 1.29 sec. 2025-10-03 23:27:07 01282_system_parts_ttl_info: [ OK ] 0.43 sec. 2025-10-03 23:27:07 00412_logical_expressions_optimizer: [ OK ] 0.23 sec. 2025-10-03 23:27:07 02999_analyzer_preimage_null: [ OK ] 0.24 sec. 2025-10-03 23:27:07 02252_executable_user_defined_function_short_circuit: [ OK ] 0.28 sec. 2025-10-03 23:27:07 02114_bool_type: [ OK ] 0.34 sec. 2025-10-03 23:27:08 00651_default_database_on_client_reconnect: [ OK ] 0.79 sec. 2025-10-03 23:27:08 00294_shard_enums: [ OK ] 0.89 sec. 2025-10-03 23:27:09 00612_shard_count: [ OK ] 0.43 sec. 2025-10-03 23:27:09 02896_leading_zeroes_no_octal: [ OK ] 2.15 sec. 2025-10-03 23:27:09 02913_sum_map_state: [ OK ] 0.23 sec. 2025-10-03 23:27:10 02813_float_parsing: [ OK ] 0.19 sec. 2025-10-03 23:27:10 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 0.83 sec. 2025-10-03 23:27:11 00926_adaptive_index_granularity_replacing_merge_tree: [ OK ] 2.81 sec. 2025-10-03 23:27:11 02421_truncate_isolation_no_merges: [ OK ] 12.31 sec. 2025-10-03 23:27:11 02535_analyzer_group_by_use_nulls: [ OK ] 0.43 sec. 2025-10-03 23:27:11 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.65 sec. 2025-10-03 23:27:11 03167_empty_tuple_concat: [ OK ] 0.15 sec. 2025-10-03 23:27:12 01661_referer: [ OK ] 1.33 sec. 2025-10-03 23:27:12 02389_dashboard: [ OK ] 0.63 sec. 2025-10-03 23:27:13 02420_final_setting: [ OK ] 1.45 sec. 2025-10-03 23:27:13 02497_having_without_actual_aggregation_bug: [ OK ] 0.22 sec. 2025-10-03 23:27:13 02246_clickhouse_local_drop_database: [ OK ] 1.43 sec. 2025-10-03 23:27:14 00855_join_with_array_join: [ OK ] 0.59 sec. 2025-10-03 23:27:14 02433_default_expression_operator_in: [ OK ] 0.85 sec. 2025-10-03 23:27:15 02534_default_granularity: [ OK ] 0.29 sec. 2025-10-03 23:27:15 02354_tuple_lowcardinality: [ OK ] 0.14 sec. 2025-10-03 23:27:15 02482_value_block_parsing: [ OK ] 0.73 sec. 2025-10-03 23:27:15 02694_wrong_identifier_shouldnt_be_accepted: [ OK ] 0.26 sec. 2025-10-03 23:27:15 02872_null_as_default_nested: [ OK ] 3.50 sec. 2025-10-03 23:27:15 02102_row_binary_with_names_and_types: [ OK ] 6.52 sec. 2025-10-03 23:27:16 03164_optimize_read_in_order_nullable: [ OK ] 0.78 sec. 2025-10-03 23:27:16 01451_wrong_error_long_query: [ OK ] 0.47 sec. 2025-10-03 23:27:16 01825_new_type_json_18: [ OK ] 0.22 sec. 2025-10-03 23:27:16 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.73 sec. 2025-10-03 23:27:16 03019_numbers_pretty: [ OK ] 0.18 sec. 2025-10-03 23:27:16 01323_redundant_functions_in_order_by: [ OK ] 0.73 sec. 2025-10-03 23:27:16 02313_negative_datetime64: [ OK ] 0.22 sec. 2025-10-03 23:27:16 03038_recursive_cte_postgres_4: [ OK ] 0.29 sec. 2025-10-03 23:27:16 02021_prewhere_always_true_where: [ OK ] 0.23 sec. 2025-10-03 23:27:17 02946_merge_tree_final_split_ranges_by_primary_key: [ OK ] 0.53 sec. 2025-10-03 23:27:17 03231_dynamic_uniq_group_by: [ OK ] 0.33 sec. 2025-10-03 23:27:17 03262_udf_in_constraint: [ OK ] 0.72 sec. 2025-10-03 23:27:17 00536_int_exp: [ OK ] 0.19 sec. 2025-10-03 23:27:18 01283_strict_resize_bug: [ OK ] 1.13 sec. 2025-10-03 23:27:18 02481_default_value_used_in_row_level_filter: [ OK ] 0.44 sec. 2025-10-03 23:27:18 02572_max_intersections: [ OK ] 0.12 sec. 2025-10-03 23:27:18 01030_incorrect_count_summing_merge_tree: [ OK ] 1.68 sec. 2025-10-03 23:27:18 02416_json_tuple_to_array_schema_inference: [ OK ] 0.27 sec. 2025-10-03 23:27:18 02156_storage_merge_prewhere_not_ready_set_bug: [ OK ] 0.33 sec. 2025-10-03 23:27:19 02908_Npy_files_caching: [ OK ] 1.35 sec. 2025-10-03 23:27:19 03047_group_by_field_identified_aggregation: [ OK ] 0.18 sec. 2025-10-03 23:27:19 02935_http_content_type_with_http_headers_progress: [ OK ] 16.81 sec. 2025-10-03 23:27:19 01583_parallel_parsing_exception_with_offset: [ OK ] 1.12 sec. 2025-10-03 23:27:19 01890_state_of_state: [ OK ] 0.69 sec. 2025-10-03 23:27:19 02177_merge_optimize_aggregation_in_order: [ OK ] 0.42 sec. 2025-10-03 23:27:20 02016_bit_shift_right_for_string_integer: [ OK ] 1.12 sec. 2025-10-03 23:27:21 00738_lock_for_inner_table: [ OK ] 2.08 sec. 2025-10-03 23:27:22 03085_analyzer_alias_column_group_by: [ OK ] 0.29 sec. 2025-10-03 23:27:22 00972_desc_table_virtual_columns: [ OK ] 0.20 sec. 2025-10-03 23:27:22 02375_rocksdb_with_filters: [ OK ] 2.76 sec. 2025-10-03 23:27:23 02136_kill_scalar_queries: [ OK ] 0.99 sec. 2025-10-03 23:27:24 01691_parser_data_type_exponential: [ OK ] 1.63 sec. 2025-10-03 23:27:24 01660_test_toDayOfYear_mysql_compatibility: [ OK ] 0.18 sec. 2025-10-03 23:27:24 01943_pmj_non_joined_stuck: [ OK ] 0.43 sec. 2025-10-03 23:27:24 00085_visible_width_of_tuple_of_dates: [ OK ] 0.24 sec. 2025-10-03 23:27:24 02771_parallel_replicas_analyzer: [ OK ] 0.75 sec. 2025-10-03 23:27:25 00258_materializing_tuples: [ OK ] 0.22 sec. 2025-10-03 23:27:25 00434_tonullable: [ OK ] 0.24 sec. 2025-10-03 23:27:26 03006_join_on_inequal_expression_4: [ OK ] 0.73 sec. 2025-10-03 23:27:26 02150_index_hypothesis_race_long: [ OK ] 6.88 sec. 2025-10-03 23:27:26 00182_functions_higher_order_and_consts: [ OK ] 1.94 sec. 2025-10-03 23:27:27 01753_max_uri_size: [ OK ] 0.53 sec. 2025-10-03 23:27:27 00714_create_temporary_table_with_in_clause: [ OK ] 0.28 sec. 2025-10-03 23:27:27 00097_long_storage_buffer_race_condition: [ OK ] 30.27 sec. 2025-10-03 23:27:27 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.23 sec. 2025-10-03 23:27:28 00154_shard_distributed_with_distinct: [ OK ] 0.19 sec. 2025-10-03 23:27:28 02428_decimal_in_floating_point_literal: [ OK ] 0.51 sec. 2025-10-03 23:27:28 02174_cte_scalar_cache_mv: [ OK ] 2.04 sec. 2025-10-03 23:27:28 02814_create_index_uniq_noop: [ OK ] 0.12 sec. 2025-10-03 23:27:28 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.48 sec. 2025-10-03 23:27:28 01650_expressions_merge_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:29 02677_decode_url_component: [ OK ] 0.32 sec. 2025-10-03 23:27:29 02232_partition_pruner_mixed_constant_type: [ OK ] 0.18 sec. 2025-10-03 23:27:29 01414_low_cardinality_nullable: [ OK ] 1.14 sec. 2025-10-03 23:27:29 02882_formatQuery: [ OK ] 0.68 sec. 2025-10-03 23:27:29 01098_msgpack_format: [ OK ] 8.44 sec. 2025-10-03 23:27:29 01284_fuzz_bits: [ OK ] 0.33 sec. 2025-10-03 23:27:29 00677_shard_any_heavy_merge: [ OK ] 0.23 sec. 2025-10-03 23:27:29 02041_openssl_hash_functions_test: [ OK ] 0.18 sec. 2025-10-03 23:27:29 00545_weird_aggregate_functions: [ OK ] 0.22 sec. 2025-10-03 23:27:29 00580_consistent_hashing_functions: [ OK ] 0.18 sec. 2025-10-03 23:27:29 00997_extract_all_crash_6627: [ OK ] 0.17 sec. 2025-10-03 23:27:29 03023_analyzer_optimize_group_by_function_keys_with_nulls: [ OK ] 0.18 sec. 2025-10-03 23:27:30 02125_fix_storage_filelog: [ OK ] 0.12 sec. 2025-10-03 23:27:30 02456_summing_mt_lc: [ OK ] 0.39 sec. 2025-10-03 23:27:30 03167_parametrized_view_with_cte: [ OK ] 0.23 sec. 2025-10-03 23:27:30 00800_low_cardinality_join: [ OK ] 0.32 sec. 2025-10-03 23:27:30 02833_sparse_columns_tuple_function: [ OK ] 0.37 sec. 2025-10-03 23:27:30 01043_categorical_iv: [ OK ] 0.34 sec. 2025-10-03 23:27:30 02551_obfuscator_keywords: [ OK ] 0.63 sec. 2025-10-03 23:27:31 01104_distributed_one_test: [ OK ] 0.28 sec. 2025-10-03 23:27:31 00512_fractional_time_zones: [ OK ] 0.78 sec. 2025-10-03 23:27:31 00563_insert_into_remote_and_zookeeper_long: [ OK ] 0.58 sec. 2025-10-03 23:27:31 00071_insert_fewer_columns: [ OK ] 0.23 sec. 2025-10-03 23:27:31 00938_dataset_test: [ OK ] 0.17 sec. 2025-10-03 23:27:32 02477_analyzer_function_hints: [ OK ] 1.59 sec. 2025-10-03 23:27:32 01273_arrow_load: [ OK ] 1.18 sec. 2025-10-03 23:27:32 02935_parallel_replicas_settings: [ OK ] 0.88 sec. 2025-10-03 23:27:33 02583_map_literal_cast: [ OK ] 0.17 sec. 2025-10-03 23:27:34 00991_system_parts_race_condition_long: [ OK ] 32.50 sec. 2025-10-03 23:27:34 03143_prewhere_profile_events: [ OK ] 3.54 sec. 2025-10-03 23:27:34 00417_kill_query: [ OK ] 2.03 sec. 2025-10-03 23:27:34 00726_materialized_view_concurrent: [ OK ] 2.08 sec. 2025-10-03 23:27:34 02870_per_column_settings: [ OK ] 1.82 sec. 2025-10-03 23:27:34 01551_context_uaf: [ OK ] 0.17 sec. 2025-10-03 23:27:35 02418_tautological_if_index: [ OK ] 0.22 sec. 2025-10-03 23:27:35 03010_view_prewhere_in: [ OK ] 0.17 sec. 2025-10-03 23:27:35 01271_show_privileges: [ OK ] 0.12 sec. 2025-10-03 23:27:35 02293_grouping_function: [ OK ] 0.22 sec. 2025-10-03 23:27:35 03276_functions_to_subcolumns_lc: [ OK ] 0.17 sec. 2025-10-03 23:27:35 01285_data_skip_index_over_aggregation: [ OK ] 0.27 sec. 2025-10-03 23:27:35 01560_crash_in_agg_empty_arglist: [ OK ] 0.27 sec. 2025-10-03 23:27:35 02475_bson_each_row_format: [ OK ] 16.89 sec. 2025-10-03 23:27:35 02381_join_dup_columns_in_plan: [ OK ] 0.27 sec. 2025-10-03 23:27:35 02136_scalar_subquery_metrics: [ OK ] 0.22 sec. 2025-10-03 23:27:35 02780_final_streams_data_skipping_index: [ OK ] 0.27 sec. 2025-10-03 23:27:36 01881_join_on_conditions_hash: [ OK ] 0.97 sec. 2025-10-03 23:27:36 01269_toStartOfSecond: [ OK ] 0.22 sec. 2025-10-03 23:27:36 02968_analyzer_join_column_not_found: [ OK ] 0.17 sec. 2025-10-03 23:27:36 02293_grouping_function_group_by: [ OK ] 0.32 sec. 2025-10-03 23:27:36 03210_nested_short_circuit_functions_bug: [ OK ] 0.12 sec. 2025-10-03 23:27:36 01050_group_array_sample: [ OK ] 0.12 sec. 2025-10-03 23:27:36 02575_map_hashing_msan: [ OK ] 0.17 sec. 2025-10-03 23:27:36 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.22 sec. 2025-10-03 23:27:36 00208_agg_state_merge: [ OK ] 0.12 sec. 2025-10-03 23:27:36 00021_sorting_arrays: [ OK ] 0.12 sec. 2025-10-03 23:27:36 02918_template_format_deadlock: [ OK ] 0.42 sec. 2025-10-03 23:27:37 01319_manual_write_to_replicas_long: [ OK ] 0.32 sec. 2025-10-03 23:27:37 00974_text_log_table_not_empty: [ OK ] 0.82 sec. 2025-10-03 23:27:37 03110_unicode_alias: [ OK ] 0.17 sec. 2025-10-03 23:27:37 02521_grouping_sets_plus_memory_efficient_aggr: [ OK ] 0.17 sec. 2025-10-03 23:27:37 01595_countMatches: [ OK ] 0.22 sec. 2025-10-03 23:27:37 02884_parallel_window_functions: [ OK ] 2.48 sec. 2025-10-03 23:27:38 02947_dropped_tables_parts: [ OK ] 0.22 sec. 2025-10-03 23:27:38 03041_dynamic_type_check_table: [ OK ] 3.08 sec. 2025-10-03 23:27:38 00719_parallel_ddl_table: [ OK ] 11.67 sec. 2025-10-03 23:27:38 00751_low_cardinality_nullable_group_by: [ OK ] 0.52 sec. 2025-10-03 23:27:38 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.17 sec. 2025-10-03 23:27:38 02734_big_int_from_float_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:27:38 00812_prewhere_alias_array: [ OK ] 0.17 sec. 2025-10-03 23:27:38 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.37 sec. 2025-10-03 23:27:38 01600_multiple_left_join_with_aliases: [ OK ] 0.12 sec. 2025-10-03 23:27:38 02843_backup_use_same_password_for_base_backup: [ OK ] 1.57 sec. 2025-10-03 23:27:38 00218_like_regexp_newline: [ OK ] 0.17 sec. 2025-10-03 23:27:39 00235_create_temporary_table_as: [ OK ] 0.12 sec. 2025-10-03 23:27:39 03199_json_extract_dynamic: [ OK ] 0.22 sec. 2025-10-03 23:27:39 02902_show_databases_limit: [ OK ] 0.12 sec. 2025-10-03 23:27:39 03014_msan_parse_date_time: [ OK ] 0.12 sec. 2025-10-03 23:27:39 00283_column_cut: [ OK ] 0.12 sec. 2025-10-03 23:27:39 00725_ipv4_ipv6_domains: [ OK ] 0.27 sec. 2025-10-03 23:27:39 01330_array_join_in_higher_order_function: [ OK ] 0.13 sec. 2025-10-03 23:27:39 00752_low_cardinality_mv_1: [ OK ] 0.22 sec. 2025-10-03 23:27:39 01286_constraints_on_default: [ OK ] 0.22 sec. 2025-10-03 23:27:39 00160_merge_and_index_in_in: [ OK ] 1.93 sec. 2025-10-03 23:27:39 02119_sumcount: [ OK ] 0.33 sec. 2025-10-03 23:27:40 00834_not_between: [ OK ] 0.12 sec. 2025-10-03 23:27:40 00292_parser_tuple_element: [ OK ] 0.12 sec. 2025-10-03 23:27:40 02418_do_not_return_empty_blocks_from_ConvertingAggregatedToChunksTransform: [ OK ] 0.37 sec. 2025-10-03 23:27:40 00588_shard_distributed_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:27:40 02900_decimal_sort_with_multiple_columns: [ OK ] 0.12 sec. 2025-10-03 23:27:40 03143_cte_scope: [ OK ] 0.17 sec. 2025-10-03 23:27:40 01700_point_in_polygon_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:27:40 01508_partition_pruning_long_2: [ OK ] 6.09 sec. 2025-10-03 23:27:40 00836_indices_alter: [ OK ] 0.32 sec. 2025-10-03 23:27:40 01891_echo: [ OK ] 0.12 sec. 2025-10-03 23:27:40 02294_anova_cmp: [ OK ] 1.82 sec. 2025-10-03 23:27:41 02813_series_period_detect: [ OK ] 0.22 sec. 2025-10-03 23:27:41 01917_distinct_on: [ OK ] 0.17 sec. 2025-10-03 23:27:41 00237_group_by_arrays: [ OK ] 0.17 sec. 2025-10-03 23:27:41 01621_clickhouse_compressor: [ OK ] 0.58 sec. 2025-10-03 23:27:42 01321_monotonous_functions_in_order_by_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:43 00705_drop_create_merge_tree: [ OK ] 6.34 sec. 2025-10-03 23:27:43 02516_projections_with_rollup: [ OK ] 1.92 sec. 2025-10-03 23:27:43 00691_array_distinct: [ OK ] 0.17 sec. 2025-10-03 23:27:43 01525_select_with_offset_fetch_clause: [ OK ] 0.17 sec. 2025-10-03 23:27:43 03210_dynamic_squashing: [ OK ] 0.37 sec. 2025-10-03 23:27:43 02941_variant_type_2: [ OK ] 4.63 sec. 2025-10-03 23:27:43 02353_partition_prune_nullable_key: [ OK ] 0.17 sec. 2025-10-03 23:27:43 02234_clickhouse_local_test_mode: [ OK ] 0.67 sec. 2025-10-03 23:27:44 02811_read_in_order_and_array_join_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:44 02905_structure_to_schema_bad_names: [ OK ] 0.52 sec. 2025-10-03 23:27:44 02040_clickhouse_benchmark_query_id_pass_through: [ OK ] 0.77 sec. 2025-10-03 23:27:44 00089_group_by_arrays_of_fixed: [ OK ] 0.12 sec. 2025-10-03 23:27:44 01786_explain_merge_tree: [ OK ] 2.33 sec. 2025-10-03 23:27:44 02286_vertical_merges_missed_column: [ OK ] 0.22 sec. 2025-10-03 23:27:44 01274_generate_random_nested: [ OK ] 0.32 sec. 2025-10-03 23:27:44 02875_merge_engine_set_index: [ OK ] 0.72 sec. 2025-10-03 23:27:44 02013_lc_nullable_and_infinity: [ OK ] 0.12 sec. 2025-10-03 23:27:45 02366_with_fill_date: [ OK ] 0.14 sec. 2025-10-03 23:27:45 02481_async_insert_dedup: [ OK ] 90.52 sec. 2025-10-03 23:27:45 03217_filtering_in_system_tables: [ OK ] 0.27 sec. 2025-10-03 23:27:45 02110_clickhouse_local_custom_tld: [ OK ] 0.42 sec. 2025-10-03 23:27:45 01800_log_nested: [ OK ] 0.22 sec. 2025-10-03 23:27:45 00813_parse_date_time_best_effort_more: [ OK ] 0.12 sec. 2025-10-03 23:27:45 00192_least_greatest: [ OK ] 0.17 sec. 2025-10-03 23:27:45 00369_int_div_of_float: [ OK ] 0.12 sec. 2025-10-03 23:27:45 02243_in_ip_address: [ OK ] 0.17 sec. 2025-10-03 23:27:45 02343_analyzer_column_transformers_strict: [ OK ] 0.17 sec. 2025-10-03 23:27:45 02113_base64encode_trailing_bytes: [ OK ] 0.27 sec. 2025-10-03 23:27:45 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.42 sec. 2025-10-03 23:27:46 02792_alter_table_modify_comment: [ OK ] 0.67 sec. 2025-10-03 23:27:46 02179_sparse_columns_detach: [ OK ] 0.23 sec. 2025-10-03 23:27:46 02233_HTTP_ranged: [ OK ] 1.02 sec. 2025-10-03 23:27:46 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.42 sec. 2025-10-03 23:27:47 01087_table_function_generate: [ OK ] 0.42 sec. 2025-10-03 23:27:47 01246_buffer_flush: [ OK ] 7.59 sec. 2025-10-03 23:27:47 01656_test_hex_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:27:47 02457_parse_date_time_best_effort: [ OK ] 0.27 sec. 2025-10-03 23:27:47 03228_pr_subquery_view_order_by: [ OK ] 0.17 sec. 2025-10-03 23:27:48 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.33 sec. 2025-10-03 23:27:48 00652_mutations_default_database: [ OK ] 0.82 sec. 2025-10-03 23:27:48 01156_pcg_deserialization: [ OK ] 3.93 sec. 2025-10-03 23:27:48 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.22 sec. 2025-10-03 23:27:48 02467_set_with_lowcardinality_type: [ OK ] 0.17 sec. 2025-10-03 23:27:48 00901_joint_entropy: [ OK ] 0.12 sec. 2025-10-03 23:27:48 03169_display_column_names_in_footer: [ OK ] 0.22 sec. 2025-10-03 23:27:48 01662_join_mixed: [ OK ] 0.12 sec. 2025-10-03 23:27:49 01473_event_time_microseconds: [ OK ] 2.28 sec. 2025-10-03 23:27:49 00387_use_client_time_zone: [ OK ] 0.42 sec. 2025-10-03 23:27:49 00302_http_compression: [ OK ] 0.77 sec. 2025-10-03 23:27:49 02815_fix_not_found_constants_col_in_block: [ OK ] 0.17 sec. 2025-10-03 23:27:49 02885_async_insert_access_check_for_defaults: [ OK ] 3.88 sec. 2025-10-03 23:27:49 01196_max_parser_depth: [ OK ] 0.52 sec. 2025-10-03 23:27:49 01933_invalid_date: [ OK ] 0.22 sec. 2025-10-03 23:27:49 02841_with_clause_resolve: [ OK ] 0.27 sec. 2025-10-03 23:27:49 02458_key_condition_not_like_prefix: [ OK ] 0.22 sec. 2025-10-03 23:27:50 02366_kql_func_dynamic: [ OK ] 0.82 sec. 2025-10-03 23:27:50 03129_format_row_json_http: [ OK ] 0.32 sec. 2025-10-03 23:27:50 01888_read_int_safe: [ OK ] 0.27 sec. 2025-10-03 23:27:50 02524_fuzz_and_fuss_2: [ OK ] 0.17 sec. 2025-10-03 23:27:50 03161_create_table_as_mv: [ OK ] 0.17 sec. 2025-10-03 23:27:50 02012_settings_clause_for_s3: [ OK ] 0.17 sec. 2025-10-03 23:27:50 00410_aggregation_combinators_with_arenas: [ OK ] 1.02 sec. 2025-10-03 23:27:51 02536_replace_with_nonconst_needle_and_replacement: [ OK ] 0.57 sec. 2025-10-03 23:27:51 01576_if_null_external_aggregation: [ OK ] 1.37 sec. 2025-10-03 23:27:51 01030_storage_hdfs_syntax: [ OK ] 0.18 sec. 2025-10-03 23:27:52 03140_client_subsequent_external_tables: [ OK ] 0.42 sec. 2025-10-03 23:27:52 00650_csv_with_specified_quote_rule: [ OK ] 2.12 sec. 2025-10-03 23:27:53 02500_remove_redundant_distinct_analyzer: [ OK ] 4.59 sec. 2025-10-03 23:27:53 02981_vertical_merges_memory_usage: [ OK ] 1.12 sec. 2025-10-03 23:27:53 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.22 sec. 2025-10-03 23:27:53 02417_opentelemetry_insert_on_distributed_table: [ OK ] 3.08 sec. 2025-10-03 23:27:53 03013_addDays_with_timezone: [ OK ] 0.12 sec. 2025-10-03 23:27:53 02221_system_zookeeper_unrestricted_like: [ OK ] 1.62 sec. 2025-10-03 23:27:54 01068_parens: [ OK ] 0.12 sec. 2025-10-03 23:27:54 02499_extract_key_value_pairs_multiple_input: [ OK ] 0.47 sec. 2025-10-03 23:27:54 00943_mv_rename_without_inner_table: [ OK ] 0.22 sec. 2025-10-03 23:27:54 02113_base64encode_trailing_bytes_1: [ OK ] 0.12 sec. 2025-10-03 23:27:54 01451_dist_logs: [ OK ] 0.77 sec. 2025-10-03 23:27:54 02668_column_block_number_with_projections: [ OK ] 0.22 sec. 2025-10-03 23:27:54 02520_group_array_last: [ OK ] 0.37 sec. 2025-10-03 23:27:54 02122_parallel_formatting_JSONEachRow: [ OK ] 1.32 sec. 2025-10-03 23:27:54 02352_lightweight_delete_and_object_column: [ OK ] 0.22 sec. 2025-10-03 23:27:54 00818_join_bug_4271: [ OK ] 0.17 sec. 2025-10-03 23:27:54 02863_non_const_timezone_check: [ OK ] 0.22 sec. 2025-10-03 23:27:54 01719_join_timezone: [ OK ] 0.22 sec. 2025-10-03 23:27:54 00079_defaulted_columns: [ OK ] 0.37 sec. 2025-10-03 23:27:55 01852_cast_operator_3: [ OK ] 0.12 sec. 2025-10-03 23:27:55 01516_date_time_output_format: [ OK ] 0.27 sec. 2025-10-03 23:27:55 02575_merge_prewhere_ephemeral: [ OK ] 0.17 sec. 2025-10-03 23:27:55 02887_mutations_subcolumns: [ OK ] 0.42 sec. 2025-10-03 23:27:55 01825_type_json_ghdata_insert_select: [ OK ] 3.94 sec. 2025-10-03 23:27:55 01143_trivial_count_with_join: [ OK ] 0.17 sec. 2025-10-03 23:27:55 02507_to_unix_timestamp_overflow: [ OK ] 0.17 sec. 2025-10-03 23:27:55 02001_append_output_file: [ OK ] 0.52 sec. 2025-10-03 23:27:55 02503_bad_compatibility_setting: [ OK ] 0.17 sec. 2025-10-03 23:27:55 00706_iso_week_and_day_of_year: [ OK ] 0.17 sec. 2025-10-03 23:27:56 00977_int_div: [ OK ] 0.22 sec. 2025-10-03 23:27:56 01245_limit_infinite_sources: [ OK ] 0.92 sec. 2025-10-03 23:27:56 02875_final_invalid_read_ranges_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:56 00398_url_functions: [ OK ] 0.77 sec. 2025-10-03 23:27:56 01103_optimize_drop_race_zookeeper: [ OK ] 15.38 sec. 2025-10-03 23:27:56 02251_last_day_of_month: [ OK ] 0.17 sec. 2025-10-03 23:27:56 00390_array_sort: [ OK ] 0.32 sec. 2025-10-03 23:27:56 02596_build_set_and_remote: [ OK ] 0.32 sec. 2025-10-03 23:27:56 01714_alter_drop_version: [ OK ] 0.17 sec. 2025-10-03 23:27:56 02455_count_state_asterisk: [ OK ] 0.17 sec. 2025-10-03 23:27:56 02949_ttl_group_by_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:56 00938_fix_rwlock_segfault_long: [ OK ] 11.21 sec. 2025-10-03 23:27:57 01074_h3_range_check: [ OK ] 0.17 sec. 2025-10-03 23:27:57 02378_analyzer_projection_names: [ OK ] 1.02 sec. 2025-10-03 23:27:57 02269_to_start_of_interval_overflow: [ OK ] 0.12 sec. 2025-10-03 23:27:57 02042_map_get_non_const_key: [ OK ] 0.12 sec. 2025-10-03 23:27:57 02960_polygon_bound_bug: [ OK ] 0.57 sec. 2025-10-03 23:27:57 02891_input_csv_cr_end_of_line: [ OK ] 0.92 sec. 2025-10-03 23:27:57 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.37 sec. 2025-10-03 23:27:57 02384_analyzer_dict_get_join_get: [ OK ] 0.47 sec. 2025-10-03 23:27:58 02306_window_move_row_number_fix: [ OK ] 0.19 sec. 2025-10-03 23:27:58 02352_grouby_shadows_arg: [ OK ] 0.30 sec. 2025-10-03 23:27:58 03214_parsing_archive_name_file: [ OK ] 1.68 sec. 2025-10-03 23:27:58 03101_analyzer_identifiers_1: [ OK ] 0.34 sec. 2025-10-03 23:27:59 01025_array_compact_generic: [ OK ] 0.29 sec. 2025-10-03 23:27:59 01683_text_log_deadlock: [ OK ] 2.13 sec. 2025-10-03 23:27:59 01531_query_log_query_comment: [ OK ] 1.29 sec. 2025-10-03 23:27:59 03261_variant_permutation_bug: [ OK ] 0.17 sec. 2025-10-03 23:27:59 02136_scalar_progress: [ OK ] 0.32 sec. 2025-10-03 23:27:59 01601_custom_tld: [ OK ] 0.37 sec. 2025-10-03 23:27:59 01071_window_view_event_tumble_asc_join: [ OK ] 1.69 sec. 2025-10-03 23:27:59 00002_system_numbers: [ OK ] 0.17 sec. 2025-10-03 23:27:59 01225_drop_dictionary_as_table: [ OK ] 0.12 sec. 2025-10-03 23:27:59 02070_join_on_disk: [ OK ] 0.22 sec. 2025-10-03 23:27:59 02969_functions_to_subcolumns_if_null: [ OK ] 0.17 sec. 2025-10-03 23:27:59 01825_type_json_distributed: [ OK ] 0.17 sec. 2025-10-03 23:28:00 02785_summing_merge_tree_datetime64: [ OK ] 0.17 sec. 2025-10-03 23:28:00 02479_nullable_primary_key_non_first_column: [ OK ] 0.22 sec. 2025-10-03 23:28:00 01345_index_date_vs_datetime: [ OK ] 0.17 sec. 2025-10-03 23:28:00 02346_non_negative_derivative: [ OK ] 0.32 sec. 2025-10-03 23:28:00 01616_untuple_access_field: [ OK ] 0.12 sec. 2025-10-03 23:28:00 02955_avro_format_zstd_encode_support: [ OK ] 0.17 sec. 2025-10-03 23:28:00 02525_jit_logical_functions_nan: [ OK ] 0.17 sec. 2025-10-03 23:28:00 00526_array_join_with_arrays_of_nullable: [ OK ] 0.12 sec. 2025-10-03 23:28:01 02766_prql: [ OK ] 0.52 sec. 2025-10-03 23:28:01 00757_enum_defaults_const: [ OK ] 0.12 sec. 2025-10-03 23:28:01 02124_clickhouse_dictionary_with_predefined_configuration: [ OK ] 0.17 sec. 2025-10-03 23:28:01 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.17 sec. 2025-10-03 23:28:01 03006_parallel_replicas_cte_explain_syntax_crash: [ OK ] 0.17 sec. 2025-10-03 23:28:01 02031_format_query_option: [ OK ] 0.37 sec. 2025-10-03 23:28:02 00688_low_cardinality_nullable_cast: [ OK ] 0.17 sec. 2025-10-03 23:28:02 00726_modulo_for_date: [ OK ] 0.17 sec. 2025-10-03 23:28:02 02662_sparse_columns_mutations_1: [ OK ] 0.27 sec. 2025-10-03 23:28:02 01818_input_format_with_names_use_header: [ OK ] 0.72 sec. 2025-10-03 23:28:02 02100_alter_scalar_circular_deadlock: [ OK ] 0.22 sec. 2025-10-03 23:28:03 01892_setting_limit_offset_distributed: [ OK ] 0.17 sec. 2025-10-03 23:28:03 01415_sticking_mutations: [ OK ] 7.55 sec. 2025-10-03 23:28:03 02809_storage_set_analysis_bug: [ OK ] 0.22 sec. 2025-10-03 23:28:03 01284_view_and_extremes_bug: [ OK ] 0.17 sec. 2025-10-03 23:28:03 03037_dynamic_merges_small: [ OK ] 1.13 sec. 2025-10-03 23:28:03 02112_parse_date_yyyymmdd: [ OK ] 0.37 sec. 2025-10-03 23:28:04 00939_test_null_in: [ OK ] 0.17 sec. 2025-10-03 23:28:04 02995_index_5: [ OK ] 9.05 sec. 2025-10-03 23:28:04 01508_partition_pruning_long_1: [ OK ] 5.04 sec. 2025-10-03 23:28:04 03222_date_time_inference: [ OK ] 1.07 sec. 2025-10-03 23:28:05 02148_issue_32737: [ OK ] 0.57 sec. 2025-10-03 23:28:05 02013_json_function_null_column: [ OK ] 0.57 sec. 2025-10-03 23:28:05 00745_compile_scalar_subquery: [ OK ] 0.27 sec. 2025-10-03 23:28:05 00997_trim: [ OK ] 0.43 sec. 2025-10-03 23:28:05 02380_analyzer_join_sample: [ OK ] 0.22 sec. 2025-10-03 23:28:06 01184_long_insert_values_huge_strings: [ OK ] 2.14 sec. 2025-10-03 23:28:06 01848_http_insert_segfault: [ OK ] 0.88 sec. 2025-10-03 23:28:06 02662_first_last_value: [ OK ] 0.17 sec. 2025-10-03 23:28:07 02761_ddl_initial_query_id: [ OK ] 1.43 sec. 2025-10-03 23:28:07 00956_http_prepared_statements: [ OK ] 0.47 sec. 2025-10-03 23:28:07 01671_aggregate_function_group_bitmap_data: [ OK ] 0.22 sec. 2025-10-03 23:28:07 02955_sparkBar_alias_sparkbar: [ OK ] 0.17 sec. 2025-10-03 23:28:07 00358_from_string_complex_types: [ OK ] 0.12 sec. 2025-10-03 23:28:07 02124_insert_deduplication_token: [ OK ] 0.22 sec. 2025-10-03 23:28:07 00551_parse_or_null: [ OK ] 0.17 sec. 2025-10-03 23:28:07 02026_accurate_cast_or_default: [ OK ] 0.27 sec. 2025-10-03 23:28:08 02868_distinct_to_count_optimization: [ OK ] 0.37 sec. 2025-10-03 23:28:08 02995_index_6: [ OK ] 9.73 sec. 2025-10-03 23:28:08 01277_large_tuples: [ OK ] 0.17 sec. 2025-10-03 23:28:08 01597_columns_list_ignored: [ OK ] 0.47 sec. 2025-10-03 23:28:08 01035_avg_weighted_long: [ OK ] 2.13 sec. 2025-10-03 23:28:08 03033_lightweight_deletes_sync: [ OK ] 0.22 sec. 2025-10-03 23:28:08 02294_stringsearch_with_nonconst_needle: [ OK ] 0.37 sec. 2025-10-03 23:28:08 02513_broken_datetime64_init_on_mac: [ OK ] 0.12 sec. 2025-10-03 23:28:09 02595_orc_arrow_parquet_more_types: [ OK ] 0.82 sec. 2025-10-03 23:28:09 02706_arrow_different_dictionaries: [ OK ] 0.47 sec. 2025-10-03 23:28:09 01012_select_limit_x_0: [ OK ] 0.12 sec. 2025-10-03 23:28:09 01677_bit_float: [ OK ] 0.17 sec. 2025-10-03 23:28:09 01676_range_hashed_dictionary: [ OK ] 0.37 sec. 2025-10-03 23:28:09 02581_share_big_sets_between_mutation_tasks: [ OK ] 9.33 sec. 2025-10-03 23:28:09 00597_with_totals_on_empty_set: [ OK ] 0.17 sec. 2025-10-03 23:28:09 00880_decimal_in_key: [ OK ] 0.57 sec. 2025-10-03 23:28:09 02099_tsv_raw_format_1: [ OK ] 5.59 sec. 2025-10-03 23:28:09 03156_group_concat: [ OK ] 0.42 sec. 2025-10-03 23:28:09 00864_union_all_supertype: [ OK ] 0.17 sec. 2025-10-03 23:28:10 02354_vector_search_index_creation_negative: [ OK ] 0.52 sec. 2025-10-03 23:28:10 03161_lightweight_delete_projection: [ OK ] 0.22 sec. 2025-10-03 23:28:10 02731_in_operator_with_one_size_tuple: [ OK ] 0.17 sec. 2025-10-03 23:28:10 03203_variant_convert_field_to_type_bug: [ OK ] 0.12 sec. 2025-10-03 23:28:10 02685_bson2: [ OK ] 0.12 sec. 2025-10-03 23:28:10 00835_if_generic_case: [ OK ] 0.22 sec. 2025-10-03 23:28:10 01822_union_and_constans_error: [ OK ] 0.17 sec. 2025-10-03 23:28:10 01528_to_uuid_or_null_or_zero: [ OK ] 0.22 sec. 2025-10-03 23:28:10 00440_nulls_merge_tree: [ OK ] 0.17 sec. 2025-10-03 23:28:10 01825_new_type_json_insert_select: [ OK ] 0.37 sec. 2025-10-03 23:28:10 01922_sum_null_for_remote: [ OK ] 0.12 sec. 2025-10-03 23:28:10 02313_multiple_limits: [ OK ] 0.17 sec. 2025-10-03 23:28:10 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 2.58 sec. 2025-10-03 23:28:10 02724_persist_interval_type: [ OK ] 0.22 sec. 2025-10-03 23:28:11 02922_respect_nulls_extensive: [ OK ] 0.37 sec. 2025-10-03 23:28:11 01020_function_array_compact: [ OK ] 0.17 sec. 2025-10-03 23:28:11 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.17 sec. 2025-10-03 23:28:11 02125_lz4_compression_bug_CSV: [ OK ] 2.33 sec. 2025-10-03 23:28:11 02250_hints_for_columns: [ OK ] 0.87 sec. 2025-10-03 23:28:11 02985_if_over_big_int_decimal: [ OK ] 0.17 sec. 2025-10-03 23:28:11 01772_intdiv_minus_one_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:28:11 01413_alter_update_supertype: [ OK ] 0.17 sec. 2025-10-03 23:28:11 02457_csv_parse_date_out_of_range: [ OK ] 0.77 sec. 2025-10-03 23:28:11 00800_low_cardinality_distributed_insert: [ OK ] 0.17 sec. 2025-10-03 23:28:12 01104_distributed_numbers_test: [ OK ] 0.22 sec. 2025-10-03 23:28:12 01039_mergetree_exec_time: [ OK ] 1.17 sec. 2025-10-03 23:28:12 01318_map_add_map_subtract_on_map_type: [ OK ] 0.37 sec. 2025-10-03 23:28:12 02990_variant_where_cond: [ OK ] 0.17 sec. 2025-10-03 23:28:12 01509_dictionary_preallocate: [ OK ] 0.42 sec. 2025-10-03 23:28:12 01666_gcd_ubsan: [ OK ] 0.22 sec. 2025-10-03 23:28:12 02012_sha512_fixedstring: [ OK ] 0.17 sec. 2025-10-03 23:28:12 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.42 sec. 2025-10-03 23:28:12 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.12 sec. 2025-10-03 23:28:12 02521_cannot_find_column_in_projection: [ OK ] 0.17 sec. 2025-10-03 23:28:12 02155_default_keyword_format_values: [ OK ] 0.97 sec. 2025-10-03 23:28:12 02677_grace_hash_limit_race: [ OK ] 0.22 sec. 2025-10-03 23:28:12 01553_datetime64_comparison: [ OK ] 0.12 sec. 2025-10-03 23:28:12 02521_analyzer_array_join_crash: [ OK ] 0.22 sec. 2025-10-03 23:28:13 03217_fliter_pushdown_no_keys: [ OK ] 0.17 sec. 2025-10-03 23:28:13 00515_gcd_lcm: [ OK ] 0.27 sec. 2025-10-03 23:28:13 01383_log_broken_table: [ OK ] 9.96 sec. 2025-10-03 23:28:13 02242_if_then_else_null_bug: [ OK ] 0.13 sec. 2025-10-03 23:28:13 01000_unneeded_substitutions_client: [ OK ] 0.42 sec. 2025-10-03 23:28:13 02785_text_with_whitespace_tab_field_delimiter: [ OK ] 1.18 sec. 2025-10-03 23:28:13 00632_aggregation_window_funnel: [ OK ] 0.67 sec. 2025-10-03 23:28:13 01280_unicode_whitespaces_lexer: [ OK ] 0.12 sec. 2025-10-03 23:28:13 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.17 sec. 2025-10-03 23:28:13 01825_type_json_field: [ OK ] 0.22 sec. 2025-10-03 23:28:14 02563_progress_when_no_rows_from_prewhere: [ OK ] 0.42 sec. 2025-10-03 23:28:14 00532_topk_generic: [ OK ] 0.17 sec. 2025-10-03 23:28:14 01518_cast_nullable_virtual_system_column: [ OK ] 0.13 sec. 2025-10-03 23:28:14 01318_decrypt: [ OK ] 0.62 sec. 2025-10-03 23:28:14 03231_dynamic_incomplete_type_insert_bug: [ OK ] 0.17 sec. 2025-10-03 23:28:14 02535_json_bson_each_row_curl: [ OK ] 0.82 sec. 2025-10-03 23:28:14 01567_system_processes_current_database: [ OK ] 0.12 sec. 2025-10-03 23:28:14 01653_tuple_hamming_distance_2: [ OK ] 0.27 sec. 2025-10-03 23:28:14 00648_replacing_empty_set_from_prewhere: [ OK ] 0.18 sec. 2025-10-03 23:28:15 02699_polygons_sym_difference_rollup: [ OK ] 0.17 sec. 2025-10-03 23:28:15 00199_ternary_operator_type_check: [ OK ] 0.32 sec. 2025-10-03 23:28:15 00712_prewhere_with_sampling_and_alias: [ OK ] 0.17 sec. 2025-10-03 23:28:15 01016_simhash_minhash_ppc: [ SKIPPED ] 0.00 sec. 2025-10-03 23:28:15 Reason: not running for current build 2025-10-03 23:28:15 03165_parseReadableSize: [ OK ] 0.37 sec. 2025-10-03 23:28:15 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.17 sec. 2025-10-03 23:28:15 02536_distributed_detach_table: [ OK ] 0.22 sec. 2025-10-03 23:28:15 01866_split_by_regexp: [ OK ] 0.22 sec. 2025-10-03 23:28:15 01908_with_unknown_column: [ OK ] 0.12 sec. 2025-10-03 23:28:16 03146_asof_join_ddb_merge_long: [ OK ] 3.78 sec. 2025-10-03 23:28:16 02535_analyzer_limit_offset: [ OK ] 0.12 sec. 2025-10-03 23:28:16 02353_format_settings: [ OK ] 0.42 sec. 2025-10-03 23:28:16 02521_aggregation_by_partitions: [ OK ] 3.89 sec. 2025-10-03 23:28:16 01247_least_greatest_filimonov: [ OK ] 0.17 sec. 2025-10-03 23:28:16 01753_optimize_aggregation_in_order: [ OK ] 0.47 sec. 2025-10-03 23:28:16 03008_uniq_exact_equal_ranges: [ OK ] 1.37 sec. 2025-10-03 23:28:16 02454_create_table_with_custom_disk: [ OK ] 0.22 sec. 2025-10-03 23:28:16 01070_h3_get_base_cell: [ OK ] 0.12 sec. 2025-10-03 23:28:17 02514_null_dictionary_source: [ OK ] 0.17 sec. 2025-10-03 23:28:17 03041_select_with_query_result: [ OK ] 0.17 sec. 2025-10-03 23:28:17 02707_clickhouse_local_implicit_file_table_function: [ OK ] 0.93 sec. 2025-10-03 23:28:17 00664_cast_from_string_to_nullable: [ OK ] 0.17 sec. 2025-10-03 23:28:17 02921_file_engine_size_virtual_column: [ OK ] 0.72 sec. 2025-10-03 23:28:17 02965_projection_with_partition_pruning: [ OK ] 0.17 sec. 2025-10-03 23:28:17 01548_lzy305: [ OK ] 0.17 sec. 2025-10-03 23:28:17 03164_linestring_geometry: [ OK ] 0.12 sec. 2025-10-03 23:28:17 00266_shard_global_subquery_and_aliases: [ OK ] 0.17 sec. 2025-10-03 23:28:17 02209_short_circuit_node_without_parents: [ OK ] 0.12 sec. 2025-10-03 23:28:18 01069_materialized_view_alter_target_table: [ OK ] 0.22 sec. 2025-10-03 23:28:18 00704_drop_truncate_memory_table: [ OK ] 0.82 sec. 2025-10-03 23:28:18 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.12 sec. 2025-10-03 23:28:19 01035_enum_conversion_native_format: [ OK ] 1.28 sec. 2025-10-03 23:28:19 02015_async_inserts_6: [ OK ] 0.67 sec. 2025-10-03 23:28:19 03262_filter_push_down_view: [ OK ] 0.17 sec. 2025-10-03 23:28:19 00340_squashing_insert_select: [ OK ] 1.32 sec. 2025-10-03 23:28:19 03203_function_printf: [ OK ] 0.22 sec. 2025-10-03 23:28:19 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.32 sec. 2025-10-03 23:28:19 01660_join_or_all: [ OK ] 0.47 sec. 2025-10-03 23:28:19 02417_from_select_syntax: [ OK ] 0.12 sec. 2025-10-03 23:28:19 00696_system_columns_limit: [ OK ] 0.17 sec. 2025-10-03 23:28:20 00313_const_totals_extremes: [ OK ] 0.42 sec. 2025-10-03 23:28:20 01256_negative_generate_random: [ OK ] 0.13 sec. 2025-10-03 23:28:20 00800_low_cardinality_distinct_numeric: [ OK ] 0.17 sec. 2025-10-03 23:28:20 02232_functions_to_subcolumns_alias: [ OK ] 0.17 sec. 2025-10-03 23:28:20 01934_constexpr_aggregate_function_parameters: [ OK ] 0.17 sec. 2025-10-03 23:28:20 01060_defaults_all_columns: [ OK ] 0.17 sec. 2025-10-03 23:28:20 01720_engine_file_empty_if_not_exists: [ OK ] 0.17 sec. 2025-10-03 23:28:20 02679_explain_merge_tree_prewhere_row_policy: [ OK ] 0.17 sec. 2025-10-03 23:28:20 01083_aggregation_memory_efficient_bug: [ OK ] 0.27 sec. 2025-10-03 23:28:20 00555_hasSubstr: [ OK ] 0.22 sec. 2025-10-03 23:28:20 02416_row_policy_always_false_index: [ OK ] 0.17 sec. 2025-10-03 23:28:20 02513_csv_bool_allow_crlf: [ OK ] 0.42 sec. 2025-10-03 23:28:20 02818_parameterized_view_with_cte_multiple_usage: [ OK ] 0.17 sec. 2025-10-03 23:28:20 01497_alias_on_default_array: [ OK ] 0.17 sec. 2025-10-03 23:28:21 02670_constant_skip_index: [ OK ] 0.17 sec. 2025-10-03 23:28:21 01665_running_difference_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:28:21 02835_fuzz_remove_redundant_sorting: [ OK ] 0.17 sec. 2025-10-03 23:28:21 00371_union_all: [ OK ] 0.17 sec. 2025-10-03 23:28:21 01050_window_view_parser_tumble: [ OK ] 0.37 sec. 2025-10-03 23:28:21 03009_format_show_database: [ OK ] 0.52 sec. 2025-10-03 23:28:21 01070_alter_with_ttl: [ OK ] 0.17 sec. 2025-10-03 23:28:21 02367_join_pushdown_column_not_found: [ OK ] 0.17 sec. 2025-10-03 23:28:22 02441_alter_delete_and_drop_column: [ OK ] 0.42 sec. 2025-10-03 23:28:22 02479_mysql_connect_to_self: [ OK ] 0.47 sec. 2025-10-03 23:28:22 01137_sample_final: [ OK ] 0.17 sec. 2025-10-03 23:28:23 02210_append_to_dev_dull: [ OK ] 0.17 sec. 2025-10-03 23:28:23 00700_decimal_math: [ OK ] 0.32 sec. 2025-10-03 23:28:24 01583_const_column_in_set_index: [ OK ] 0.45 sec. 2025-10-03 23:28:24 00377_shard_group_uniq_array_of_string_array: [ OK ] 3.49 sec. 2025-10-03 23:28:24 03036_dynamic_read_subcolumns_compact_merge_tree: [ OK ] 2.53 sec. 2025-10-03 23:28:24 00118_storage_join: [ OK ] 0.22 sec. 2025-10-03 23:28:24 01458_count_digits: [ OK ] 0.17 sec. 2025-10-03 23:28:24 01044_great_circle_angle: [ OK ] 0.17 sec. 2025-10-03 23:28:24 02015_order_by_with_fill_misoptimization: [ OK ] 0.12 sec. 2025-10-03 23:28:24 02746_index_analysis_binary_operator_with_null: [ OK ] 0.12 sec. 2025-10-03 23:28:24 00008_array_join: [ OK ] 0.12 sec. 2025-10-03 23:28:25 02786_transform_float: [ OK ] 0.12 sec. 2025-10-03 23:28:25 00973_create_table_as_table_function: [ OK ] 0.22 sec. 2025-10-03 23:28:25 02943_variant_type_with_different_local_and_global_order: [ OK ] 10.02 sec. 2025-10-03 23:28:25 00599_create_view_with_subquery: [ OK ] 0.17 sec. 2025-10-03 23:28:25 02806_cte_block_cannot_be_empty: [ OK ] 0.12 sec. 2025-10-03 23:28:25 02800_transform_alter: [ OK ] 0.22 sec. 2025-10-03 23:28:25 00486_if_fixed_string: [ OK ] 0.22 sec. 2025-10-03 23:28:25 02562_with_fill_nullable: [ OK ] 0.12 sec. 2025-10-03 23:28:26 03206_json_parsing_and_formatting: [ OK ] 1.95 sec. 2025-10-03 23:28:26 01942_dateTimeToSnowflakeID: [ OK ] 0.27 sec. 2025-10-03 23:28:26 00900_null_array_orc_load: [ OK ] 0.82 sec. 2025-10-03 23:28:26 02534_s3_heap_use_after_free: [ OK ] 0.17 sec. 2025-10-03 23:28:26 00944_clear_index_in_partition: [ OK ] 1.52 sec. 2025-10-03 23:28:26 02132_client_history_navigation: [ OK ] 0.47 sec. 2025-10-03 23:28:26 01047_nullable_rand: [ OK ] 0.17 sec. 2025-10-03 23:28:26 02482_value_block_assert: [ OK ] 0.17 sec. 2025-10-03 23:28:26 01144_multiword_data_types: [ OK ] 0.17 sec. 2025-10-03 23:28:27 01907_multiple_aliases: [ OK ] 0.17 sec. 2025-10-03 23:28:27 02531_ipv4_arithmetic: [ OK ] 0.17 sec. 2025-10-03 23:28:27 00635_shard_distinct_order_by: [ OK ] 0.17 sec. 2025-10-03 23:28:27 02013_emptystring_cast: [ OK ] 0.22 sec. 2025-10-03 23:28:27 01568_window_functions_distributed: [ OK ] 0.32 sec. 2025-10-03 23:28:27 00937_test_use_header_csv: [ OK ] 2.03 sec. 2025-10-03 23:28:27 02554_format_json_columns_for_empty: [ OK ] 0.17 sec. 2025-10-03 23:28:27 03203_count_with_non_deterministic_function: [ OK ] 0.17 sec. 2025-10-03 23:28:28 02192_comment: [ OK ] 0.17 sec. 2025-10-03 23:28:28 00900_parquet_time_to_ch_date_time: [ OK ] 0.72 sec. 2025-10-03 23:28:28 01801_dateDiff_DateTime64: [ OK ] 0.32 sec. 2025-10-03 23:28:28 01069_set_in_group_by: [ OK ] 0.17 sec. 2025-10-03 23:28:28 01932_null_valid_identifier: [ OK ] 0.17 sec. 2025-10-03 23:28:37 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 8.41 sec. 2025-10-03 23:28:37 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.70 sec. 2025-10-03 23:28:37 00546_shard_tuple_element_formatting: [ OK ] 0.17 sec. 2025-10-03 23:28:37 00958_format_of_tuple_array_element: [ OK ] 0.37 sec. 2025-10-03 23:28:38 01825_new_type_json_ghdata_insert_select: [ OK ] 10.86 sec. 2025-10-03 23:28:38 01533_distinct_nullable_uuid: [ OK ] 0.37 sec. 2025-10-03 23:28:38 02933_paste_join: [ OK ] 0.42 sec. 2025-10-03 23:28:38 02175_distributed_join_current_database: [ OK ] 0.22 sec. 2025-10-03 23:28:38 01732_union_and_union_all: [ OK ] 0.12 sec. 2025-10-03 23:28:38 01821_join_table_race_long: [ OK ] 1.78 sec. 2025-10-03 23:28:40 01293_optimize_final_force: [ OK ] 30.25 sec. 2025-10-03 23:28:40 02531_two_level_aggregation_bug: [ OK ] 1.38 sec. 2025-10-03 23:28:40 02988_ordinary_database_warning: [ OK ] 0.12 sec. 2025-10-03 23:28:40 02041_test_fuzzy_alter: [ OK ] 0.17 sec. 2025-10-03 23:28:40 01537_fuzz_count_equal: [ OK ] 0.12 sec. 2025-10-03 23:28:40 03169_modify_column_data_loss: [ OK ] 0.22 sec. 2025-10-03 23:28:40 00349_visible_width: [ OK ] 0.12 sec. 2025-10-03 23:28:40 00461_default_value_of_argument_type: [ OK ] 0.12 sec. 2025-10-03 23:28:40 00038_totals_limit: [ OK ] 0.12 sec. 2025-10-03 23:28:41 02050_clickhouse_local_parsing_exception: [ OK ] 0.42 sec. 2025-10-03 23:28:41 00881_unknown_identifier_in_in: [ OK ] 0.12 sec. 2025-10-03 23:28:41 02503_join_switch_alias_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:28:41 02039_group_by_with_totals_having: [ OK ] 0.12 sec. 2025-10-03 23:28:41 02714_date_date32_in: [ OK ] 0.12 sec. 2025-10-03 23:28:41 01680_date_time_add_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:28:41 03249_dynamic_alter_consistency: [ OK ] 0.57 sec. 2025-10-03 23:28:42 02366_kql_func_ip: [ OK ] 0.87 sec. 2025-10-03 23:28:42 00959_format_with_different_aliases: [ OK ] 0.37 sec. 2025-10-03 23:28:42 01813_quantileBfloat16_nans: [ OK ] 0.12 sec. 2025-10-03 23:28:42 03003_sql_json_nonsense: [ OK ] 0.12 sec. 2025-10-03 23:28:42 01260_ubsan_decimal_parse: [ OK ] 0.12 sec. 2025-10-03 23:28:42 02273_full_sort_join: [ OK ] 4.84 sec. 2025-10-03 23:28:42 03039_dynamic_replacing_merge_tree: [ OK ] 4.03 sec. 2025-10-03 23:28:42 01746_lc_values_format_bug: [ OK ] 0.17 sec. 2025-10-03 23:28:43 00300_csv: [ OK ] 0.17 sec. 2025-10-03 23:28:43 02950_reading_array_tuple_subcolumns: [ OK ] 0.37 sec. 2025-10-03 23:28:43 03045_analyzer_alias_join_with_if: [ OK ] 0.17 sec. 2025-10-03 23:28:43 00956_join_use_nulls_with_array_column: [ OK ] 0.12 sec. 2025-10-03 23:28:43 01076_json_each_row_array: [ OK ] 0.62 sec. 2025-10-03 23:28:43 02901_remove_nullable_crash_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:28:43 00405_output_format_pretty_color: [ OK ] 0.22 sec. 2025-10-03 23:28:43 00198_group_by_empty_arrays: [ OK ] 0.17 sec. 2025-10-03 23:28:43 01470_explain: [ OK ] 0.12 sec. 2025-10-03 23:28:44 02100_multiple_hosts_command_line_set_ssl: [ OK ] 30.89 sec. 2025-10-03 23:28:44 02974_backup_query_format_null: [ OK ] 0.77 sec. 2025-10-03 23:28:44 02530_dictionaries_update_field: [ OK ] 64.23 sec. 2025-10-03 23:28:44 01852_map_combinator: [ OK ] 0.37 sec. 2025-10-03 23:28:45 03210_inconsistent_formatting_of_data_types: [ OK ] 0.62 sec. 2025-10-03 23:28:45 02248_nullable_custom_types_to_string: [ OK ] 0.12 sec. 2025-10-03 23:28:45 01509_check_parallel_quorum_inserts_long: [ OK ] 1.07 sec. 2025-10-03 23:28:46 03003_prql_panic: [ OK ] 0.42 sec. 2025-10-03 23:28:46 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.17 sec. 2025-10-03 23:28:46 00483_cast_syntax: [ OK ] 0.12 sec. 2025-10-03 23:28:46 02149_external_schema_inference: [ OK ] 2.68 sec. 2025-10-03 23:28:46 03172_http_content_encoding: [ OK ] 2.03 sec. 2025-10-03 23:28:46 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.37 sec. 2025-10-03 23:28:46 01123_parse_date_time_best_effort_even_more: [ OK ] 0.12 sec. 2025-10-03 23:28:46 00944_minmax_null: [ OK ] 0.22 sec. 2025-10-03 23:28:46 02752_forbidden_headers: [ OK ] 0.42 sec. 2025-10-03 23:28:46 01328_bad_peephole_optimization: [ OK ] 0.12 sec. 2025-10-03 23:28:46 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.22 sec. 2025-10-03 23:28:47 01533_collate_in_nullable: [ OK ] 0.17 sec. 2025-10-03 23:28:47 02995_index_10: [ OK ] 3.54 sec. 2025-10-03 23:28:47 00482_subqueries_and_aliases: [ OK ] 0.17 sec. 2025-10-03 23:28:47 00261_storage_aliases_and_array_join: [ OK ] 0.57 sec. 2025-10-03 23:28:47 02841_local_assert: [ OK ] 0.52 sec. 2025-10-03 23:28:47 02525_analyzer_function_in_crash_fix: [ OK ] 0.17 sec. 2025-10-03 23:28:47 01210_drop_view: [ OK ] 0.17 sec. 2025-10-03 23:28:47 01651_map_functions: [ OK ] 0.47 sec. 2025-10-03 23:28:47 00464_sort_all_constant_columns: [ OK ] 0.12 sec. 2025-10-03 23:28:47 02125_low_cardinality_int256: [ OK ] 0.12 sec. 2025-10-03 23:28:47 02386_analyzer_in_function_nested_subqueries: [ OK ] 0.12 sec. 2025-10-03 23:28:47 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.12 sec. 2025-10-03 23:28:47 02494_query_cache_empty_tuple: [ OK ] 0.17 sec. 2025-10-03 23:28:48 03168_fuzz_multiIf_short_circuit: [ OK ] 0.12 sec. 2025-10-03 23:28:48 01710_projection_with_mixed_pipeline: [ OK ] 0.22 sec. 2025-10-03 23:28:48 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.12 sec. 2025-10-03 23:28:48 02326_settings_changes_system_table: [ OK ] 0.12 sec. 2025-10-03 23:28:48 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 2.13 sec. 2025-10-03 23:28:48 00823_sequence_match_dfa: [ OK ] 0.42 sec. 2025-10-03 23:28:48 03033_create_as_copies_comment: [ OK ] 0.17 sec. 2025-10-03 23:28:48 01410_full_join_and_null_predicates: [ OK ] 0.32 sec. 2025-10-03 23:28:48 02502_bad_values_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:28:48 01318_alter_add_column_exists: [ OK ] 0.17 sec. 2025-10-03 23:28:48 02477_single_value_data_string_regression: [ OK ] 0.47 sec. 2025-10-03 23:28:48 02803_remote_cannot_clone_block: [ OK ] 0.17 sec. 2025-10-03 23:28:49 02998_to_milliseconds: [ OK ] 0.22 sec. 2025-10-03 23:28:49 00177_inserts_through_http_parts: [ OK ] 0.42 sec. 2025-10-03 23:28:49 01565_query_loop_after_client_error: [ OK ] 0.42 sec. 2025-10-03 23:28:49 02421_explain_subquery: [ OK ] 0.32 sec. 2025-10-03 23:28:49 00763_lock_buffer_long: [ OK ] 22.21 sec. 2025-10-03 23:28:49 01461_alter_table_function: [ OK ] 0.22 sec. 2025-10-03 23:28:50 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.12 sec. 2025-10-03 23:28:50 02891_array_shingles: [ OK ] 0.27 sec. 2025-10-03 23:28:50 01097_cyclic_defaults: [ OK ] 0.22 sec. 2025-10-03 23:28:50 00794_materialized_view_with_column_defaults: [ OK ] 0.22 sec. 2025-10-03 23:28:50 02816_has_token_empty: [ OK ] 0.17 sec. 2025-10-03 23:28:50 01659_h3_buffer_overflow: [ OK ] 0.22 sec. 2025-10-03 23:28:50 03069_analyzer_with_alias_in_array_join: [ OK ] 0.12 sec. 2025-10-03 23:28:50 02207_s3_content_type: [ OK ] 1.17 sec. 2025-10-03 23:28:51 00059_shard_global_in: [ OK ] 0.17 sec. 2025-10-03 23:28:51 03151_analyzer_view_read_only_necessary_columns: [ OK ] 0.17 sec. 2025-10-03 23:28:51 02420_stracktrace_debug_symbols: [ OK ] 0.47 sec. 2025-10-03 23:28:51 00952_input_function: [ OK ] 3.23 sec. 2025-10-03 23:28:51 02701_non_parametric_function: [ OK ] 0.12 sec. 2025-10-03 23:28:51 01926_date_date_time_supertype: [ OK ] 0.22 sec. 2025-10-03 23:28:52 02473_optimize_old_parts: [ OK ] 35.16 sec. 2025-10-03 23:28:52 01485_256_bit_multiply: [ OK ] 0.47 sec. 2025-10-03 23:28:52 01768_array_product: [ OK ] 0.27 sec. 2025-10-03 23:28:52 02536_date_from_number_inference_fix: [ OK ] 0.17 sec. 2025-10-03 23:28:52 01471_with_format: [ OK ] 0.12 sec. 2025-10-03 23:28:52 00800_low_cardinality_empty_array: [ OK ] 0.17 sec. 2025-10-03 23:28:52 02916_replication_protocol_wait_for_part: [ OK ] 10.37 sec. 2025-10-03 23:28:52 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 2.33 sec. 2025-10-03 23:28:52 02501_limits_on_result_for_view: [ OK ] 0.22 sec. 2025-10-03 23:28:52 02250_insert_select_from_file_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:28:52 03095_merge_and_buffer_tables: [ OK ] 0.22 sec. 2025-10-03 23:28:52 01414_mutations_and_errors: [ OK ] 0.22 sec. 2025-10-03 23:28:52 02158_ztest: [ OK ] 0.17 sec. 2025-10-03 23:28:53 03058_analyzer_ambiguous_columns: [ OK ] 0.22 sec. 2025-10-03 23:28:53 02493_analyzer_uniq_injective_functions_elimination: [ OK ] 0.17 sec. 2025-10-03 23:28:53 00495_reading_const_zero_column: [ OK ] 0.17 sec. 2025-10-03 23:28:53 02989_group_by_tuple: [ OK ] 0.12 sec. 2025-10-03 23:28:53 02893_system_drop_schema_cache_format: [ OK ] 0.12 sec. 2025-10-03 23:28:53 02026_arrayDifference_const: [ OK ] 0.12 sec. 2025-10-03 23:28:53 02249_parse_date_time_basic: [ OK ] 0.17 sec. 2025-10-03 23:28:53 00688_aggregation_retention: [ OK ] 0.22 sec. 2025-10-03 23:28:53 02474_extract_fixedstring_from_json: [ OK ] 0.17 sec. 2025-10-03 23:28:53 02286_tuple_numeric_identifier: [ OK ] 0.22 sec. 2025-10-03 23:28:53 00575_merge_and_index_with_function_in_in: [ OK ] 0.17 sec. 2025-10-03 23:28:53 01948_heredoc: [ OK ] 0.17 sec. 2025-10-03 23:28:54 03037_dynamic_merges_1_vertical_wide_merge_tree: [ OK ] 2.78 sec. 2025-10-03 23:28:54 01773_case_sensitive_revision: [ OK ] 0.12 sec. 2025-10-03 23:28:54 02012_zookeeper_changed_enum_type_incompatible: [ OK ] 1.22 sec. 2025-10-03 23:28:54 01605_skip_idx_compact_parts: [ OK ] 0.24 sec. 2025-10-03 23:28:54 02751_multiif_to_if_crash: [ OK ] 0.12 sec. 2025-10-03 23:28:54 02735_array_map_array_of_tuples: [ OK ] 0.12 sec. 2025-10-03 23:28:54 01855_jit_comparison_constant_result: [ OK ] 0.22 sec. 2025-10-03 23:28:54 03271_decimal_monotonic_day_of_week: [ OK ] 0.18 sec. 2025-10-03 23:28:54 00583_limit_by_expressions: [ OK ] 0.17 sec. 2025-10-03 23:28:54 00342_escape_sequences: [ OK ] 0.12 sec. 2025-10-03 23:28:54 01544_file_engine_settings: [ OK ] 0.52 sec. 2025-10-03 23:28:54 02155_read_in_order_max_rows_to_read: [ OK ] 0.17 sec. 2025-10-03 23:28:54 01560_optimize_on_insert_long: [ OK ] 0.32 sec. 2025-10-03 23:28:54 01107_join_right_table_totals: [ OK ] 0.32 sec. 2025-10-03 23:28:54 00863_comma_join_in: [ OK ] 0.22 sec. 2025-10-03 23:28:54 02888_single_state_nullable_type: [ OK ] 0.12 sec. 2025-10-03 23:28:54 03168_inconsistent_ast_formatting: [ OK ] 0.12 sec. 2025-10-03 23:28:54 01677_array_enumerate_bug: [ OK ] 0.12 sec. 2025-10-03 23:28:54 00409_shard_limit_by: [ OK ] 0.27 sec. 2025-10-03 23:28:55 00462_json_true_false_literals: [ OK ] 0.17 sec. 2025-10-03 23:28:55 02552_sparse_columns_intersect: [ OK ] 0.17 sec. 2025-10-03 23:28:55 00725_quantiles_shard: [ OK ] 0.17 sec. 2025-10-03 23:28:55 02661_quantile_approx: [ OK ] 0.37 sec. 2025-10-03 23:28:55 02095_function_get_os_kernel_version: [ OK ] 0.12 sec. 2025-10-03 23:28:55 01099_operators_date_and_timestamp: [ OK ] 0.47 sec. 2025-10-03 23:28:55 02457_insert_select_progress_http: [ OK ] 0.37 sec. 2025-10-03 23:28:56 00411_long_accurate_number_comparison_int4: [ OK ] 2.73 sec. 2025-10-03 23:28:56 00688_low_cardinality_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:28:56 02116_tuple_element_analyzer: [ OK ] 0.27 sec. 2025-10-03 23:28:56 01891_jit_aggregation_function_any_long: [ OK ] 0.67 sec. 2025-10-03 23:28:56 00987_distributed_stack_overflow: [ OK ] 0.12 sec. 2025-10-03 23:28:56 03002_map_array_functions_with_low_cardinality: [ OK ] 0.12 sec. 2025-10-03 23:28:56 03002_modify_query_cte: [ OK ] 0.18 sec. 2025-10-03 23:28:57 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.17 sec. 2025-10-03 23:28:57 00301_csv: [ OK ] 2.28 sec. 2025-10-03 23:28:57 00700_decimal_complex_types: [ OK ] 0.82 sec. 2025-10-03 23:28:58 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 1.47 sec. 2025-10-03 23:28:58 00902_entropy: [ OK ] 0.22 sec. 2025-10-03 23:28:58 02532_analyzer_aggregation_with_rollup: [ OK ] 0.12 sec. 2025-10-03 23:28:58 01710_order_by_projections_incomplete: [ OK ] 0.22 sec. 2025-10-03 23:28:58 03130_nested_type: [ OK ] 0.42 sec. 2025-10-03 23:28:59 02661_read_from_archive_zip: [ OK ] 4.04 sec. 2025-10-03 23:28:59 03212_thousand_exceptions: [ OK ] 7.49 sec. 2025-10-03 23:28:59 01949_heredoc_unfinished: [ OK ] 0.37 sec. 2025-10-03 23:28:59 01755_shard_pruning_with_literal: [ OK ] 0.17 sec. 2025-10-03 23:28:59 01146_clickhouse_local_data: [ OK ] 0.57 sec. 2025-10-03 23:28:59 03202_dynamic_null_map_subcolumn: [ OK ] 0.72 sec. 2025-10-03 23:28:59 02579_parameterized_replace: [ OK ] 0.12 sec. 2025-10-03 23:28:59 01825_new_type_json_distributed: [ OK ] 0.22 sec. 2025-10-03 23:29:00 02884_parquet_new_encodings: [ OK ] 0.42 sec. 2025-10-03 23:29:00 03094_recursive_type_proto: [ OK ] 0.47 sec. 2025-10-03 23:29:00 00837_insert_select_and_read_prefix: [ OK ] 0.17 sec. 2025-10-03 23:29:00 02387_analyzer_cte: [ OK ] 0.17 sec. 2025-10-03 23:29:00 02476_fix_lambda_parsing: [ OK ] 0.42 sec. 2025-10-03 23:29:00 03203_client_benchmark_options: [ OK ] 5.04 sec. 2025-10-03 23:29:00 01739_index_hint: [ OK ] 0.32 sec. 2025-10-03 23:29:00 00043_summing_empty_part: [ OK ] 0.22 sec. 2025-10-03 23:29:00 00983_summing_merge_tree_not_an_identifier: [ OK ] 0.12 sec. 2025-10-03 23:29:02 02500_numbers_inference: [ OK ] 2.09 sec. 2025-10-03 23:29:02 01505_log_distributed_deadlock: [ OK ] 0.17 sec. 2025-10-03 23:29:02 00933_ttl_replicated_zookeeper: [ OK ] 1.83 sec. 2025-10-03 23:29:02 02553_new_type_json_attach_partition: [ OK ] 0.22 sec. 2025-10-03 23:29:02 00898_quantile_timing_parameter_check: [ OK ] 0.12 sec. 2025-10-03 23:29:02 02835_drop_user_during_session: [ OK ] 4.33 sec. 2025-10-03 23:29:02 02418_keeper_map_keys_limit: [ OK ] 0.27 sec. 2025-10-03 23:29:02 00112_shard_totals_after_having: [ OK ] 0.17 sec. 2025-10-03 23:29:02 02731_formats_s3: [ OK ] 0.22 sec. 2025-10-03 23:29:03 02983_empty_map: [ OK ] 0.38 sec. 2025-10-03 23:29:03 01825_type_json_10: [ OK ] 0.17 sec. 2025-10-03 23:29:03 02468_has_any_tuple: [ OK ] 0.17 sec. 2025-10-03 23:29:03 02513_date_string_comparison: [ OK ] 0.47 sec. 2025-10-03 23:29:03 02872_prewhere_filter: [ OK ] 0.17 sec. 2025-10-03 23:29:03 01417_update_permutation_crash: [ OK ] 0.17 sec. 2025-10-03 23:29:03 02538_analyzer_create_table_as_select: [ OK ] 0.22 sec. 2025-10-03 23:29:03 03036_prewhere_lambda_function: [ OK ] 0.17 sec. 2025-10-03 23:29:03 01128_generate_random_nested: [ OK ] 0.37 sec. 2025-10-03 23:29:03 02206_array_starts_ends_with: [ OK ] 0.22 sec. 2025-10-03 23:29:03 02810_initcap: [ OK ] 0.17 sec. 2025-10-03 23:29:03 01943_log_column_sizes: [ OK ] 0.22 sec. 2025-10-03 23:29:04 01141_join_get_negative: [ OK ] 0.17 sec. 2025-10-03 23:29:04 00623_truncate_all_tables: [ OK ] 0.37 sec. 2025-10-03 23:29:04 03143_benchmark_query_id_prefix: [ OK ] 0.83 sec. 2025-10-03 23:29:04 02679_query_parameters_dangling_pointer: [ OK ] 0.12 sec. 2025-10-03 23:29:04 01413_allow_non_metadata_alters: [ OK ] 0.22 sec. 2025-10-03 23:29:04 01797_StripeLog_rwlock_ub: [ OK ] 0.17 sec. 2025-10-03 23:29:05 02815_empty_subquery_nullable_bug: [ OK ] 0.17 sec. 2025-10-03 23:29:05 03321_join_on_is_null_lowcardinality: [ OK ] 0.17 sec. 2025-10-03 23:29:05 01891_not_like_partition_prune: [ OK ] 0.17 sec. 2025-10-03 23:29:05 01660_join_or_any: [ OK ] 0.42 sec. 2025-10-03 23:29:05 02345_create_table_allow_trailing_comma: [ OK ] 0.22 sec. 2025-10-03 23:29:05 02362_part_log_merge_algorithm: [ OK ] 0.32 sec. 2025-10-03 23:29:06 00133_long_shard_memory_tracker_and_exception_safety: [ OK ] 5.31 sec. 2025-10-03 23:29:06 02493_numeric_literals_with_underscores: [ OK ] 0.52 sec. 2025-10-03 23:29:06 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:29:07 02103_with_names_and_types_parallel_parsing: [ OK ] 1.83 sec. 2025-10-03 23:29:07 02811_invalid_embedded_rocksdb_create: [ OK ] 0.12 sec. 2025-10-03 23:29:07 01086_window_view_cleanup: [ OK ] 3.48 sec. 2025-10-03 23:29:07 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 20.51 sec. 2025-10-03 23:29:07 02023_parser_number_binary_literal: [ OK ] 0.17 sec. 2025-10-03 23:29:07 01825_type_json_describe: [ OK ] 0.17 sec. 2025-10-03 23:29:07 02915_sleep_large_uint: [ OK ] 0.17 sec. 2025-10-03 23:29:07 02982_unambiguous_alter_commands: [ OK ] 0.18 sec. 2025-10-03 23:29:07 02941_variant_type_3: [ OK ] 7.04 sec. 2025-10-03 23:29:07 00625_summing_merge_tree_merge: [ OK ] 0.87 sec. 2025-10-03 23:29:07 01780_column_sparse: [ OK ] 0.27 sec. 2025-10-03 23:29:07 02919_alter_temporary_table_with_nondefault_engine: [ OK ] 0.17 sec. 2025-10-03 23:29:08 01135_default_and_alter_zookeeper: [ OK ] 0.22 sec. 2025-10-03 23:29:08 02946_parallel_replicas_distributed: [ OK ] 0.17 sec. 2025-10-03 23:29:08 02533_generate_random_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:29:08 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.17 sec. 2025-10-03 23:29:08 01164_detach_attach_partition_race: [ OK ] 10.78 sec. 2025-10-03 23:29:08 01821_join_table_mutation: [ OK ] 0.22 sec. 2025-10-03 23:29:08 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.27 sec. 2025-10-03 23:29:08 00116_storage_set: [ OK ] 0.22 sec. 2025-10-03 23:29:08 01321_aggregate_functions_of_group_by_keys: [ OK ] 0.62 sec. 2025-10-03 23:29:08 02000_table_function_cluster_macros: [ OK ] 0.12 sec. 2025-10-03 23:29:08 02764_index_analysis_fix: [ OK ] 0.17 sec. 2025-10-03 23:29:08 00401_merge_and_stripelog: [ OK ] 0.47 sec. 2025-10-03 23:29:08 02992_all_columns_should_have_comment: [ OK ] 0.27 sec. 2025-10-03 23:29:08 01778_test_LowCardinality_FixedString_pk: [ OK ] 0.17 sec. 2025-10-03 23:29:08 00850_global_join_dups: [ OK ] 0.37 sec. 2025-10-03 23:29:08 01300_group_by_other_keys: [ OK ] 0.92 sec. 2025-10-03 23:29:09 00211_shard_query_formatting_aliases: [ OK ] 0.17 sec. 2025-10-03 23:29:09 02154_bitmap_contains: [ OK ] 0.12 sec. 2025-10-03 23:29:09 01433_hex_float: [ OK ] 0.12 sec. 2025-10-03 23:29:09 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:29:09 00140_parse_unix_timestamp_as_datetime: [ OK ] 0.22 sec. 2025-10-03 23:29:09 00282_merging: [ OK ] 0.52 sec. 2025-10-03 23:29:09 01946_tskv: [ OK ] 0.77 sec. 2025-10-03 23:29:09 03101_analyzer_invalid_join_on: [ OK ] 0.22 sec. 2025-10-03 23:29:09 00965_set_index_string_functions: [ OK ] 1.47 sec. 2025-10-03 23:29:09 02536_delta_gorilla_corruption: [ OK ] 0.47 sec. 2025-10-03 23:29:09 01780_column_sparse_filter: [ OK ] 0.22 sec. 2025-10-03 23:29:09 00932_geohash_support: [ OK ] 0.27 sec. 2025-10-03 23:29:09 01396_negative_datetime_saturate_to_zero: [ OK ] 0.12 sec. 2025-10-03 23:29:09 03032_variant_bool_number_not_suspicious: [ OK ] 0.12 sec. 2025-10-03 23:29:10 02918_analyzer_to_ast_crash: [ OK ] 0.12 sec. 2025-10-03 23:29:10 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.37 sec. 2025-10-03 23:29:10 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.37 sec. 2025-10-03 23:29:10 01655_test_isnull_mysql_dialect: [ OK ] 0.17 sec. 2025-10-03 23:29:10 01016_uniqCombined64: [ OK ] 0.37 sec. 2025-10-03 23:29:10 01585_use_index_for_global_in_with_null: [ OK ] 0.32 sec. 2025-10-03 23:29:10 00563_complex_in_expression: [ OK ] 0.22 sec. 2025-10-03 23:29:10 00189_time_zones_long: [ OK ] 1.33 sec. 2025-10-03 23:29:10 02950_part_log_bytes_uncompressed: [ OK ] 0.27 sec. 2025-10-03 23:29:10 01163_search_case_insensetive_utf8: [ OK ] 0.17 sec. 2025-10-03 23:29:10 01942_create_table_with_sample: [ OK ] 0.17 sec. 2025-10-03 23:29:10 03078_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.17 sec. 2025-10-03 23:29:10 00916_add_materialized_column_after: [ OK ] 0.17 sec. 2025-10-03 23:29:10 02181_dictionary_attach_detach: [ OK ] 0.22 sec. 2025-10-03 23:29:10 01016_index_tuple_field_type: [ OK ] 0.22 sec. 2025-10-03 23:29:11 01927_query_views_log_current_database: [ OK ] 0.52 sec. 2025-10-03 23:29:11 02540_date_column_consistent_insert_behaviour: [ OK ] 0.42 sec. 2025-10-03 23:29:11 02317_distinct_in_order_optimization: [ OK ] 0.83 sec. 2025-10-03 23:29:11 01058_zlib_ng_level1_bug: [ OK ] 2.13 sec. 2025-10-03 23:29:11 01430_moving_sum_empty_state: [ OK ] 0.17 sec. 2025-10-03 23:29:11 02997_fix_datetime64_scale_conversion: [ OK ] 0.87 sec. 2025-10-03 23:29:11 01492_format_readable_quantity: [ OK ] 0.12 sec. 2025-10-03 23:29:11 03072_analyzer_missing_columns_from_subquery: [ OK ] 0.12 sec. 2025-10-03 23:29:11 01051_random_printable_ascii: [ OK ] 0.12 sec. 2025-10-03 23:29:11 02012_low_cardinality_uuid_with_extremes: [ OK ] 0.27 sec. 2025-10-03 23:29:11 00702_join_on_dups: [ OK ] 0.62 sec. 2025-10-03 23:29:11 03146_parameterized_view_with_date: [ OK ] 0.42 sec. 2025-10-03 23:29:11 02416_keeper_map: [ OK ] 0.62 sec. 2025-10-03 23:29:12 03008_local_plain_rewritable: [ OK ] 1.02 sec. 2025-10-03 23:29:12 02179_key_condition_no_common_type: [ OK ] 0.17 sec. 2025-10-03 23:29:12 01109_inflating_cross_join: [ OK ] 0.17 sec. 2025-10-03 23:29:12 00508_materialized_view_to: [ OK ] 0.22 sec. 2025-10-03 23:29:12 02725_sleep_max_time: [ OK ] 0.12 sec. 2025-10-03 23:29:12 02029_orc_low_cardinality: [ OK ] 0.72 sec. 2025-10-03 23:29:12 01847_bad_like: [ OK ] 0.22 sec. 2025-10-03 23:29:12 02683_native_too_large_size: [ OK ] 0.12 sec. 2025-10-03 23:29:12 01785_parallel_formatting_memory: [ OK ] 0.62 sec. 2025-10-03 23:29:12 00700_decimal_arithm: [ OK ] 0.62 sec. 2025-10-03 23:29:12 00544_agg_foreach_of_two_arg: [ OK ] 0.12 sec. 2025-10-03 23:29:12 02456_bloom_filter_assert: [ OK ] 0.38 sec. 2025-10-03 23:29:12 02245_s3_schema_desc: [ OK ] 0.22 sec. 2025-10-03 23:29:13 01227_distributed_global_in_issue_2610: [ OK ] 0.17 sec. 2025-10-03 23:29:13 02117_show_create_table_system: [ OK ] 0.32 sec. 2025-10-03 23:29:13 01308_row_policy_and_trivial_count_query: [ OK ] 0.17 sec. 2025-10-03 23:29:13 03033_virtual_column_override: [ OK ] 0.12 sec. 2025-10-03 23:29:13 01458_named_tuple_millin: [ OK ] 0.18 sec. 2025-10-03 23:29:13 01035_lc_empty_part_bug: [ OK ] 0.57 sec. 2025-10-03 23:29:13 02366_kql_func_string: [ OK ] 1.32 sec. 2025-10-03 23:29:13 01506_ttl_same_with_order_by: [ OK ] 0.37 sec. 2025-10-03 23:29:13 01296_codecs_bad_arguments: [ OK ] 0.17 sec. 2025-10-03 23:29:13 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.17 sec. 2025-10-03 23:29:13 02405_pmj_issue_40335: [ OK ] 0.23 sec. 2025-10-03 23:29:13 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.18 sec. 2025-10-03 23:29:13 03251_unaligned_window_function_state: [ OK ] 0.12 sec. 2025-10-03 23:29:13 00098_k_union_all: [ OK ] 0.12 sec. 2025-10-03 23:29:13 02126_dist_desc: [ OK ] 1.98 sec. 2025-10-03 23:29:13 02891_empty_tuple: [ OK ] 0.22 sec. 2025-10-03 23:29:13 01782_field_oom: [ OK ] 0.52 sec. 2025-10-03 23:29:13 01497_now_support_timezone: [ OK ] 0.12 sec. 2025-10-03 23:29:13 02735_system_zookeeper_connection: [ OK ] 0.17 sec. 2025-10-03 23:29:13 02393_every_metric_must_have_documentation: [ OK ] 0.12 sec. 2025-10-03 23:29:14 02310_uuid_v7: [ OK ] 0.12 sec. 2025-10-03 23:29:14 02790_fix_coredump_when_compile_expression: [ OK ] 0.12 sec. 2025-10-03 23:29:14 02158_explain_ast_alter_commands: [ OK ] 0.47 sec. 2025-10-03 23:29:14 01311_comparison_with_constant_string: [ OK ] 0.22 sec. 2025-10-03 23:29:14 03245_views_and_filter_push_down_bug: [ OK ] 0.12 sec. 2025-10-03 23:29:14 02456_progress_tty: [ OK ] 8.71 sec. 2025-10-03 23:29:14 02932_apply_deleted_mask: [ OK ] 0.32 sec. 2025-10-03 23:29:14 03243_compatibility_setting_with_alias: [ OK ] 0.17 sec. 2025-10-03 23:29:15 00976_shard_low_cardinality_achimbab: [ OK ] 0.17 sec. 2025-10-03 23:29:15 02790_sql_standard_fetch: [ OK ] 0.17 sec. 2025-10-03 23:29:15 02539_settings_alias: [ OK ] 1.32 sec. 2025-10-03 23:29:15 02703_explain_query_tree_is_forbidden_with_old_analyzer: [ OK ] 0.12 sec. 2025-10-03 23:29:15 02245_s3_virtual_columns: [ OK ] 0.22 sec. 2025-10-03 23:29:15 02151_client_option_echo: [ OK ] 0.62 sec. 2025-10-03 23:29:15 02901_analyzer_recursive_window: [ OK ] 0.17 sec. 2025-10-03 23:29:15 02382_join_and_filtering_set: [ OK ] 0.22 sec. 2025-10-03 23:29:15 01889_tokenize: [ OK ] 0.17 sec. 2025-10-03 23:29:15 00825_protobuf_format_enum_mapping: [ OK ] 1.83 sec. 2025-10-03 23:29:16 00175_if_num_arrays: [ OK ] 0.22 sec. 2025-10-03 23:29:16 01183_custom_separated_format_http: [ OK ] 2.37 sec. 2025-10-03 23:29:16 00804_test_alter_compression_codecs: [ OK ] 2.33 sec. 2025-10-03 23:29:16 00927_asof_join_correct_bt: [ OK ] 0.27 sec. 2025-10-03 23:29:16 01880_remote_ipv6: [ OK ] 0.27 sec. 2025-10-03 23:29:16 00995_exception_while_insert: [ OK ] 0.77 sec. 2025-10-03 23:29:17 00070_insert_fewer_columns_http: [ OK ] 0.37 sec. 2025-10-03 23:29:17 02907_fromDaysSinceYearZero: [ OK ] 0.27 sec. 2025-10-03 23:29:17 00705_aggregate_states_addition: [ OK ] 0.22 sec. 2025-10-03 23:29:17 00874_issue_3495: [ OK ] 0.17 sec. 2025-10-03 23:29:17 02366_kql_func_math: [ OK ] 0.17 sec. 2025-10-03 23:29:17 00400_client_external_options: [ OK ] 0.77 sec. 2025-10-03 23:29:17 02717_pretty_json: [ OK ] 0.12 sec. 2025-10-03 23:29:18 00933_ttl_with_default: [ OK ] 0.27 sec. 2025-10-03 23:29:18 02836_file_diagnostics_while_reading_header: [ OK ] 0.42 sec. 2025-10-03 23:29:18 01582_distinct_subquery_groupby: [ OK ] 0.22 sec. 2025-10-03 23:29:18 00265_http_content_type_format_timezone: [ OK ] 0.57 sec. 2025-10-03 23:29:18 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.43 sec. 2025-10-03 23:29:18 01911_logical_error_minus: [ OK ] 0.32 sec. 2025-10-03 23:29:19 02810_row_binary_with_defaults: [ OK ] 0.17 sec. 2025-10-03 23:29:19 02956_rocksdb_with_ttl: [ OK ] 3.18 sec. 2025-10-03 23:29:19 02420_key_condition_actions_dag_bug_40599: [ OK ] 0.27 sec. 2025-10-03 23:29:19 00723_remerge_sort: [ OK ] 0.22 sec. 2025-10-03 23:29:19 00926_geo_to_h3: [ OK ] 0.22 sec. 2025-10-03 23:29:19 01269_create_with_null: [ OK ] 0.22 sec. 2025-10-03 23:29:19 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.17 sec. 2025-10-03 23:29:19 03164_analyzer_validate_tree_size: [ OK ] 0.22 sec. 2025-10-03 23:29:20 00534_exp10: [ OK ] 0.12 sec. 2025-10-03 23:29:20 02439_merge_selecting_partitions: [ OK ] 3.68 sec. 2025-10-03 23:29:20 00734_timeslot: [ OK ] 0.17 sec. 2025-10-03 23:29:20 02597_projection_materialize_and_replication: [ OK ] 1.22 sec. 2025-10-03 23:29:20 02963_invalid_identifier: [ OK ] 0.12 sec. 2025-10-03 23:29:20 01308_polygon_area: [ OK ] 0.17 sec. 2025-10-03 23:29:20 02771_system_user_processes: [ OK ] 1.02 sec. 2025-10-03 23:29:20 02346_additional_filters: [ OK ] 0.47 sec. 2025-10-03 23:29:20 01854_s2_cap_union: [ OK ] 0.22 sec. 2025-10-03 23:29:20 02844_table_function_url_filter_by_virtual_columns: [ OK ] 0.52 sec. 2025-10-03 23:29:20 03145_asof_join_ddb_inequalities: [ OK ] 0.27 sec. 2025-10-03 23:29:20 02910_bad_logs_level_in_local: [ OK ] 0.12 sec. 2025-10-03 23:29:20 01126_month_partitioning_consistent_code: [ OK ] 0.17 sec. 2025-10-03 23:29:21 03034_recursive_cte_tree: [ OK ] 0.22 sec. 2025-10-03 23:29:21 00147_alter_nested_default: [ OK ] 0.28 sec. 2025-10-03 23:29:21 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 2.33 sec. 2025-10-03 23:29:21 00628_in_lambda_on_merge_table_bug: [ OK ] 0.27 sec. 2025-10-03 23:29:21 01635_sum_map_fuzz: [ OK ] 0.17 sec. 2025-10-03 23:29:21 01177_group_array_moving: [ OK ] 0.17 sec. 2025-10-03 23:29:21 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.42 sec. 2025-10-03 23:29:21 02452_check_low_cardinality: [ OK ] 0.22 sec. 2025-10-03 23:29:21 00926_adaptive_index_granularity_merge_tree: [ OK ] 0.92 sec. 2025-10-03 23:29:22 02760_dictionaries_memory: [ OK ] 6.54 sec. 2025-10-03 23:29:22 01144_join_rewrite_with_ambiguous_column_and_view: [ OK ] 0.22 sec. 2025-10-03 23:29:22 00146_summing_merge_tree_nested_map: [ OK ] 0.27 sec. 2025-10-03 23:29:22 01596_full_join_chertus: [ OK ] 0.12 sec. 2025-10-03 23:29:22 03215_view_with_recursive: [ OK ] 0.27 sec. 2025-10-03 23:29:22 01398_in_tuple_func: [ OK ] 0.17 sec. 2025-10-03 23:29:22 02003_compress_bz2: [ OK ] 0.52 sec. 2025-10-03 23:29:22 02967_http_compressed: [ OK ] 0.37 sec. 2025-10-03 23:29:23 00854_multiple_join_asterisks: [ OK ] 0.17 sec. 2025-10-03 23:29:23 02588_avro_date32_and_decimals: [ OK ] 0.77 sec. 2025-10-03 23:29:23 01671_test_toQuarter_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:29:23 00973_uniq_non_associativity: [ OK ] 0.52 sec. 2025-10-03 23:29:23 01630_disallow_floating_point_as_partition_key: [ OK ] 0.17 sec. 2025-10-03 23:29:23 00900_entropy_shard: [ OK ] 0.17 sec. 2025-10-03 23:29:23 01508_query_obfuscator: [ OK ] 0.42 sec. 2025-10-03 23:29:23 03049_unknown_identifier_materialized_column: [ OK ] 0.17 sec. 2025-10-03 23:29:23 00719_parallel_ddl_db: [ OK ] 8.00 sec. 2025-10-03 23:29:23 01883_grouping_sets_crash: [ OK ] 0.27 sec. 2025-10-03 23:29:23 02864_statistics_usage: [ OK ] 0.27 sec. 2025-10-03 23:29:23 01198_client_quota_key: [ OK ] 0.47 sec. 2025-10-03 23:29:23 01666_merge_tree_max_query_limit: [ OK ] 2.13 sec. 2025-10-03 23:29:23 03000_virtual_columns_in_prewhere: [ OK ] 0.17 sec. 2025-10-03 23:29:24 02294_decimal_second_errors: [ OK ] 0.17 sec. 2025-10-03 23:29:24 01351_geohash_assert: [ OK ] 0.12 sec. 2025-10-03 23:29:24 02923_join_use_nulls_modulo: [ OK ] 0.12 sec. 2025-10-03 23:29:24 00098_2_union_all: [ OK ] 0.17 sec. 2025-10-03 23:29:24 02293_h3_distance: [ OK ] 0.22 sec. 2025-10-03 23:29:24 01061_window_view_event_hop_to_asc: [ OK ] 1.03 sec. 2025-10-03 23:29:24 00910_zookeeper_custom_compression_codecs_replicated_long: [ OK ] 0.87 sec. 2025-10-03 23:29:24 02943_variant_read_subcolumns: [ OK ] 3.63 sec. 2025-10-03 23:29:24 02201_use_skip_indexes_if_final: [ OK ] 0.17 sec. 2025-10-03 23:29:25 03172_system_detached_tables: [ OK ] 0.62 sec. 2025-10-03 23:29:25 02491_part_log_has_table_uuid: [ OK ] 0.27 sec. 2025-10-03 23:29:25 01526_max_untracked_memory: [ OK ] 1.38 sec. 2025-10-03 23:29:25 00381_first_significant_subdomain: [ OK ] 0.12 sec. 2025-10-03 23:29:25 01646_fix_window_funnel_inconistency: [ OK ] 0.17 sec. 2025-10-03 23:29:25 00834_date_datetime_cmp: [ OK ] 0.12 sec. 2025-10-03 23:29:25 01744_tuple_cast_to_map_bugfix: [ OK ] 0.17 sec. 2025-10-03 23:29:25 02922_url_s3_engine_size_virtual_column: [ OK ] 0.77 sec. 2025-10-03 23:29:25 00753_comment_columns_zookeeper: [ OK ] 0.22 sec. 2025-10-03 23:29:25 03129_update_nested_materialized_column_check: [ OK ] 0.17 sec. 2025-10-03 23:29:26 01176_mysql_client_interactive: [ OK ] 1.28 sec. 2025-10-03 23:29:26 02009_decimal_no_trailing_zeros: [ OK ] 0.22 sec. 2025-10-03 23:29:26 03215_varian_as_common_type_integers: [ OK ] 0.17 sec. 2025-10-03 23:29:26 02122_parallel_formatting_RowBinary: [ OK ] 0.87 sec. 2025-10-03 23:29:26 01440_big_int_least_greatest: [ OK ] 0.18 sec. 2025-10-03 23:29:26 03164_early_constant_folding_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:29:26 02015_async_inserts_3: [ OK ] 5.69 sec. 2025-10-03 23:29:26 01419_skip_index_compact_parts: [ OK ] 0.17 sec. 2025-10-03 23:29:26 00647_multiply_aggregation_state: [ OK ] 0.27 sec. 2025-10-03 23:29:26 02283_array_norm: [ OK ] 0.27 sec. 2025-10-03 23:29:26 01913_summing_mt_and_simple_agg_function_with_lc: [ OK ] 0.17 sec. 2025-10-03 23:29:27 03210_variant_with_aggregate_function_type: [ OK ] 0.22 sec. 2025-10-03 23:29:27 01710_projection_with_ast_rewrite_settings: [ OK ] 0.27 sec. 2025-10-03 23:29:27 02893_vertical_final_bugs: [ OK ] 0.22 sec. 2025-10-03 23:29:27 01754_cluster_all_replicas_shard_num: [ OK ] 0.22 sec. 2025-10-03 23:29:27 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.17 sec. 2025-10-03 23:29:27 00630_arbitrary_csv_delimiter: [ OK ] 2.38 sec. 2025-10-03 23:29:27 02124_insert_deduplication_token_materialized_views: [ OK ] 1.12 sec. 2025-10-03 23:29:28 02341_analyzer_aliases_basics: [ OK ] 0.27 sec. 2025-10-03 23:29:29 00735_long_conditional: [ OK ] 1.63 sec. 2025-10-03 23:29:29 00207_left_array_join: [ OK ] 0.12 sec. 2025-10-03 23:29:29 00753_distributed_system_columns_and_system_tables: [ OK ] 0.17 sec. 2025-10-03 23:29:30 01648_mutations_and_escaping: [ OK ] 5.79 sec. 2025-10-03 23:29:30 02523_range_const_start: [ OK ] 0.12 sec. 2025-10-03 23:29:30 01313_parse_date_time_best_effort_null_zero: [ OK ] 0.22 sec. 2025-10-03 23:29:30 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.17 sec. 2025-10-03 23:29:30 02483_elapsed_time: [ OK ] 3.28 sec. 2025-10-03 23:29:30 01296_pipeline_stuck: [ OK ] 0.22 sec. 2025-10-03 23:29:30 01528_play: [ OK ] 0.32 sec. 2025-10-03 23:29:30 01514_distributed_cancel_query_on_error: [ OK ] 0.92 sec. 2025-10-03 23:29:31 00004_shard_format_ast_and_remote_table: [ OK ] 0.17 sec. 2025-10-03 23:29:31 00443_preferred_block_size_bytes: [ OK ] 3.43 sec. 2025-10-03 23:29:31 02784_projections_read_in_order_bug: [ OK ] 0.17 sec. 2025-10-03 23:29:31 02674_trivial_count_analyzer: [ OK ] 0.32 sec. 2025-10-03 23:29:31 00111_shard_external_sort_distributed: [ OK ] 3.33 sec. 2025-10-03 23:29:31 01768_extended_range: [ OK ] 0.17 sec. 2025-10-03 23:29:31 02515_tuple_lambda_parsing: [ OK ] 0.12 sec. 2025-10-03 23:29:31 00320_between: [ OK ] 0.12 sec. 2025-10-03 23:29:31 01527_bad_aggregation_in_lambda: [ OK ] 0.12 sec. 2025-10-03 23:29:31 01030_limit_by_with_ties_error: [ OK ] 0.67 sec. 2025-10-03 23:29:31 03290_final_sample: [ OK ] 0.22 sec. 2025-10-03 23:29:31 00930_max_partitions_per_insert_block: [ OK ] 0.42 sec. 2025-10-03 23:29:31 02410_to_decimal_or_default: [ OK ] 0.17 sec. 2025-10-03 23:29:31 01281_parseDateTime64BestEffort: [ OK ] 0.32 sec. 2025-10-03 23:29:31 02986_leftpad_fixedstring: [ OK ] 0.17 sec. 2025-10-03 23:29:31 01275_alter_rename_column_default_expr: [ OK ] 0.32 sec. 2025-10-03 23:29:32 02291_join_const_literal_36279: [ OK ] 0.28 sec. 2025-10-03 23:29:32 02015_async_inserts_5: [ OK ] 0.97 sec. 2025-10-03 23:29:33 01083_window_view_select: [ OK ] 1.18 sec. 2025-10-03 23:29:33 01681_arg_min_max_if_fix: [ OK ] 0.13 sec. 2025-10-03 23:29:33 01576_alter_low_cardinality_and_select: [ OK ] 1.53 sec. 2025-10-03 23:29:33 02122_parallel_formatting_TSVWithNames: [ OK ] 0.97 sec. 2025-10-03 23:29:33 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.22 sec. 2025-10-03 23:29:33 00752_low_cardinality_lambda_argument: [ OK ] 0.17 sec. 2025-10-03 23:29:33 01356_wrong_filter-type_bug: [ OK ] 0.17 sec. 2025-10-03 23:29:33 02456_alter-nullable-column-bag: [ OK ] 0.17 sec. 2025-10-03 23:29:33 03044_analyzer_alias_join: [ OK ] 0.12 sec. 2025-10-03 23:29:33 00212_long_shard_aggregate_function_uniq: [ OK ] 2.13 sec. 2025-10-03 23:29:33 02560_null_as_default: [ OK ] 0.17 sec. 2025-10-03 23:29:33 02899_use_default_format_on_http_exception: [ OK ] 0.42 sec. 2025-10-03 23:29:33 02017_columns_with_dot: [ OK ] 0.22 sec. 2025-10-03 23:29:33 01010_partial_merge_join: [ OK ] 0.92 sec. 2025-10-03 23:29:34 03000_minmax_index_first: [ OK ] 0.17 sec. 2025-10-03 23:29:34 01476_right_full_join_switch: [ OK ] 0.22 sec. 2025-10-03 23:29:34 02678_explain_pipeline_graph_with_projection: [ OK ] 0.17 sec. 2025-10-03 23:29:34 02097_remove_sample_by: [ OK ] 0.32 sec. 2025-10-03 23:29:34 02916_local_insert_into_function: [ OK ] 0.37 sec. 2025-10-03 23:29:34 02006_todatetime64_from_string: [ OK ] 0.17 sec. 2025-10-03 23:29:34 01922_array_join_with_index: [ OK ] 0.17 sec. 2025-10-03 23:29:34 00878_join_unexpected_results: [ OK ] 0.42 sec. 2025-10-03 23:29:34 00680_duplicate_columns_inside_union_all: [ OK ] 0.17 sec. 2025-10-03 23:29:34 01798_uniq_theta_sketch: [ OK ] 0.62 sec. 2025-10-03 23:29:34 00852_any_join_nulls: [ OK ] 0.17 sec. 2025-10-03 23:29:34 02911_system_symbols: [ OK ] 0.27 sec. 2025-10-03 23:29:35 01264_nested_baloo_bear: [ OK ] 0.17 sec. 2025-10-03 23:29:35 01280_min_map_max_map: [ OK ] 0.27 sec. 2025-10-03 23:29:35 01560_optimize_on_insert_zookeeper: [ OK ] 0.32 sec. 2025-10-03 23:29:35 02530_ip_part_id: [ OK ] 0.22 sec. 2025-10-03 23:29:35 02315_replace_multiif_to_if: [ OK ] 0.12 sec. 2025-10-03 23:29:35 00285_not_all_data_in_totals: [ OK ] 0.17 sec. 2025-10-03 23:29:35 01055_compact_parts: [ OK ] 0.37 sec. 2025-10-03 23:29:35 01825_type_json_wide_parts_merge: [ OK ] 0.17 sec. 2025-10-03 23:29:35 02184_hash_functions_and_ip_types: [ OK ] 0.17 sec. 2025-10-03 23:29:35 02884_virtual_column_order_by: [ OK ] 0.17 sec. 2025-10-03 23:29:36 00504_mergetree_arrays_rw: [ OK ] 0.33 sec. 2025-10-03 23:29:36 02154_dictionary_get_http_json: [ OK ] 1.03 sec. 2025-10-03 23:29:36 01062_pm_multiple_all_join_same_value: [ OK ] 0.17 sec. 2025-10-03 23:29:36 00531_client_ignore_error: [ OK ] 0.60 sec. 2025-10-03 23:29:36 00012_array_join_alias_2: [ OK ] 0.12 sec. 2025-10-03 23:29:36 02705_grouping_keys_equal_keys: [ OK ] 0.12 sec. 2025-10-03 23:29:36 03229_json_null_as_default_for_tuple: [ OK ] 0.12 sec. 2025-10-03 23:29:36 01812_basic_auth_http_server: [ OK ] 2.34 sec. 2025-10-03 23:29:36 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.22 sec. 2025-10-03 23:29:36 01055_prewhere_bugs: [ OK ] 0.18 sec. 2025-10-03 23:29:37 01479_cross_join_9855: [ OK ] 0.12 sec. 2025-10-03 23:29:37 00816_join_column_names_sarg: [ OK ] 0.17 sec. 2025-10-03 23:29:37 01453_normalize_query_alias_uuid: [ OK ] 0.12 sec. 2025-10-03 23:29:37 02294_nothing_arguments_in_functions_errors: [ OK ] 0.77 sec. 2025-10-03 23:29:37 01198_plus_inf: [ OK ] 0.12 sec. 2025-10-03 23:29:37 01546_log_queries_min_query_duration_ms: [ OK ] 0.97 sec. 2025-10-03 23:29:37 01670_sign_function: [ OK ] 0.23 sec. 2025-10-03 23:29:37 02782_inconsistent_formatting_and_constant_folding: [ OK ] 0.18 sec. 2025-10-03 23:29:37 02239_client_host_help: [ OK ] 0.42 sec. 2025-10-03 23:29:37 00604_show_create_database: [ OK ] 0.12 sec. 2025-10-03 23:29:37 02377_optimize_sorting_by_input_stream_properties_explain: [ OK ] 4.39 sec. 2025-10-03 23:29:37 03299_deep_nested_map_creation: [ OK ] 0.12 sec. 2025-10-03 23:29:37 02811_primary_key_in_columns: [ OK ] 0.37 sec. 2025-10-03 23:29:38 01073_grant_and_revoke: [ OK ] 0.17 sec. 2025-10-03 23:29:38 01214_point_in_Mecca: [ OK ] 0.68 sec. 2025-10-03 23:29:38 00961_check_table: [ OK ] 0.27 sec. 2025-10-03 23:29:38 02025_dictionary_array_nested_map: [ OK ] 0.17 sec. 2025-10-03 23:29:38 00533_uniq_array: [ OK ] 0.12 sec. 2025-10-03 23:29:38 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.22 sec. 2025-10-03 23:29:38 01019_Buffer_and_max_memory_usage: [ OK ] 0.57 sec. 2025-10-03 23:29:38 02541_empty_function_support_ip: [ OK ] 0.17 sec. 2025-10-03 23:29:38 02151_hash_table_sizes_stats_distributed: [ OK ] 12.51 sec. 2025-10-03 23:29:38 03246_skipping_index_70108: [ OK ] 0.52 sec. 2025-10-03 23:29:38 03040_recursive_cte_postgres_6: [ OK ] 0.32 sec. 2025-10-03 23:29:39 02381_analyzer_join_final: [ OK ] 0.22 sec. 2025-10-03 23:29:39 02456_BLAKE3_hash_function_test: [ OK ] 0.12 sec. 2025-10-03 23:29:39 02864_statistics_predicates: [ OK ] 1.02 sec. 2025-10-03 23:29:39 02962_parallel_window_functions_different_partitioning: [ OK ] 0.17 sec. 2025-10-03 23:29:39 02156_storage_merge_prewhere_2: [ OK ] 0.22 sec. 2025-10-03 23:29:40 00900_orc_arrow_parquet_nested: [ OK ] 2.48 sec. 2025-10-03 23:29:40 00346_if_tuple: [ OK ] 0.12 sec. 2025-10-03 23:29:40 02474_analyzer_subqueries_table_expression_modifiers: [ OK ] 0.17 sec. 2025-10-03 23:29:40 00353_join_by_tuple: [ OK ] 0.12 sec. 2025-10-03 23:29:40 01307_orc_output_format: [ OK ] 1.02 sec. 2025-10-03 23:29:40 02269_create_table_with_collation: [ OK ] 0.17 sec. 2025-10-03 23:29:40 01515_mv_and_array_join_optimisation_bag: [ OK ] 0.17 sec. 2025-10-03 23:29:41 01889_check_row_policy_defined_using_user_function: [ OK ] 1.78 sec. 2025-10-03 23:29:41 02575_merge_prewhere_different_default_kind: [ OK ] 0.18 sec. 2025-10-03 23:29:41 02005_log_formatted_queries: [ OK ] 0.32 sec. 2025-10-03 23:29:41 02122_parallel_formatting_TSVWithNamesAndTypes: [ OK ] 1.02 sec. 2025-10-03 23:29:41 00437_nulls_first_last: [ OK ] 0.27 sec. 2025-10-03 23:29:41 01493_alter_remove_no_property_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:29:41 01787_arena_assert_column_nothing: [ OK ] 0.12 sec. 2025-10-03 23:29:41 01056_create_table_as: [ OK ] 0.32 sec. 2025-10-03 23:29:41 01745_alter_delete_view: [ OK ] 0.17 sec. 2025-10-03 23:29:42 02902_add_scalar_in_all_case: [ OK ] 0.17 sec. 2025-10-03 23:29:42 00121_drop_column_zookeeper: [ OK ] 0.32 sec. 2025-10-03 23:29:42 02346_additional_filters_index: [ OK ] 0.22 sec. 2025-10-03 23:29:42 01460_line_as_string_format: [ OK ] 3.74 sec. 2025-10-03 23:29:42 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.17 sec. 2025-10-03 23:29:42 01674_htm_xml_coarse_parse: [ OK ] 0.18 sec. 2025-10-03 23:29:42 00098_6_union_all: [ OK ] 0.12 sec. 2025-10-03 23:29:42 00520_tuple_values_interpreter: [ OK ] 0.17 sec. 2025-10-03 23:29:42 02793_implicit_pretty_format_settings: [ OK ] 0.42 sec. 2025-10-03 23:29:42 00825_protobuf_format_nested_optional: [ OK ] 1.27 sec. 2025-10-03 23:29:43 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.27 sec. 2025-10-03 23:29:43 02960_alter_table_part_query_parameter: [ OK ] 0.17 sec. 2025-10-03 23:29:43 02210_toColumnTypeName_toLowCardinality_const: [ OK ] 0.12 sec. 2025-10-03 23:29:43 01213_alter_rename_primary_key_zookeeper_long: [ OK ] 0.37 sec. 2025-10-03 23:29:43 01483_merge_table_join_and_group_by: [ OK ] 0.27 sec. 2025-10-03 23:29:43 02515_fix_any_parsing: [ OK ] 0.37 sec. 2025-10-03 23:29:44 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.37 sec. 2025-10-03 23:29:44 00519_create_as_select_from_temporary_table: [ OK ] 0.12 sec. 2025-10-03 23:29:44 00459_group_array_insert_at: [ OK ] 0.17 sec. 2025-10-03 23:29:44 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.32 sec. 2025-10-03 23:29:44 01626_cnf_test: [ OK ] 0.17 sec. 2025-10-03 23:29:44 02399_merge_tree_mutate_in_partition: [ OK ] 0.22 sec. 2025-10-03 23:29:44 01621_decode_XML: [ OK ] 0.17 sec. 2025-10-03 23:29:44 02995_preliminary_filters_duplicated_columns_SimpleAggregateFunction: [ OK ] 0.12 sec. 2025-10-03 23:29:44 03173_forbid_qualify: [ OK ] 0.22 sec. 2025-10-03 23:29:45 02941_variant_type_alters: [ OK ] 6.04 sec. 2025-10-03 23:29:45 01018_ip_dictionary_long: [ OK ] 2.68 sec. 2025-10-03 23:29:45 03261_optimize_rewrite_array_exists_to_has_crash: [ OK ] 0.13 sec. 2025-10-03 23:29:45 03289_explain_syntax_statistics: [ OK ] 0.12 sec. 2025-10-03 23:29:45 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.17 sec. 2025-10-03 23:29:45 02706_kolmogorov_smirnov_test_scipy: [ OK ] 2.98 sec. 2025-10-03 23:29:45 03034_json_extract_variant: [ OK ] 0.12 sec. 2025-10-03 23:29:45 02267_join_dup_columns_issue36199: [ OK ] 0.27 sec. 2025-10-03 23:29:46 02532_profileevents_server_startup_time: [ OK ] 0.12 sec. 2025-10-03 23:29:46 02662_sparse_columns_mutations_2: [ OK ] 0.22 sec. 2025-10-03 23:29:46 02725_async_insert_table_setting: [ OK ] 0.63 sec. 2025-10-03 23:29:46 02456_async_inserts_logs: [ OK ] 1.73 sec. 2025-10-03 23:29:46 00136_duplicate_order_by_elems: [ OK ] 0.12 sec. 2025-10-03 23:29:46 01569_query_profiler_big_query_id: [ OK ] 1.62 sec. 2025-10-03 23:29:46 02226_analyzer_or_like_combine: [ OK ] 0.17 sec. 2025-10-03 23:29:47 02971_functions_to_subcolumns_column_names: [ OK ] 0.17 sec. 2025-10-03 23:29:47 02946_literal_alias_misclassification: [ OK ] 0.17 sec. 2025-10-03 23:29:47 00365_statistics_in_formats: [ OK ] 1.02 sec. 2025-10-03 23:29:47 02356_trivial_count_with_empty_set: [ OK ] 0.12 sec. 2025-10-03 23:29:47 01306_polygons_intersection: [ OK ] 0.22 sec. 2025-10-03 23:29:47 01076_range_reader_segfault: [ OK ] 0.17 sec. 2025-10-03 23:29:47 03033_recursive_cte_basic: [ OK ] 0.27 sec. 2025-10-03 23:29:47 00438_bit_rotate: [ OK ] 0.12 sec. 2025-10-03 23:29:47 00470_identifiers_in_double_quotes: [ OK ] 0.12 sec. 2025-10-03 23:29:48 03199_fix_auc_tie_handling: [ OK ] 0.17 sec. 2025-10-03 23:29:48 01503_if_const_optimization: [ OK ] 0.12 sec. 2025-10-03 23:29:48 01139_asof_join_types: [ OK ] 0.23 sec. 2025-10-03 23:29:48 01275_extract_groups_check: [ OK ] 0.22 sec. 2025-10-03 23:29:49 00653_verification_monotonic_data_load: [ OK ] 4.90 sec. 2025-10-03 23:29:49 01532_having_with_totals: [ OK ] 0.17 sec. 2025-10-03 23:29:49 00825_protobuf_format_no_length_delimiter: [ OK ] 1.12 sec. 2025-10-03 23:29:49 02206_information_schema_show_database: [ OK ] 0.12 sec. 2025-10-03 23:29:50 00569_parse_date_time_best_effort: [ OK ] 0.12 sec. 2025-10-03 23:29:50 02968_full_sorting_join_fuzz: [ OK ] 3.23 sec. 2025-10-03 23:29:50 03015_parser_shortcut_lexer_errors: [ OK ] 0.37 sec. 2025-10-03 23:29:50 01120_join_constants: [ OK ] 0.18 sec. 2025-10-03 23:29:51 00100_subquery_table_identifier: [ OK ] 0.93 sec. 2025-10-03 23:29:51 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.42 sec. 2025-10-03 23:29:51 00492_drop_temporary_table: [ OK ] 0.19 sec. 2025-10-03 23:29:52 02915_lazy_loading_of_base_backups: [ OK ] 1.74 sec. 2025-10-03 23:29:52 02861_interpolate_alias_precedence: [ OK ] 0.22 sec. 2025-10-03 23:29:52 02830_insert_values_time_interval: [ OK ] 0.27 sec. 2025-10-03 23:29:53 02367_optimize_trivial_count_with_array_join: [ OK ] 0.27 sec. 2025-10-03 23:29:53 01304_direct_io_long: [ OK ] 6.20 sec. 2025-10-03 23:29:53 01550_type_map_formats_input: [ OK ] 1.70 sec. 2025-10-03 23:29:53 02723_zookeeper_name: [ OK ] 0.47 sec. 2025-10-03 23:29:53 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.17 sec. 2025-10-03 23:29:53 02772_s3_crash: [ OK ] 0.12 sec. 2025-10-03 23:29:53 01167_isolation_hermitage: [ OK ] 28.29 sec. 2025-10-03 23:29:53 02722_log_profile_events: [ OK ] 0.12 sec. 2025-10-03 23:29:54 00326_long_function_multi_if: [ OK ] 15.59 sec. 2025-10-03 23:29:54 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.37 sec. 2025-10-03 23:29:54 02244_url_engine_headers_test: [ OK ] 0.22 sec. 2025-10-03 23:29:54 00553_invalid_nested_name: [ OK ] 0.12 sec. 2025-10-03 23:29:54 02991_count_rewrite_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:29:54 01654_bar_nan: [ OK ] 0.12 sec. 2025-10-03 23:29:54 02470_suspicious_low_cardinality_msan: [ OK ] 0.17 sec. 2025-10-03 23:29:54 02176_optimize_aggregation_in_order_empty: [ OK ] 0.17 sec. 2025-10-03 23:29:54 03036_dynamic_read_subcolumns_memory: [ OK ] 0.77 sec. 2025-10-03 23:29:54 01018_Distributed__shard_num: [ OK ] 0.37 sec. 2025-10-03 23:29:54 02541_analyzer_grouping_sets_crash_fix: [ OK ] 0.13 sec. 2025-10-03 23:29:55 02387_parse_date_as_datetime: [ OK ] 0.12 sec. 2025-10-03 23:29:55 01455_shard_leaf_max_rows_bytes_to_read: [ OK ] 0.37 sec. 2025-10-03 23:29:55 02105_backslash_letter_commands: [ OK ] 0.47 sec. 2025-10-03 23:29:55 02995_index_4: [ OK ] 8.87 sec. 2025-10-03 23:29:55 00662_array_has_nullable: [ OK ] 0.32 sec. 2025-10-03 23:29:56 01273_arrow_arrays_load: [ OK ] 0.97 sec. 2025-10-03 23:29:56 02002_sampling_and_unknown_column_bug: [ OK ] 0.17 sec. 2025-10-03 23:29:56 01781_token_extractor_buffer_overflow: [ OK ] 0.32 sec. 2025-10-03 23:29:56 02232_allow_only_replicated_engine: [ OK ] 1.52 sec. 2025-10-03 23:29:56 00981_topK_topKWeighted_long: [ OK ] 1.93 sec. 2025-10-03 23:29:56 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.12 sec. 2025-10-03 23:29:56 02812_pointwise_array_operations: [ OK ] 0.27 sec. 2025-10-03 23:29:56 01137_order_by_func_final: [ OK ] 0.17 sec. 2025-10-03 23:29:56 02834_client_yaml_configs: [ OK ] 0.52 sec. 2025-10-03 23:29:56 01710_projections_order_by_incomplete: [ OK ] 0.17 sec. 2025-10-03 23:29:56 01440_big_int_arithm: [ OK ] 0.32 sec. 2025-10-03 23:29:56 01825_new_type_json_10: [ OK ] 0.17 sec. 2025-10-03 23:29:56 00721_force_by_identical_result_after_merge_zookeeper_long: [ OK ] 0.32 sec. 2025-10-03 23:29:57 01710_projections_order_by_complete: [ OK ] 0.17 sec. 2025-10-03 23:29:57 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.22 sec. 2025-10-03 23:29:57 00548_slice_of_nested: [ OK ] 0.12 sec. 2025-10-03 23:29:57 02021_h3_get_faces: [ OK ] 0.17 sec. 2025-10-03 23:29:57 01372_remote_table_function_empty_table: [ OK ] 0.12 sec. 2025-10-03 23:29:57 02842_move_pk_to_end_of_prewhere: [ OK ] 0.27 sec. 2025-10-03 23:29:57 02880_indexHint__partition_id: [ OK ] 0.17 sec. 2025-10-03 23:29:57 01076_window_view_alter_query_to: [ OK ] 1.42 sec. 2025-10-03 23:29:57 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.27 sec. 2025-10-03 23:29:57 02422_read_numbers_as_strings: [ OK ] 0.12 sec. 2025-10-03 23:29:57 03073_analyzer_alias_as_column_name: [ OK ] 0.17 sec. 2025-10-03 23:29:57 02725_cnf_large_check: [ OK ] 0.22 sec. 2025-10-03 23:29:58 01852_jit_if: [ OK ] 0.17 sec. 2025-10-03 23:29:58 03145_unicode_quotes: [ OK ] 0.12 sec. 2025-10-03 23:29:58 01548_query_log_query_execution_ms: [ OK ] 1.22 sec. 2025-10-03 23:29:58 01147_partial_merge_full_join: [ OK ] 0.67 sec. 2025-10-03 23:29:58 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.17 sec. 2025-10-03 23:29:58 00907_set_index_max_rows: [ OK ] 0.78 sec. 2025-10-03 23:29:58 01142_join_lc_and_nullable_in_key: [ OK ] 0.32 sec. 2025-10-03 23:29:58 02313_dump_column_structure_low_cardinality: [ OK ] 0.12 sec. 2025-10-03 23:29:58 02151_clickhouse_client_hints: [ OK ] 0.37 sec. 2025-10-03 23:29:58 01318_encrypt: [ OK ] 0.52 sec. 2025-10-03 23:29:59 02482_if_with_nothing_argument: [ OK ] 0.12 sec. 2025-10-03 23:29:59 00999_nullable_nested_types_4877: [ OK ] 0.27 sec. 2025-10-03 23:29:59 02899_restore_parts_replicated_merge_tree: [ OK ] 2.98 sec. 2025-10-03 23:29:59 01710_projection_with_column_transformers: [ OK ] 0.12 sec. 2025-10-03 23:29:59 02983_empty_map_hasToken: [ OK ] 0.27 sec. 2025-10-03 23:29:59 00341_squashing_insert_select2: [ OK ] 0.27 sec. 2025-10-03 23:29:59 02707_protobuf_unnamed_tuple_as_nested_message: [ OK ] 0.42 sec. 2025-10-03 23:29:59 02998_attach_partition_not_allowed_if_structure_differs_due_to_materialized_column: [ OK ] 0.17 sec. 2025-10-03 23:29:59 03208_uniq_with_empty_tuple: [ OK ] 0.17 sec. 2025-10-03 23:29:59 02231_bloom_filter_sizing: [ OK ] 0.27 sec. 2025-10-03 23:29:59 00460_vertical_and_totals_extremes: [ OK ] 0.17 sec. 2025-10-03 23:29:59 02796_projection_date_filter_on_view: [ OK ] 0.52 sec. 2025-10-03 23:29:59 01508_explain_header: [ OK ] 0.12 sec. 2025-10-03 23:30:00 00674_has_array_enum: [ OK ] 0.12 sec. 2025-10-03 23:30:00 00231_format_vertical_raw: [ OK ] 0.12 sec. 2025-10-03 23:30:00 02185_range_hashed_dictionary_open_ranges: [ OK ] 0.27 sec. 2025-10-03 23:30:00 01355_CSV_input_format_allow_errors: [ OK ] 1.08 sec. 2025-10-03 23:30:01 02020_exponential_smoothing: [ OK ] 0.77 sec. 2025-10-03 23:30:01 02293_h3_line: [ OK ] 0.27 sec. 2025-10-03 23:30:01 00046_stored_aggregates_simple: [ OK ] 0.17 sec. 2025-10-03 23:30:02 01232_untuple: [ OK ] 0.22 sec. 2025-10-03 23:30:02 02488_zero_copy_detached_parts_drop_table: [ OK ] 1.58 sec. 2025-10-03 23:30:02 00962_enumNotExect: [ OK ] 0.22 sec. 2025-10-03 23:30:02 00209_insert_select_extremes: [ OK ] 0.22 sec. 2025-10-03 23:30:02 00024_unused_array_join_in_subquery: [ OK ] 0.12 sec. 2025-10-03 23:30:02 00975_recursive_materialized_view: [ OK ] 0.22 sec. 2025-10-03 23:30:03 01181_db_atomic_drop_on_cluster: [ OK ] 0.42 sec. 2025-10-03 23:30:03 02700_regexp_operator: [ OK ] 0.12 sec. 2025-10-03 23:30:03 01558_ttest: [ OK ] 0.38 sec. 2025-10-03 23:30:03 02149_schema_inference_formats_with_schema_2: [ OK ] 9.80 sec. 2025-10-03 23:30:03 01825_replacing_vertical_merge: [ OK ] 0.22 sec. 2025-10-03 23:30:03 00602_throw_if: [ OK ] 1.58 sec. 2025-10-03 23:30:03 02958_transform_enum: [ OK ] 0.17 sec. 2025-10-03 23:30:05 01040_dictionary_invalidate_query_switchover_long: [ OK ] 15.46 sec. 2025-10-03 23:30:05 02204_fractional_progress_bar_long: [ OK ] 5.19 sec. 2025-10-03 23:30:05 00580_cast_nullable_to_non_nullable: [ OK ] 0.12 sec. 2025-10-03 23:30:05 01760_modulo_negative: [ OK ] 0.12 sec. 2025-10-03 23:30:05 02343_analyzer_lambdas: [ OK ] 0.37 sec. 2025-10-03 23:30:06 00443_optimize_final_vertical_merge: [ OK ] 2.73 sec. 2025-10-03 23:30:06 00502_string_concat_with_array: [ OK ] 0.12 sec. 2025-10-03 23:30:06 02674_date_int_string_json_inference: [ OK ] 0.12 sec. 2025-10-03 23:30:06 01630_simple_aggregate_all_functions_in_summing_merge_tree: [ OK ] 2.98 sec. 2025-10-03 23:30:07 00488_non_ascii_column_names: [ OK ] 0.17 sec. 2025-10-03 23:30:07 00912_string_comparison: [ OK ] 0.17 sec. 2025-10-03 23:30:07 00555_hasAll_hasAny: [ OK ] 0.32 sec. 2025-10-03 23:30:08 02906_force_optimize_projection_name: [ OK ] 0.97 sec. 2025-10-03 23:30:09 00955_test_final_mark_use: [ OK ] 1.12 sec. 2025-10-03 23:30:09 02292_create_function_validate: [ OK ] 0.12 sec. 2025-10-03 23:30:09 01037_polygon_dicts_correctness_fast: [ OK ] 5.59 sec. 2025-10-03 23:30:09 03209_parallel_replicas_order_by_all: [ OK ] 0.22 sec. 2025-10-03 23:30:09 00974_bitmapContains_with_primary_key: [ OK ] 0.17 sec. 2025-10-03 23:30:10 01942_dateTimeToSnowflake: [ OK ] 0.27 sec. 2025-10-03 23:30:10 03057_analyzer_subquery_alias_join: [ OK ] 0.17 sec. 2025-10-03 23:30:10 02177_sum_if_not_found: [ OK ] 0.17 sec. 2025-10-03 23:30:10 00942_mv_rename_table: [ OK ] 0.17 sec. 2025-10-03 23:30:10 02026_describe_include_subcolumns: [ OK ] 0.17 sec. 2025-10-03 23:30:10 02995_index_7: [ OK ] 3.48 sec. 2025-10-03 23:30:11 02723_param_exception_message_context: [ OK ] 0.42 sec. 2025-10-03 23:30:11 00098_a_union_all: [ OK ] 0.12 sec. 2025-10-03 23:30:11 02889_file_log_save_errors: [ OK ] 2.08 sec. 2025-10-03 23:30:11 01047_window_view_parser_inner_table: [ OK ] 0.82 sec. 2025-10-03 23:30:11 01710_projection_with_joins: [ OK ] 0.22 sec. 2025-10-03 23:30:11 00687_insert_into_mv: [ OK ] 0.27 sec. 2025-10-03 23:30:11 01757_optimize_skip_unused_shards_limit: [ OK ] 0.22 sec. 2025-10-03 23:30:12 00552_logical_functions_simple: [ OK ] 0.17 sec. 2025-10-03 23:30:12 02932_group_by_null_fuzzer: [ OK ] 0.17 sec. 2025-10-03 23:30:12 03037_dynamic_merges_2_vertical_wide_merge_tree: [ OK ] 0.57 sec. 2025-10-03 23:30:12 00572_aggregation_by_empty_set: [ OK ] 0.17 sec. 2025-10-03 23:30:12 01462_test_codec_on_alias: [ OK ] 0.17 sec. 2025-10-03 23:30:12 00717_low_cardinaliry_distributed_group_by: [ OK ] 0.77 sec. 2025-10-03 23:30:12 01017_in_unconvertible_complex_type: [ OK ] 0.17 sec. 2025-10-03 23:30:12 01533_optimize_skip_merged_partitions: [ OK ] 0.17 sec. 2025-10-03 23:30:13 02998_pretty_format_print_readable_number_on_single_value: [ OK ] 0.37 sec. 2025-10-03 23:30:13 00562_rewrite_select_expression_with_union: [ OK ] 0.17 sec. 2025-10-03 23:30:13 02457_tuple_of_intervals: [ OK ] 0.32 sec. 2025-10-03 23:30:13 03171_function_to_subcolumns_fuzzer: [ OK ] 0.27 sec. 2025-10-03 23:30:13 00910_buffer_prewhere_different_types: [ OK ] 0.17 sec. 2025-10-03 23:30:13 03033_dynamic_text_serialization: [ OK ] 0.17 sec. 2025-10-03 23:30:13 01016_null_part_minmax: [ OK ] 0.17 sec. 2025-10-03 23:30:13 00009_array_join_subquery: [ OK ] 0.12 sec. 2025-10-03 23:30:13 02887_byteswap: [ OK ] 0.27 sec. 2025-10-03 23:30:14 02560_window_ntile: [ OK ] 0.27 sec. 2025-10-03 23:30:14 01428_nullable_asof_join: [ OK ] 0.27 sec. 2025-10-03 23:30:14 02797_transform_narrow_types: [ OK ] 0.17 sec. 2025-10-03 23:30:14 02862_sorted_distinct_sparse_fix: [ OK ] 0.17 sec. 2025-10-03 23:30:14 02365_multisearch_random_tests: [ OK ] 2.13 sec. 2025-10-03 23:30:14 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.22 sec. 2025-10-03 23:30:14 01670_distributed_bytes_to_throw_insert: [ OK ] 0.22 sec. 2025-10-03 23:30:14 01825_new_type_json_ephemeral: [ OK ] 0.17 sec. 2025-10-03 23:30:14 01388_clear_all_columns: [ OK ] 0.27 sec. 2025-10-03 23:30:15 01403_datetime64_constant_arg: [ OK ] 0.12 sec. 2025-10-03 23:30:15 01472_obfuscator_uuid: [ OK ] 0.83 sec. 2025-10-03 23:30:15 01414_push_predicate_when_contains_with_clause: [ OK ] 0.27 sec. 2025-10-03 23:30:15 01251_string_comparison: [ OK ] 0.12 sec. 2025-10-03 23:30:15 01428_hash_set_nan_key: [ OK ] 0.17 sec. 2025-10-03 23:30:15 00123_shard_unmerged_result_when_max_distributed_connections_is_one: [ OK ] 0.17 sec. 2025-10-03 23:30:15 00299_stripe_log_multiple_inserts: [ OK ] 0.32 sec. 2025-10-03 23:30:15 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.18 sec. 2025-10-03 23:30:15 02768_into_outfile_extensions_format: [ OK ] 0.37 sec. 2025-10-03 23:30:16 01710_order_by_projections_complete: [ OK ] 0.17 sec. 2025-10-03 23:30:16 00702_join_with_using_dups: [ OK ] 0.22 sec. 2025-10-03 23:30:16 01522_validate_alter_default: [ OK ] 0.17 sec. 2025-10-03 23:30:16 01322_cast_keep_nullable: [ OK ] 0.17 sec. 2025-10-03 23:30:16 02481_merge_array_join_sample_by: [ OK ] 0.22 sec. 2025-10-03 23:30:16 02515_distinct_zero_size_key_bug_44831: [ OK ] 0.12 sec. 2025-10-03 23:30:16 01533_distinct_depends_on_max_threads: [ OK ] 0.37 sec. 2025-10-03 23:30:17 03096_update_non_indexed_columns: [ OK ] 0.22 sec. 2025-10-03 23:30:17 01086_odbc_roundtrip: [ SKIPPED ] 0.00 sec. 2025-10-03 23:30:17 Reason: not running for current build 2025-10-03 23:30:17 01655_agg_if_nullable: [ OK ] 0.17 sec. 2025-10-03 23:30:17 01423_if_nullable_cond: [ OK ] 0.12 sec. 2025-10-03 23:30:17 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 2.43 sec. 2025-10-03 23:30:17 02146_mv_non_phys: [ OK ] 0.12 sec. 2025-10-03 23:30:17 02842_filesystem_cache_validate_path: [ OK ] 0.17 sec. 2025-10-03 23:30:17 02008_aliased_column_distributed_bug: [ OK ] 0.17 sec. 2025-10-03 23:30:17 02833_array_join_columns: [ OK ] 0.17 sec. 2025-10-03 23:30:18 03200_memory_engine_alter_dynamic: [ OK ] 0.17 sec. 2025-10-03 23:30:18 02864_replace_regexp_string_fallback: [ OK ] 0.17 sec. 2025-10-03 23:30:18 02192_comment_error: [ OK ] 0.62 sec. 2025-10-03 23:30:18 02456_datetime_schema_inference: [ OK ] 0.19 sec. 2025-10-03 23:30:18 03196_local_memory_limit: [ OK ] 0.52 sec. 2025-10-03 23:30:18 02388_analyzer_recursive_lambda: [ OK ] 0.12 sec. 2025-10-03 23:30:19 01669_test_toYear_mysql_dialect: [ OK ] 0.12 sec. 2025-10-03 23:30:19 01921_test_progress_bar: [ OK ] 0.47 sec. 2025-10-03 23:30:19 00995_optimize_read_in_order_with_aggregation: [ OK ] 0.17 sec. 2025-10-03 23:30:19 01056_prepared_statements_null_and_escaping: [ OK ] 0.42 sec. 2025-10-03 23:30:19 01073_attach_if_not_exists: [ OK ] 0.17 sec. 2025-10-03 23:30:20 00956_sensitive_data_masking: [ OK ] 3.58 sec. 2025-10-03 23:30:20 00764_max_query_size_allocation: [ OK ] 0.32 sec. 2025-10-03 23:30:20 00311_array_primary_key: [ OK ] 0.22 sec. 2025-10-03 23:30:20 03032_async_backup_restore: [ OK ] 1.02 sec. 2025-10-03 23:30:20 02794_pushdown_invalid_get: [ OK ] 0.12 sec. 2025-10-03 23:30:20 02459_read_in_order_bufer: [ OK ] 0.17 sec. 2025-10-03 23:30:20 01318_map_add_map_subtract: [ OK ] 0.32 sec. 2025-10-03 23:30:20 02498_storage_join_key_positions: [ OK ] 0.52 sec. 2025-10-03 23:30:21 02478_projection_with_group_by_alter: [ OK ] 0.32 sec. 2025-10-03 23:30:21 03023_invalid_format_detection: [ OK ] 0.47 sec. 2025-10-03 23:30:21 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.17 sec. 2025-10-03 23:30:21 01069_insert_float_as_nullable_unit8: [ OK ] 0.17 sec. 2025-10-03 23:30:21 02943_use_full_text_skip_index_with_has_any: [ OK ] 0.27 sec. 2025-10-03 23:30:21 00936_crc_functions: [ OK ] 0.22 sec. 2025-10-03 23:30:21 00975_json_hang: [ OK ] 0.32 sec. 2025-10-03 23:30:22 02730_with_fill_by_sorting_prefix: [ OK ] 0.32 sec. 2025-10-03 23:30:22 03033_analyzer_merge_engine_filter_push_down: [ OK ] 0.17 sec. 2025-10-03 23:30:22 01676_reinterpret_as: [ OK ] 0.32 sec. 2025-10-03 23:30:22 02805_distributed_queries_timeouts: [ OK ] 24.15 sec. 2025-10-03 23:30:22 02423_multidimensional_array_get_data_at: [ OK ] 0.17 sec. 2025-10-03 23:30:22 02452_json_utf8_validation: [ OK ] 0.27 sec. 2025-10-03 23:30:22 03031_table_function_fuzzquery: [ OK ] 0.12 sec. 2025-10-03 23:30:23 01358_mutation_delete_null_rows: [ OK ] 0.22 sec. 2025-10-03 23:30:23 02147_arrow_duplicate_columns: [ OK ] 0.67 sec. 2025-10-03 23:30:23 02287_ephemeral_format_crash: [ OK ] 0.17 sec. 2025-10-03 23:30:24 03001_bad_error_message_higher_order_functions: [ OK ] 0.42 sec. 2025-10-03 23:30:24 00098_h_union_all: [ OK ] 0.12 sec. 2025-10-03 23:30:24 02282_array_distance: [ OK ] 0.47 sec. 2025-10-03 23:30:24 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.12 sec. 2025-10-03 23:30:25 02164_materialized_view_support_virtual_column: [ OK ] 0.17 sec. 2025-10-03 23:30:25 02798_generic_transform: [ OK ] 0.17 sec. 2025-10-03 23:30:26 02930_client_file_log_comment: [ OK ] 0.83 sec. 2025-10-03 23:30:26 02049_clickhouse_local_merge_tree: [ OK ] 0.57 sec. 2025-10-03 23:30:27 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.22 sec. 2025-10-03 23:30:27 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.17 sec. 2025-10-03 23:30:27 03209_json_type_horizontal_merges: [ OK ] 7.00 sec. 2025-10-03 23:30:27 03168_cld2_tsan: [ OK ] 0.12 sec. 2025-10-03 23:30:27 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.17 sec. 2025-10-03 23:30:28 01923_different_expression_name_alias: [ OK ] 0.17 sec. 2025-10-03 23:30:28 01457_min_index_granularity_bytes_setting: [ OK ] 0.17 sec. 2025-10-03 23:30:28 01555_system_distribution_queue_mask: [ OK ] 0.27 sec. 2025-10-03 23:30:28 02845_prewhere_preserve_column: [ OK ] 0.12 sec. 2025-10-03 23:30:28 01820_unhex_case_insensitive: [ OK ] 0.12 sec. 2025-10-03 23:30:29 01651_lc_insert_tiny_log_1: [ OK ] 2.13 sec. 2025-10-03 23:30:29 00183_skip_unavailable_shards: [ OK ] 24.16 sec. 2025-10-03 23:30:29 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.27 sec. 2025-10-03 23:30:29 03287_dynamic_and_json_squashing_fix: [ OK ] 0.27 sec. 2025-10-03 23:30:29 02923_cte_equality_disjunction: [ OK ] 0.12 sec. 2025-10-03 23:30:30 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.37 sec. 2025-10-03 23:30:30 01910_view_dictionary_check_refresh: [ OK ] 24.21 sec. 2025-10-03 23:30:30 02336_sort_optimization_with_fill: [ OK ] 0.12 sec. 2025-10-03 23:30:30 00625_query_in_form_data: [ OK ] 0.32 sec. 2025-10-03 23:30:30 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.37 sec. 2025-10-03 23:30:30 01592_length_map: [ OK ] 0.17 sec. 2025-10-03 23:30:30 03203_system_numbers_limit_and_offset_simple: [ OK ] 0.12 sec. 2025-10-03 23:30:30 03010_read_system_parts_table_test: [ OK ] 0.17 sec. 2025-10-03 23:30:30 01554_row_number_after_cannot_read_all_data: [ OK ] 0.52 sec. 2025-10-03 23:30:31 02477_is_null_parser: [ OK ] 0.12 sec. 2025-10-03 23:30:31 03215_grant_current_grants: [ OK ] 1.12 sec. 2025-10-03 23:30:31 02316_literal_no_octal: [ OK ] 0.12 sec. 2025-10-03 23:30:31 02919_segfault_nullable_materialized_update: [ OK ] 0.22 sec. 2025-10-03 23:30:31 03098_prefer_column_to_alias_subquery: [ OK ] 0.22 sec. 2025-10-03 23:30:31 02889_system_drop_format_schema: [ OK ] 0.12 sec. 2025-10-03 23:30:31 01317_no_password_in_command_line: [ OK ] 2.88 sec. 2025-10-03 23:30:31 02537_system_formats: [ OK ] 0.12 sec. 2025-10-03 23:30:31 02998_native_parquet_reader: [ OK ] 0.37 sec. 2025-10-03 23:30:31 02587_csv_big_numbers_inference: [ OK ] 0.12 sec. 2025-10-03 23:30:32 02224_s2_test_const_columns: [ OK ] 0.17 sec. 2025-10-03 23:30:32 02473_extract_low_cardinality_from_json: [ OK ] 0.12 sec. 2025-10-03 23:30:32 01475_mutation_with_if: [ OK ] 0.32 sec. 2025-10-03 23:30:32 00998_constraints_all_tables: [ OK ] 0.38 sec. 2025-10-03 23:30:32 00897_flatten: [ OK ] 0.17 sec. 2025-10-03 23:30:33 02801_backup_native_copy: [ OK ] 2.03 sec. 2025-10-03 23:30:33 00278_insert_already_sorted: [ OK ] 0.32 sec. 2025-10-03 23:30:33 02905_show_setting_query: [ OK ] 0.17 sec. 2025-10-03 23:30:33 00627_recursive_alias: [ OK ] 0.12 sec. 2025-10-03 23:30:34 00900_orc_arrow_parquet_tuples: [ OK ] 1.88 sec. 2025-10-03 23:30:34 02783_date_predicate_optimizations: [ OK ] 1.02 sec. 2025-10-03 23:30:34 02234_position_case_insensitive_utf8: [ OK ] 0.17 sec. 2025-10-03 23:30:34 01710_normal_projection_fix1: [ OK ] 0.39 sec. 2025-10-03 23:30:34 02343_create_empty_as_select: [ OK ] 0.23 sec. 2025-10-03 23:30:34 01021_only_tuple_columns: [ OK ] 0.50 sec. 2025-10-03 23:30:35 02231_hierarchical_dictionaries_constant: [ OK ] 0.38 sec. 2025-10-03 23:30:35 03231_prewhere_conditions_order: [ OK ] 0.17 sec. 2025-10-03 23:30:35 01825_type_json_multiple_files: [ OK ] 1.98 sec. 2025-10-03 23:30:35 02734_optimize_group_by: [ OK ] 0.17 sec. 2025-10-03 23:30:35 00451_left_array_join_and_constants: [ OK ] 0.12 sec. 2025-10-03 23:30:35 01076_predicate_optimizer_with_view: [ OK ] 0.17 sec. 2025-10-03 23:30:35 00389_concat_operator: [ OK ] 0.12 sec. 2025-10-03 23:30:35 01055_compact_parts_1: [ OK ] 0.22 sec. 2025-10-03 23:30:35 01246_finalize_aggregation_race: [ OK ] 0.17 sec. 2025-10-03 23:30:35 03269_partition_key_not_in_set: [ OK ] 0.42 sec. 2025-10-03 23:30:35 03220_replace_formatting: [ OK ] 0.37 sec. 2025-10-03 23:30:35 02661_read_from_archive_tzst: [ OK ] 4.09 sec. 2025-10-03 23:30:35 02580_like_substring_search_bug: [ OK ] 0.12 sec. 2025-10-03 23:30:35 02230_create_table_as_ignore_ttl: [ OK ] 0.17 sec. 2025-10-03 23:30:36 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.17 sec. 2025-10-03 23:30:36 02427_column_nullable_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:30:36 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.17 sec. 2025-10-03 23:30:36 03143_ttl_in_system_parts_columns_table: [ OK ] 0.17 sec. 2025-10-03 23:30:36 02861_join_on_nullsafe_compare: [ OK ] 0.52 sec. 2025-10-03 23:30:36 01495_subqueries_in_with_statement: [ OK ] 0.32 sec. 2025-10-03 23:30:36 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.32 sec. 2025-10-03 23:30:36 01342_query_parameters_alias: [ OK ] 0.42 sec. 2025-10-03 23:30:36 00500_point_in_polygon: [ OK ] 0.32 sec. 2025-10-03 23:30:36 00908_analyze_query: [ OK ] 0.17 sec. 2025-10-03 23:30:36 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.12 sec. 2025-10-03 23:30:36 00362_great_circle_distance: [ OK ] 0.17 sec. 2025-10-03 23:30:36 00506_shard_global_in_union: [ OK ] 0.32 sec. 2025-10-03 23:30:37 02377_modify_column_from_lc: [ OK ] 0.27 sec. 2025-10-03 23:30:37 00700_to_decimal_or_something_1: [ OK ] 0.72 sec. 2025-10-03 23:30:37 01500_StorageFile_write_to_fd: [ OK ] 0.42 sec. 2025-10-03 23:30:37 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.17 sec. 2025-10-03 23:30:37 03161_cnf_reduction: [ OK ] 0.27 sec. 2025-10-03 23:30:38 03003_analyzer_setting: [ OK ] 0.12 sec. 2025-10-03 23:30:38 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.32 sec. 2025-10-03 23:30:38 00543_access_to_temporary_table_in_readonly_mode: [ OK ] 1.37 sec. 2025-10-03 23:30:38 02271_int_sql_compatibility: [ OK ] 0.17 sec. 2025-10-03 23:30:38 01881_negate_formatting: [ OK ] 0.17 sec. 2025-10-03 23:30:38 03246_json_subcolumn_correct_type: [ OK ] 0.17 sec. 2025-10-03 23:30:38 00700_decimal_defaults: [ OK ] 0.17 sec. 2025-10-03 23:30:38 01867_support_datetime64_version_column: [ OK ] 0.22 sec. 2025-10-03 23:30:38 02294_system_certificates: [ OK ] 0.12 sec. 2025-10-03 23:30:38 02118_show_create_table_rocksdb: [ OK ] 0.12 sec. 2025-10-03 23:30:39 02361_fsync_profile_events: [ OK ] 0.72 sec. 2025-10-03 23:30:39 03014_async_with_dedup_part_log_rmt: [ OK ] 1.22 sec. 2025-10-03 23:30:39 01354_order_by_tuple_collate_const: [ OK ] 0.12 sec. 2025-10-03 23:30:40 02668_parse_datetime: [ OK ] 0.62 sec. 2025-10-03 23:30:40 03155_datasketches_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:30:41 02118_deserialize_whole_text: [ OK ] 2.39 sec. 2025-10-03 23:30:41 00982_array_enumerate_uniq_ranked: [ OK ] 0.12 sec. 2025-10-03 23:30:41 01343_min_bytes_to_use_mmap_io: [ OK ] 0.27 sec. 2025-10-03 23:30:41 02841_not_ready_set_bug: [ OK ] 1.13 sec. 2025-10-03 23:30:42 02907_http_exception_json_bug: [ OK ] 0.37 sec. 2025-10-03 23:30:42 00053_all_inner_join: [ OK ] 0.12 sec. 2025-10-03 23:30:42 00590_limit_by_column_removal: [ OK ] 0.17 sec. 2025-10-03 23:30:42 02998_primary_key_skip_columns: [ OK ] 113.75 sec. 2025-10-03 23:30:42 00908_bloom_filter_index: [ OK ] 5.89 sec. 2025-10-03 23:30:42 00716_allow_ddl: [ OK ] 0.17 sec. 2025-10-03 23:30:42 02710_allow_suspicious_indices: [ OK ] 0.27 sec. 2025-10-03 23:30:43 01735_to_datetime64: [ OK ] 0.32 sec. 2025-10-03 23:30:43 02465_limit_trivial_max_rows_to_read: [ OK ] 0.23 sec. 2025-10-03 23:30:43 00753_alter_attach: [ OK ] 0.98 sec. 2025-10-03 23:30:43 00171_shard_array_of_tuple_remote: [ OK ] 0.17 sec. 2025-10-03 23:30:44 02475_analyzer_join_tree_subquery: [ OK ] 0.18 sec. 2025-10-03 23:30:44 01509_format_raw_blob: [ OK ] 0.74 sec. 2025-10-03 23:30:44 00712_prewhere_with_alias_and_virtual_column: [ OK ] 0.18 sec. 2025-10-03 23:30:44 01825_type_json_add_column: [ SKIPPED ] 0.00 sec. 2025-10-03 23:30:44 Reason: disabled 2025-10-03 23:30:44 02149_read_in_order_fixed_prefix_negative: [ OK ] 1.58 sec. 2025-10-03 23:30:44 01390_check_table_codec: [ OK ] 0.22 sec. 2025-10-03 23:30:44 02721_url_cluster: [ OK ] 0.43 sec. 2025-10-03 23:30:44 00720_with_cube: [ OK ] 0.22 sec. 2025-10-03 23:30:44 01493_table_function_null: [ OK ] 0.12 sec. 2025-10-03 23:30:44 01951_distributed_push_down_limit: [ OK ] 0.17 sec. 2025-10-03 23:30:44 01440_big_int_shift: [ OK ] 0.13 sec. 2025-10-03 23:30:45 02735_asof_join_right_null: [ OK ] 0.22 sec. 2025-10-03 23:30:45 02481_i43247_ubsan_in_minmaxany: [ OK ] 0.12 sec. 2025-10-03 23:30:45 02591_protobuf_nested_arrays: [ OK ] 0.53 sec. 2025-10-03 23:30:45 01033_quota_dcl: [ OK ] 0.13 sec. 2025-10-03 23:30:45 02187_async_inserts_all_formats: [ OK ] 46.07 sec. 2025-10-03 23:30:45 02968_mysql_show_warnings: [ OK ] 0.63 sec. 2025-10-03 23:30:46 02006_client_test_hint_no_such_error_name: [ OK ] 0.37 sec. 2025-10-03 23:30:46 02319_lightweight_delete_on_merge_tree: [ OK ] 0.77 sec. 2025-10-03 23:30:46 01134_set_overflow_mode: [ OK ] 0.17 sec. 2025-10-03 23:30:46 01010_pmj_one_row_blocks: [ OK ] 0.77 sec. 2025-10-03 23:30:46 02459_low_cardinality_uint128_aggregator: [ OK ] 0.32 sec. 2025-10-03 23:30:46 01661_join_complex: [ OK ] 0.33 sec. 2025-10-03 23:30:48 02177_issue_31009: [ OK ] 7.21 sec. 2025-10-03 23:30:48 02266_protobuf_format_google_wrappers: [ OK ] 2.33 sec. 2025-10-03 23:30:48 02771_skip_empty_files: [ OK ] 1.89 sec. 2025-10-03 23:30:48 01281_sum_nullable: [ OK ] 0.17 sec. 2025-10-03 23:30:49 02161_array_first_last: [ OK ] 0.23 sec. 2025-10-03 23:30:49 02813_any_value: [ OK ] 0.12 sec. 2025-10-03 23:30:49 01073_blockSerializedSize: [ OK ] 0.52 sec. 2025-10-03 23:30:49 00181_aggregate_functions_statistics: [ OK ] 0.42 sec. 2025-10-03 23:30:49 01657_array_element_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:30:49 00756_power_alias: [ OK ] 0.17 sec. 2025-10-03 23:30:49 02287_type_object_convert: [ OK ] 0.27 sec. 2025-10-03 23:30:49 01376_array_fill_empty: [ OK ] 0.20 sec. 2025-10-03 23:30:49 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.23 sec. 2025-10-03 23:30:50 02532_send_logs_level_test: [ OK ] 0.83 sec. 2025-10-03 23:30:50 02391_hashed_dictionary_shards: [ OK ] 0.58 sec. 2025-10-03 23:30:50 02902_diable_apply_deleted_mask: [ OK ] 0.22 sec. 2025-10-03 23:30:50 02129_skip_quoted_fields: [ OK ] 3.74 sec. 2025-10-03 23:30:50 02479_analyzer_join_with_constants: [ OK ] 0.22 sec. 2025-10-03 23:30:52 02122_parallel_formatting_JSONCompactStrings: [ OK ] 1.58 sec. 2025-10-03 23:30:52 00028_shard_big_agg_aj_distributed: [ OK ] 0.27 sec. 2025-10-03 23:30:52 01658_values_ubsan: [ OK ] 0.13 sec. 2025-10-03 23:30:52 01603_read_with_backoff_bug: [ OK ] 13.38 sec. 2025-10-03 23:30:52 01081_keywords_formatting: [ OK ] 0.17 sec. 2025-10-03 23:30:52 00069_date_arithmetic: [ OK ] 0.23 sec. 2025-10-03 23:30:52 00978_ml_math: [ OK ] 0.12 sec. 2025-10-03 23:30:53 02932_query_settings_max_size_drop: [ OK ] 0.37 sec. 2025-10-03 23:30:53 00196_float32_formatting: [ OK ] 0.23 sec. 2025-10-03 23:30:55 00900_orc_load: [ OK ] 1.48 sec. 2025-10-03 23:30:55 02954_analyzer_fuzz_i57086: [ OK ] 0.17 sec. 2025-10-03 23:30:55 01019_parallel_parsing_cancel: [ OK ] 4.60 sec. 2025-10-03 23:30:55 00984_parser_stack_overflow: [ OK ] 2.59 sec. 2025-10-03 23:30:55 02155_parse_date_lowcard_default_throw: [ OK ] 0.17 sec. 2025-10-03 23:30:55 00048_a_stored_aggregates_merge: [ OK ] 0.28 sec. 2025-10-03 23:30:55 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 0.57 sec. 2025-10-03 23:30:55 00525_aggregate_functions_of_nullable_that_return_non_nullable: [ OK ] 0.13 sec. 2025-10-03 23:30:55 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.17 sec. 2025-10-03 23:30:56 02160_monthname: [ OK ] 0.17 sec. 2025-10-03 23:30:56 02425_categorical_information_value_properties: [ OK ] 0.22 sec. 2025-10-03 23:30:56 00467_qualified_names: [ OK ] 0.22 sec. 2025-10-03 23:30:56 02462_match_regexp_pk: [ OK ] 0.17 sec. 2025-10-03 23:30:56 02368_cancel_write_into_hdfs: [ OK ] 5.86 sec. 2025-10-03 23:30:56 02474_fix_function_parser_bug: [ OK ] 0.13 sec. 2025-10-03 23:30:56 02243_make_date32_mysql: [ OK ] 0.32 sec. 2025-10-03 23:30:56 02900_window_function_with_sparse_column: [ OK ] 0.24 sec. 2025-10-03 23:30:56 01605_drop_settings_profile_while_assigned: [ OK ] 0.17 sec. 2025-10-03 23:30:56 00206_empty_array_to_single: [ OK ] 0.12 sec. 2025-10-03 23:30:56 01770_add_months_ubsan: [ OK ] 0.17 sec. 2025-10-03 23:30:56 00749_inner_join_of_unnamed_subqueries: [ OK ] 0.22 sec. 2025-10-03 23:30:57 02319_dict_get_check_arguments_size: [ OK ] 0.27 sec. 2025-10-03 23:30:58 00909_ngram_distance: [ OK ] 0.88 sec. 2025-10-03 23:30:58 02786_max_execution_time_leaf: [ OK ] 2.13 sec. 2025-10-03 23:30:58 02472_segfault_expression_parser: [ OK ] 0.12 sec. 2025-10-03 23:30:58 02861_replacing_merge_tree_with_cleanup: [ OK ] 0.17 sec. 2025-10-03 23:30:58 02293_http_header_full_summary_without_progress: [ OK ] 1.38 sec. 2025-10-03 23:30:58 00950_test_gorilla_codec: [ OK ] 0.22 sec. 2025-10-03 23:30:58 02718_array_fold: [ OK ] 0.32 sec. 2025-10-03 23:30:58 01396_low_cardinality_fixed_string_default: [ OK ] 0.17 sec. 2025-10-03 23:30:58 02373_analyzer_join_use_nulls: [ OK ] 0.27 sec. 2025-10-03 23:30:59 01825_type_json_nullable: [ OK ] 0.22 sec. 2025-10-03 23:30:59 01457_compile_expressions_fuzzer: [ OK ] 0.12 sec. 2025-10-03 23:30:59 02668_parse_datetime_in_joda_syntax: [ OK ] 0.92 sec. 2025-10-03 23:30:59 01509_output_format_pretty_row_numbers: [ OK ] 0.27 sec. 2025-10-03 23:30:59 00040_array_enumerate_uniq: [ OK ] 0.52 sec. 2025-10-03 23:30:59 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.28 sec. 2025-10-03 23:30:59 00814_parsing_ub: [ OK ] 0.17 sec. 2025-10-03 23:31:00 00754_alter_modify_column_partitions: [ OK ] 0.47 sec. 2025-10-03 23:31:00 00033_fixed_string_to_string: [ OK ] 0.12 sec. 2025-10-03 23:31:02 00093_union_race_conditions_4: [ OK ] 1.68 sec. 2025-10-03 23:31:02 01521_max_length_alias: [ OK ] 0.17 sec. 2025-10-03 23:31:02 00728_json_each_row_parsing: [ OK ] 5.85 sec. 2025-10-03 23:31:02 02027_arrayCumSumNonNegative_const: [ OK ] 0.12 sec. 2025-10-03 23:31:02 03009_consecutive_keys_nullable: [ OK ] 0.57 sec. 2025-10-03 23:31:03 02668_logical_optimizer_removing_redundant_checks: [ OK ] 0.17 sec. 2025-10-03 23:31:03 02434_cancel_insert_when_client_dies: [ OK ] 41.60 sec. 2025-10-03 23:31:03 01051_window_view_parser_hop: [ OK ] 0.52 sec. 2025-10-03 23:31:03 02884_interval_operator_support_plural_literal: [ OK ] 0.22 sec. 2025-10-03 23:31:04 02016_agg_empty_result_bug_28880: [ OK ] 0.17 sec. 2025-10-03 23:31:04 00725_comment_columns_long: [ OK ] 0.22 sec. 2025-10-03 23:31:04 01666_blns_long: [ OK ] 0.68 sec. 2025-10-03 23:31:04 02432_s3_parallel_parts_cleanup: [ OK ] 41.21 sec. 2025-10-03 23:31:04 02982_perf_introspection_for_inserts: [ OK ] 1.63 sec. 2025-10-03 23:31:04 00825_http_header_query_id: [ OK ] 0.32 sec. 2025-10-03 23:31:04 03171_indexing_by_hilbert_curve: [ OK ] 0.37 sec. 2025-10-03 23:31:04 02771_log_faminy_truncate_count: [ OK ] 0.17 sec. 2025-10-03 23:31:04 01881_create_as_tuple: [ OK ] 0.17 sec. 2025-10-03 23:31:04 02709_generate_random_valid_decimals_and_bools: [ OK ] 0.17 sec. 2025-10-03 23:31:04 01066_bit_count: [ OK ] 0.17 sec. 2025-10-03 23:31:04 01572_kill_window_function: [ OK ] 0.57 sec. 2025-10-03 23:31:05 02346_fulltext_index_bug52019: [ OK ] 0.17 sec. 2025-10-03 23:31:05 00806_alter_update: [ OK ] 0.17 sec. 2025-10-03 23:31:05 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.12 sec. 2025-10-03 23:31:05 02956_format_constexpr: [ OK ] 0.12 sec. 2025-10-03 23:31:05 03015_analyzer_groupby_fuzz_60772: [ OK ] 0.12 sec. 2025-10-03 23:31:05 01868_order_by_fill_with_datetime64: [ OK ] 0.12 sec. 2025-10-03 23:31:05 01375_null_issue_3767: [ OK ] 0.17 sec. 2025-10-03 23:31:05 01040_h3_get_resolution: [ OK ] 0.17 sec. 2025-10-03 23:31:05 01018_ddl_dictionaries_special: [ OK ] 0.37 sec. 2025-10-03 23:31:05 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.12 sec. 2025-10-03 23:31:05 01353_nullable_tuple: [ OK ] 0.52 sec. 2025-10-03 23:31:05 02152_count_distinct_optimization: [ OK ] 0.22 sec. 2025-10-03 23:31:06 02435_rollback_cancelled_queries: [ OK ] 21.49 sec. 2025-10-03 23:31:06 02010_lc_native: [ OK ] 0.92 sec. 2025-10-03 23:31:06 00055_join_two_numbers: [ OK ] 0.12 sec. 2025-10-03 23:31:06 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.32 sec. 2025-10-03 23:31:06 00765_locate: [ OK ] 0.22 sec. 2025-10-03 23:31:06 02716_drop_if_empty: [ OK ] 0.22 sec. 2025-10-03 23:31:06 00153_transform: [ OK ] 0.22 sec. 2025-10-03 23:31:06 00942_mutate_index: [ OK ] 1.18 sec. 2025-10-03 23:31:06 02013_bloom_filter_hasAll: [ OK ] 0.22 sec. 2025-10-03 23:31:06 02503_in_lc_const_args_bug: [ OK ] 0.12 sec. 2025-10-03 23:31:06 02467_cross_join_three_table_functions: [ OK ] 0.12 sec. 2025-10-03 23:31:07 02840_grace_hash_join_structure_mismatch: [ OK ] 0.17 sec. 2025-10-03 23:31:07 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.12 sec. 2025-10-03 23:31:07 00552_logical_functions_ternary: [ OK ] 0.17 sec. 2025-10-03 23:31:07 01049_join_low_card_crash: [ OK ] 0.22 sec. 2025-10-03 23:31:07 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.17 sec. 2025-10-03 23:31:07 00415_into_outfile: [ OK ] 1.07 sec. 2025-10-03 23:31:08 02995_preliminary_filters_duplicated_columns: [ OK ] 0.17 sec. 2025-10-03 23:31:08 01720_union_distinct_with_limit: [ OK ] 0.17 sec. 2025-10-03 23:31:08 00672_arrayDistinct: [ OK ] 0.17 sec. 2025-10-03 23:31:08 02015_async_inserts_7: [ OK ] 0.78 sec. 2025-10-03 23:31:08 01866_aggregate_function_interval_length_sum: [ OK ] 0.27 sec. 2025-10-03 23:31:09 00843_optimize_predicate_and_rename_table: [ OK ] 0.22 sec. 2025-10-03 23:31:09 01277_alter_rename_column_constraint: [ OK ] 0.37 sec. 2025-10-03 23:31:09 01046_materialized_view_with_join_over_distributed: [ OK ] 0.22 sec. 2025-10-03 23:31:09 02277_full_sort_join_misc: [ OK ] 0.17 sec. 2025-10-03 23:31:09 02244_make_datetime: [ OK ] 0.37 sec. 2025-10-03 23:31:11 00534_functions_bad_arguments9: [ OK ] 6.14 sec. 2025-10-03 23:31:12 02494_zero_copy_projection_cancel_fetch: [ OK ] 22.78 sec. 2025-10-03 23:31:13 02155_csv_with_strings_with_slash: [ OK ] 1.65 sec. 2025-10-03 23:31:13 01246_extractAllGroupsVertical: [ OK ] 0.34 sec. 2025-10-03 23:31:14 02973_parse_crlf_with_tsv_files: [ OK ] 1.33 sec. 2025-10-03 23:31:14 01666_lcm_ubsan: [ OK ] 0.27 sec. 2025-10-03 23:31:14 00614_shard_same_header_for_local_and_remote_node_in_distributed_query: [ OK ] 0.27 sec. 2025-10-03 23:31:14 02316_cast_to_ip_address_default_column: [ OK ] 0.27 sec. 2025-10-03 23:31:14 02381_parse_array_of_tuples: [ OK ] 0.19 sec. 2025-10-03 23:31:14 01496_signedness_conversion_monotonicity: [ OK ] 0.28 sec. 2025-10-03 23:31:15 00578_merge_trees_without_primary_key: [ OK ] 0.47 sec. 2025-10-03 23:31:15 01195_formats_diagnostic_info: [ OK ] 8.50 sec. 2025-10-03 23:31:15 02916_analyzer_set_in_join: [ OK ] 0.22 sec. 2025-10-03 23:31:15 00032_fixed_string_to_string: [ OK ] 0.24 sec. 2025-10-03 23:31:15 01470_columns_transformers: [ OK ] 0.94 sec. 2025-10-03 23:31:16 00534_functions_bad_arguments4_long: [ OK ] 6.87 sec. 2025-10-03 23:31:16 01502_jemalloc_percpu_arena: [ OK ] 1.13 sec. 2025-10-03 23:31:17 01532_tuple_with_name_type: [ OK ] 0.33 sec. 2025-10-03 23:31:18 03036_test_parquet_bloom_filter_push_down_ipv6: [ OK ] 2.09 sec. 2025-10-03 23:31:18 02122_parallel_formatting_JSONStrings: [ OK ] 3.34 sec. 2025-10-03 23:31:19 00621_regression_for_in_operator: [ OK ] 0.32 sec. 2025-10-03 23:31:19 00254_tuple_extremes: [ OK ] 0.27 sec. 2025-10-03 23:31:19 01516_drop_table_stress_long: [ OK ] 20.55 sec. 2025-10-03 23:31:19 00957_coalesce_const_nullable_crash: [ OK ] 0.32 sec. 2025-10-03 23:31:22 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 2.89 sec. 2025-10-03 23:31:23 00407_parsing_nulls: [ OK ] 5.67 sec. 2025-10-03 23:31:23 02962_indexHint_rpn_construction: [ OK ] 0.50 sec. 2025-10-03 23:31:23 02662_sparse_columns_mutations_5: [ OK ] 0.60 sec. 2025-10-03 23:31:24 02188_parser_dictionary_primary_key: [ OK ] 0.64 sec. 2025-10-03 23:31:25 02377_majority_insert_quorum_zookeeper_long: [ OK ] 5.86 sec. 2025-10-03 23:31:25 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.99 sec. 2025-10-03 23:31:26 02319_lightweight_delete_on_merge_tree_compact_parts: [ OK ] 1.35 sec. 2025-10-03 23:31:27 02343_group_by_use_nulls: [ OK ] 0.39 sec. 2025-10-03 23:31:28 01053_if_chain_check: [ OK ] 0.45 sec. 2025-10-03 23:31:28 02661_read_from_archive_tar: [ OK ] 11.65 sec. 2025-10-03 23:31:29 01874_select_from_trailing_whitespaces: [ OK ] 3.64 sec. 2025-10-03 23:31:29 00808_array_enumerate_segfault: [ OK ] 0.43 sec. 2025-10-03 23:31:29 01231_log_queries_min_type: [ OK ] 5.38 sec. 2025-10-03 23:31:29 01702_bitmap_native_integers: [ OK ] 0.33 sec. 2025-10-03 23:31:29 02179_degrees_radians: [ OK ] 0.39 sec. 2025-10-03 23:31:29 01533_quantile_deterministic_assert: [ OK ] 0.39 sec. 2025-10-03 23:31:30 03201_local_named_collections: [ OK ] 2.05 sec. 2025-10-03 23:31:30 01234_to_string_monotonic: [ OK ] 0.60 sec. 2025-10-03 23:31:30 00906_low_cardinality_rollup: [ OK ] 0.49 sec. 2025-10-03 23:31:30 00738_nested_merge_multidimensional_array: [ OK ] 0.44 sec. 2025-10-03 23:31:31 01762_deltasumtimestamp_datetime64: [ OK ] 1.44 sec. 2025-10-03 23:31:31 00625_arrays_in_nested: [ OK ] 0.71 sec. 2025-10-03 23:31:31 01889_key_condition_function_chains: [ OK ] 0.63 sec. 2025-10-03 23:31:31 00534_functions_bad_arguments13: [ OK ] 13.33 sec. 2025-10-03 23:31:31 02001_shard_num_shard_count: [ OK ] 0.47 sec. 2025-10-03 23:31:32 01323_if_with_nulls: [ OK ] 0.49 sec. 2025-10-03 23:31:32 02725_any_join_single_row: [ OK ] 0.64 sec. 2025-10-03 23:31:32 00138_table_aliases: [ OK ] 0.28 sec. 2025-10-03 23:31:32 02733_distinct: [ OK ] 0.29 sec. 2025-10-03 23:31:32 02593_bson_more_types: [ OK ] 2.21 sec. 2025-10-03 23:31:32 03215_key_condition_bug: [ OK ] 0.34 sec. 2025-10-03 23:31:32 01825_type_json_parallel_insert: [ OK ] 0.59 sec. 2025-10-03 23:31:33 00649_quantile_tdigest_negative: [ OK ] 0.24 sec. 2025-10-03 23:31:33 00141_parse_timestamp_as_datetime: [ OK ] 0.35 sec. 2025-10-03 23:31:33 01272_totals_and_filter_bug: [ OK ] 0.34 sec. 2025-10-03 23:31:33 02677_analyzer_bitmap_has_any: [ OK ] 0.29 sec. 2025-10-03 23:31:33 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.30 sec. 2025-10-03 23:31:34 00165_transform_non_const_default: [ OK ] 0.46 sec. 2025-10-03 23:31:34 03223_nested_json_in_shared_data_merges: [ OK ] 0.57 sec. 2025-10-03 23:31:34 01010_low_cardinality_and_native_http: [ OK ] 3.44 sec. 2025-10-03 23:31:34 02366_window_function_order_by: [ OK ] 0.34 sec. 2025-10-03 23:31:35 03273_dictionary_rbac: [ OK ] 2.62 sec. 2025-10-03 23:31:36 00910_client_window_size_detection: [ OK ] 0.97 sec. 2025-10-03 23:31:36 02972_to_string_nullable_timezone: [ OK ] 0.22 sec. 2025-10-03 23:31:37 02933_sqid: [ OK ] 2.82 sec. 2025-10-03 23:31:37 02238_lz4_bug: [ OK ] 4.98 sec. 2025-10-03 23:31:39 02461_cancel_finish_race: [ OK ] 30.37 sec. 2025-10-03 23:31:39 01889_clickhouse_client_config_format: [ OK ] 2.18 sec. 2025-10-03 23:31:40 02590_bson_duplicate_column: [ OK ] 0.12 sec. 2025-10-03 23:31:40 01624_soft_constraints: [ FAIL ] 5.46 sec. 2025-10-03 23:31:40 Reason: result differs with reference: 2025-10-03 23:31:40 --- /usr/share/clickhouse-test/queries/0_stateless/01624_soft_constraints.reference 2025-10-03 23:13:23.187410800 +0100 2025-10-03 23:31:40 +++ /tmp/clickhouse-test/0_stateless/01624_soft_constraints.stdout 2025-10-03 23:31:40.244806404 +0100 2025-10-03 23:31:40 @@ -1,16 +1,16 @@ 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 2, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 2, 2025-10-03 23:31:40 - "rows_read": 2, 2025-10-03 23:31:40 - "rows_read": 2, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 2, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 1, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 3, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 "rows_read": 4, 2025-10-03 23:31:40 - "rows_read": 3, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 + "rows_read": 4, 2025-10-03 23:31:40 2025-10-03 23:31:40 2025-10-03 23:31:40 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 886097 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 12882457 --max_read_buffer_size 835506 --prefer_localhost_replica 0 --max_block_size 82186 --max_joined_block_size_rows 95534 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 8 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 5780039 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 1629356800 --local_filesystem_read_method pread --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 23 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2978180429 --min_compress_block_size 753664 --max_compress_block_size 1226297 --merge_tree_compact_parts_min_granules_to_multibuffer_read 25 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 3982650 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone Mexico/BajaSur --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.22 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 0 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1 2025-10-03 23:31:40 2025-10-03 23:31:40 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 8536431 --merge_max_block_size 1125 --index_granularity 61681 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 9370 --primary_key_compress_block_size 98993 --replace_long_file_name_to_hash 0 --max_file_name_length 6 --min_bytes_for_full_part_storage 445223189 --compact_parts_max_bytes_to_buffer 5375667 --compact_parts_max_granules_to_buffer 256 --compact_parts_merge_max_bytes_to_prefetch_part 430049 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 456 2025-10-03 23:31:40 2025-10-03 23:31:40 Database: test_c7a15iui 2025-10-03 23:31:40 02565_update_empty_nested: [ OK ] 0.45 sec. 2025-10-03 23:31:40 00700_decimal_compare: [ OK ] 0.83 sec. 2025-10-03 23:31:40 02122_parallel_formatting_Template: [ OK ] 1.47 sec. 2025-10-03 23:31:41 01014_function_repeat_corner_cases: [ OK ] 0.39 sec. 2025-10-03 23:31:41 00718_low_cardinaliry_alter: [ OK ] 0.38 sec. 2025-10-03 23:31:41 03165_round_scale_as_column: [ OK ] 0.98 sec. 2025-10-03 23:31:42 03217_primary_index_memory_leak: [ OK ] 5.72 sec. 2025-10-03 23:31:42 02486_truncate_and_unexpected_parts: [ OK ] 1.39 sec. 2025-10-03 23:31:43 02510_group_by_prewhere_null: [ OK ] 0.44 sec. 2025-10-03 23:31:43 02841_parallel_final_wrong_columns_order: [ OK ] 1.12 sec. 2025-10-03 23:31:43 00354_host_command_line_option: [ OK ] 1.44 sec. 2025-10-03 23:31:43 00905_field_with_aggregate_function_state: [ OK ] 0.22 sec. 2025-10-03 23:31:43 02995_bad_formatting_union_intersect: [ OK ] 0.17 sec. 2025-10-03 23:31:43 02993_values_escape_quote: [ OK ] 0.22 sec. 2025-10-03 23:31:43 01140_select_from_storage_join_fix: [ OK ] 0.33 sec. 2025-10-03 23:31:43 02935_date_trunc_case_unsensitiveness: [ OK ] 0.43 sec. 2025-10-03 23:31:43 03040_alias_column_join: [ OK ] 0.18 sec. 2025-10-03 23:31:43 01833_test_collation_alvarotuso: [ OK ] 0.23 sec. 2025-10-03 23:31:43 02006_client_test_hint_error_name: [ OK ] 0.17 sec. 2025-10-03 23:31:44 00494_shard_alias_substitution_bug: [ OK ] 0.17 sec. 2025-10-03 23:31:44 01716_decimal_comparison_ubsan: [ OK ] 0.18 sec. 2025-10-03 23:31:44 00623_truncate_table: [ OK ] 0.58 sec. 2025-10-03 23:31:44 01001_enums_in_in_section: [ OK ] 0.18 sec. 2025-10-03 23:31:44 02371_analyzer_join_cross: [ OK ] 0.43 sec. 2025-10-03 23:31:44 02417_keeper_map_create_drop: [ OK ] 0.27 sec. 2025-10-03 23:31:44 00836_indices_alter_replicated_zookeeper_long: [ OK ] 2.19 sec. 2025-10-03 23:31:44 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.33 sec. 2025-10-03 23:31:44 02233_with_total_empty_chunk: [ OK ] 0.18 sec. 2025-10-03 23:31:44 01305_nullable-prewhere_bug: [ OK ] 0.17 sec. 2025-10-03 23:31:44 00644_different_expressions_with_same_alias: [ OK ] 0.18 sec. 2025-10-03 23:31:45 02810_system_jemalloc_bins: [ OK ] 0.22 sec. 2025-10-03 23:31:45 02466_distributed_query_profiler: [ OK ] 0.88 sec. 2025-10-03 23:31:45 01119_optimize_trivial_insert_select: [ OK ] 0.33 sec. 2025-10-03 23:31:45 02355_column_type_name_lc: [ OK ] 0.18 sec. 2025-10-03 23:31:46 02968_adaptive_async_insert_timeout: [ OK ] 1.22 sec. 2025-10-03 23:31:46 02122_parallel_formatting_TSV: [ OK ] 1.18 sec. 2025-10-03 23:31:46 02676_distinct_reading_in_order_analyzer: [ OK ] 0.17 sec. 2025-10-03 23:31:46 01345_array_join_LittleMaverick: [ OK ] 0.17 sec. 2025-10-03 23:31:46 01917_prewhere_column_type: [ OK ] 0.28 sec. 2025-10-03 23:31:46 01892_jit_aggregation_function_any_last_long: [ OK ] 0.83 sec. 2025-10-03 23:31:46 02476_fix_cast_parser_bug: [ OK ] 0.13 sec. 2025-10-03 23:31:47 02790_optimize_skip_unused_shards_join: [ OK ] 0.22 sec. 2025-10-03 23:31:47 02564_query_id_header: [ OK ] 0.74 sec. 2025-10-03 23:31:47 03031_distinguish_bool_and_int_in_settings: [ OK ] 0.38 sec. 2025-10-03 23:31:47 03200_subcolumns_join_use_nulls: [ OK ] 0.17 sec. 2025-10-03 23:31:47 02343_analyzer_lambdas_issue_28083: [ OK ] 0.23 sec. 2025-10-03 23:31:47 00092_union_race_conditions_3: [ OK ] 12.38 sec. 2025-10-03 23:31:47 02319_no_columns_in_row_level_filter: [ OK ] 0.48 sec. 2025-10-03 23:31:48 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 1.03 sec. 2025-10-03 23:31:48 01245_distributed_group_by_no_merge_with-extremes_and_totals: [ OK ] 1.13 sec. 2025-10-03 23:31:48 03054_analyzer_join_alias: [ OK ] 0.18 sec. 2025-10-03 23:31:49 02149_schema_inference_formats_with_schema_1: [ OK ] 11.78 sec. 2025-10-03 23:31:49 01825_type_json_6: [ OK ] 1.19 sec. 2025-10-03 23:31:49 02719_aggregate_with_empty_string_key: [ OK ] 0.17 sec. 2025-10-03 23:31:49 00156_array_map_to_constant: [ OK ] 0.17 sec. 2025-10-03 23:31:49 01471_limit_by_format: [ OK ] 0.13 sec. 2025-10-03 23:31:50 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.17 sec. 2025-10-03 23:31:50 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.39 sec. 2025-10-03 23:31:51 00695_pretty_max_column_pad_width: [ OK ] 0.17 sec. 2025-10-03 23:31:51 02513_parquet_orc_arrow_nullable_schema_inference: [ OK ] 1.08 sec. 2025-10-03 23:31:51 02538_ngram_bf_index_with_null: [ OK ] 0.17 sec. 2025-10-03 23:31:51 02574_suspicious_low_cardinality_msan: [ OK ] 0.28 sec. 2025-10-03 23:31:51 01073_bad_alter_partition: [ OK ] 0.28 sec. 2025-10-03 23:31:53 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 7.82 sec. 2025-10-03 23:31:53 02015_async_inserts_1: [ OK ] 4.31 sec. 2025-10-03 23:31:54 02353_compression_level: [ OK ] 3.39 sec. 2025-10-03 23:31:54 00600_replace_running_query: [ OK ] 1.69 sec. 2025-10-03 23:31:54 01637_nullable_fuzz3: [ OK ] 0.22 sec. 2025-10-03 23:31:55 01811_storage_buffer_flush_parameters: [ OK ] 1.99 sec. 2025-10-03 23:31:55 01560_mann_whitney: [ OK ] 0.22 sec. 2025-10-03 23:31:55 01852_cast_operator: [ OK ] 0.27 sec. 2025-10-03 23:31:55 02415_all_new_functions_must_be_documented: [ OK ] 0.12 sec. 2025-10-03 23:31:55 02993_lazy_index_loading: [ OK ] 1.03 sec. 2025-10-03 23:31:56 02124_json_each_row_with_progress: [ OK ] 0.68 sec. 2025-10-03 23:31:56 02354_distributed_with_external_aggregation_memory_usage: [ OK ] 50.67 sec. 2025-10-03 23:31:56 01825_new_type_json_multiple_files: [ OK ] 1.93 sec. 2025-10-03 23:31:56 00119_storage_join: [ OK ] 0.22 sec. 2025-10-03 23:31:57 02101_avro_union_index_out_of_boundary: [ OK ] 0.52 sec. 2025-10-03 23:31:57 02464_decimal_scale_buffer_overflow: [ OK ] 0.18 sec. 2025-10-03 23:31:57 02096_date_time_1970_saturation: [ OK ] 0.27 sec. 2025-10-03 23:31:57 02152_dictionary_date32_type: [ OK ] 0.22 sec. 2025-10-03 23:31:57 01675_data_type_coroutine: [ OK ] 8.32 sec. 2025-10-03 23:31:57 01393_benchmark_secure_port: [ OK ] 0.77 sec. 2025-10-03 23:31:57 00725_join_on_bug_3: [ OK ] 0.32 sec. 2025-10-03 23:31:57 02374_regexp_replace: [ OK ] 0.12 sec. 2025-10-03 23:31:57 01732_more_consistent_datetime64_parsing: [ OK ] 0.17 sec. 2025-10-03 23:31:57 02127_storage_join_settings_with_persistency: [ OK ] 0.17 sec. 2025-10-03 23:31:57 02015_async_inserts_4: [ OK ] 1.88 sec. 2025-10-03 23:31:57 00324_hashing_enums: [ OK ] 0.12 sec. 2025-10-03 23:31:57 01338_sha256_fixedstring: [ OK ] 0.17 sec. 2025-10-03 23:31:58 00921_datetime64_basic: [ OK ] 0.37 sec. 2025-10-03 23:31:58 02495_sum_if_to_count_if_bug: [ OK ] 0.17 sec. 2025-10-03 23:31:58 01786_nullable_string_tsv_at_eof: [ OK ] 0.88 sec. 2025-10-03 23:31:58 00098_7_union_all: [ OK ] 0.13 sec. 2025-10-03 23:31:59 01490_nullable_string_to_enum: [ OK ] 0.17 sec. 2025-10-03 23:31:59 00411_long_accurate_number_comparison_int1: [ OK ] 7.25 sec. 2025-10-03 23:31:59 02765_parallel_replicas_final_modifier: [ OK ] 0.17 sec. 2025-10-03 23:31:59 00882_multiple_join_no_alias: [ OK ] 0.23 sec. 2025-10-03 23:31:59 00911_tautological_compare: [ OK ] 0.12 sec. 2025-10-03 23:31:59 01931_storage_merge_no_columns: [ OK ] 0.17 sec. 2025-10-03 23:31:59 01651_lc_insert_tiny_log_2: [ OK ] 1.68 sec. 2025-10-03 23:31:59 01561_aggregate_functions_of_key_with_join: [ OK ] 0.12 sec. 2025-10-03 23:31:59 01623_byte_size_const: [ OK ] 0.12 sec. 2025-10-03 23:31:59 02122_parallel_formatting_JSONCompact: [ OK ] 1.13 sec. 2025-10-03 23:31:59 02864_test_ipv4_type_mismatch: [ OK ] 0.17 sec. 2025-10-03 23:31:59 00859_distinct_with_join: [ OK ] 0.17 sec. 2025-10-03 23:31:59 02835_nested_array_lowcardinality: [ OK ] 0.22 sec. 2025-10-03 23:32:00 02022_array_full_text_bloom_filter_index: [ OK ] 0.27 sec. 2025-10-03 23:32:00 03144_invalid_filter: [ OK ] 0.17 sec. 2025-10-03 23:32:00 01764_table_function_dictionary: [ OK ] 0.17 sec. 2025-10-03 23:32:00 01925_json_as_string_data_in_square_brackets: [ OK ] 0.18 sec. 2025-10-03 23:32:00 02508_index_analysis_to_date_timezone: [ OK ] 0.22 sec. 2025-10-03 23:32:00 01436_storage_merge_with_join_push_down: [ OK ] 0.27 sec. 2025-10-03 23:32:00 02996_analyzer_prewhere_projection: [ OK ] 0.17 sec. 2025-10-03 23:32:00 03290_limit_by_segv: [ OK ] 0.12 sec. 2025-10-03 23:32:00 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.34 sec. 2025-10-03 23:32:00 01338_long_select_and_alter_zookeeper: [ OK ] 13.00 sec. 2025-10-03 23:32:01 00524_time_intervals_months_underflow: [ OK ] 0.32 sec. 2025-10-03 23:32:01 02122_parallel_formatting_XML: [ OK ] 1.53 sec. 2025-10-03 23:32:01 01508_format_regexp_raw: [ OK ] 0.57 sec. 2025-10-03 23:32:01 02122_parallel_formatting_PrettySpaceNoEscapes: [ OK ] 1.73 sec. 2025-10-03 23:32:01 01776_decrypt_aead_size_check: [ OK ] 0.12 sec. 2025-10-03 23:32:01 01702_system_numbers_scientific_notation: [ OK ] 0.17 sec. 2025-10-03 23:32:01 03198_json_extract_more_types: [ OK ] 0.22 sec. 2025-10-03 23:32:01 00702_join_with_using: [ OK ] 0.27 sec. 2025-10-03 23:32:02 03224_nested_json_merges_new_type_in_shared_data: [ OK ] 0.52 sec. 2025-10-03 23:32:02 00700_decimal_array_functions: [ OK ] 0.22 sec. 2025-10-03 23:32:02 01846_alter_column_without_type_bugfix: [ OK ] 0.27 sec. 2025-10-03 23:32:02 01412_optimize_deduplicate_bug: [ OK ] 0.18 sec. 2025-10-03 23:32:02 01552_impl_aggfunc_cloneresize: [ OK ] 0.17 sec. 2025-10-03 23:32:02 00253_insert_recursive_defaults: [ OK ] 0.23 sec. 2025-10-03 23:32:02 00098_g_union_all: [ OK ] 0.17 sec. 2025-10-03 23:32:02 02017_order_by_with_fill_redundant_functions: [ OK ] 0.12 sec. 2025-10-03 23:32:03 01582_any_join_supertype: [ OK ] 0.27 sec. 2025-10-03 23:32:03 01441_low_cardinality_array_index: [ OK ] 1.78 sec. 2025-10-03 23:32:03 01030_concatenate_equal_fixed_strings: [ OK ] 0.12 sec. 2025-10-03 23:32:03 02000_default_from_default_empty_column: [ OK ] 0.17 sec. 2025-10-03 23:32:03 02457_key_condition_with_types_that_cannot_be_nullable: [ OK ] 0.17 sec. 2025-10-03 23:32:03 01391_limit_overflow: [ OK ] 0.17 sec. 2025-10-03 23:32:03 03010_virtual_memory_mappings_asynchronous_metrics: [ OK ] 0.13 sec. 2025-10-03 23:32:03 00975_values_list: [ OK ] 0.22 sec. 2025-10-03 23:32:03 01349_mutation_datetime_key: [ OK ] 0.17 sec. 2025-10-03 23:32:04 00834_kill_mutation: [ OK ] 2.03 sec. 2025-10-03 23:32:04 02932_set_ttl_where: [ OK ] 3.54 sec. 2025-10-03 23:32:04 02271_temporary_table_show_rows_bytes: [ OK ] 0.12 sec. 2025-10-03 23:32:04 02527_storage_merge_prewhere_different_type: [ OK ] 0.22 sec. 2025-10-03 23:32:05 00426_nulls_sorting: [ OK ] 0.17 sec. 2025-10-03 23:32:05 02724_function_in_left_table_clause_asof_join: [ OK ] 0.17 sec. 2025-10-03 23:32:05 01085_max_distributed_connections: [ OK ] 1.48 sec. 2025-10-03 23:32:05 02231_buffer_aggregate_states_leak: [ OK ] 4.75 sec. 2025-10-03 23:32:05 02919_skip_lots_of_parsing_errors: [ OK ] 5.14 sec. 2025-10-03 23:32:05 00106_totals_after_having: [ OK ] 0.17 sec. 2025-10-03 23:32:05 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 2.29 sec. 2025-10-03 23:32:05 00700_decimal_empty_aggregates: [ OK ] 0.42 sec. 2025-10-03 23:32:05 02900_add_subtract_interval_with_string_date: [ OK ] 0.72 sec. 2025-10-03 23:32:06 02178_column_function_insert_from: [ OK ] 0.22 sec. 2025-10-03 23:32:06 02497_schema_inference_nulls: [ OK ] 0.32 sec. 2025-10-03 23:32:06 01414_freeze_does_not_prevent_alters: [ OK ] 0.27 sec. 2025-10-03 23:32:06 02845_domain_rfc_support_ipv6: [ OK ] 0.22 sec. 2025-10-03 23:32:06 01019_array_fill: [ OK ] 0.17 sec. 2025-10-03 23:32:06 02457_bz2_concatenated: [ OK ] 0.62 sec. 2025-10-03 23:32:06 02710_topk_with_empty_array: [ OK ] 0.12 sec. 2025-10-03 23:32:06 01178_int_field_to_decimal: [ OK ] 0.22 sec. 2025-10-03 23:32:06 01431_finish_sorting_with_consts: [ OK ] 0.17 sec. 2025-10-03 23:32:06 01648_normalize_query_keep_names: [ OK ] 0.12 sec. 2025-10-03 23:32:06 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.17 sec. 2025-10-03 23:32:07 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 2.33 sec. 2025-10-03 23:32:07 02912_group_array_sample: [ OK ] 0.12 sec. 2025-10-03 23:32:07 00594_alias_in_distributed: [ OK ] 0.57 sec. 2025-10-03 23:32:07 02019_multiple_weird_with_fill: [ OK ] 0.12 sec. 2025-10-03 23:32:07 00319_index_for_like: [ OK ] 0.27 sec. 2025-10-03 23:32:07 01302_polygons_distance: [ OK ] 0.17 sec. 2025-10-03 23:32:07 02319_timeslots_dt64: [ OK ] 0.22 sec. 2025-10-03 23:32:07 01276_random_string: [ OK ] 1.03 sec. 2025-10-03 23:32:07 02495_concat_with_separator: [ OK ] 0.37 sec. 2025-10-03 23:32:08 01602_runningConcurrency: [ OK ] 0.27 sec. 2025-10-03 23:32:08 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.12 sec. 2025-10-03 23:32:08 01780_column_sparse_tuple: [ OK ] 0.32 sec. 2025-10-03 23:32:08 01401_FORMAT_SETTINGS: [ OK ] 0.42 sec. 2025-10-03 23:32:08 02014_dict_get_nullable_key: [ OK ] 0.27 sec. 2025-10-03 23:32:08 02763_row_policy_storage_merge_alias: [ OK ] 0.38 sec. 2025-10-03 23:32:08 02708_parallel_replicas_not_found_column: [ OK ] 0.17 sec. 2025-10-03 23:32:09 01323_too_many_threads_bug: [ OK ] 0.67 sec. 2025-10-03 23:32:09 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.12 sec. 2025-10-03 23:32:09 02154_bit_slice_for_fixedstring: [ OK ] 0.65 sec. 2025-10-03 23:32:09 01710_projection_row_policy: [ OK ] 0.22 sec. 2025-10-03 23:32:09 02097_polygon_dictionary_store_key: [ OK ] 0.27 sec. 2025-10-03 23:32:09 03014_window_view_crash: [ OK ] 0.12 sec. 2025-10-03 23:32:09 01075_in_arrays_enmk: [ OK ] 0.17 sec. 2025-10-03 23:32:09 01940_custom_tld_sharding_key: [ OK ] 0.17 sec. 2025-10-03 23:32:09 02449_check_dependencies_and_table_shutdown: [ OK ] 0.27 sec. 2025-10-03 23:32:09 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.12 sec. 2025-10-03 23:32:09 02480_tets_show_full: [ OK ] 0.58 sec. 2025-10-03 23:32:10 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.22 sec. 2025-10-03 23:32:10 00193_parallel_replicas: [ OK ] 0.37 sec. 2025-10-03 23:32:10 01936_quantiles_cannot_return_null: [ OK ] 0.12 sec. 2025-10-03 23:32:10 02478_analyzer_table_expression_aliases: [ OK ] 0.22 sec. 2025-10-03 23:32:10 02864_filtered_url_with_globs: [ OK ] 0.17 sec. 2025-10-03 23:32:10 02912_ingestion_mv_deduplication: [ OK ] 0.98 sec. 2025-10-03 23:32:10 02542_table_function_format: [ OK ] 0.17 sec. 2025-10-03 23:32:12 02269_bool_map_sync_after_error: [ OK ] 1.38 sec. 2025-10-03 23:32:12 02783_parallel_replicas_trivial_count_optimization: [ OK ] 1.43 sec. 2025-10-03 23:32:12 03033_analyzer_parametrized_view_alias: [ OK ] 0.17 sec. 2025-10-03 23:32:12 00534_functions_bad_arguments3: [ OK ] 6.34 sec. 2025-10-03 23:32:12 01921_with_fill_with_totals: [ OK ] 0.12 sec. 2025-10-03 23:32:12 00168_buffer_defaults: [ OK ] 0.17 sec. 2025-10-03 23:32:13 01213_alter_rename_nested: [ OK ] 0.22 sec. 2025-10-03 23:32:13 03214_join_on_tuple_comparison_elimination_bug: [ OK ] 0.22 sec. 2025-10-03 23:32:13 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.39 sec. 2025-10-03 23:32:13 02437_drop_mv_restart_replicas: [ OK ] 15.84 sec. 2025-10-03 23:32:13 02995_index_1: [ OK ] 7.16 sec. 2025-10-03 23:32:13 02502_fuzz_bad_cast_to_ast_literal: [ OK ] 0.18 sec. 2025-10-03 23:32:14 01240_join_get_or_null: [ OK ] 0.22 sec. 2025-10-03 23:32:14 01127_month_partitioning_consistency_select: [ OK ] 0.17 sec. 2025-10-03 23:32:14 02680_default_star: [ OK ] 0.12 sec. 2025-10-03 23:32:14 01043_dictionary_attribute_properties_values: [ OK ] 0.12 sec. 2025-10-03 23:32:14 01927_query_views_log_matview_exceptions: [ OK ] 1.88 sec. 2025-10-03 23:32:14 01710_projection_with_nullable_keys: [ OK ] 0.12 sec. 2025-10-03 23:32:14 01950_aliases_bad_cast: [ OK ] 0.12 sec. 2025-10-03 23:32:14 01921_not_chain: [ OK ] 0.12 sec. 2025-10-03 23:32:14 02221_system_zookeeper_unrestricted: [ OK ] 1.18 sec. 2025-10-03 23:32:14 02674_null_default_structure: [ OK ] 0.12 sec. 2025-10-03 23:32:15 03135_keeper_client_find_commands: [ OK ] 0.77 sec. 2025-10-03 23:32:15 01319_query_formatting_in_server_log: [ OK ] 0.67 sec. 2025-10-03 23:32:15 01058_window_view_event_hop_to_strict_asc: [ OK ] 1.12 sec. 2025-10-03 23:32:15 02797_aggregator_huge_mem_usage_bug: [ OK ] 0.47 sec. 2025-10-03 23:32:15 01913_join_push_down_bug: [ OK ] 0.17 sec. 2025-10-03 23:32:15 01084_window_view_with_table_identifier: [ OK ] 0.97 sec. 2025-10-03 23:32:15 02550_client_connections_credentials: [ OK ] 9.96 sec. 2025-10-03 23:32:15 02483_cuturlparameter_with_arrays: [ OK ] 0.17 sec. 2025-10-03 23:32:15 02346_fulltext_index_match_predicate: [ OK ] 0.23 sec. 2025-10-03 23:32:15 00701_rollup: [ OK ] 0.22 sec. 2025-10-03 23:32:16 01611_constant_folding_subqueries: [ OK ] 0.18 sec. 2025-10-03 23:32:16 01246_extractAllGroupsHorizontal: [ OK ] 0.33 sec. 2025-10-03 23:32:16 02967_fuzz_bad_cast: [ OK ] 0.17 sec. 2025-10-03 23:32:16 00996_neighbor: [ OK ] 0.32 sec. 2025-10-03 23:32:16 02020_cast_integer_overflow: [ OK ] 0.17 sec. 2025-10-03 23:32:16 01670_log_comment: [ OK ] 0.32 sec. 2025-10-03 23:32:16 00155_long_merges: [ OK ] 76.63 sec. 2025-10-03 23:32:16 02874_toDaysSinceYearZero: [ OK ] 0.27 sec. 2025-10-03 23:32:16 02539_vertical_merge_compact_parts: [ OK ] 0.32 sec. 2025-10-03 23:32:16 03171_direct_dict_short_circuit_bug: [ OK ] 0.22 sec. 2025-10-03 23:32:17 01420_format_row: [ OK ] 0.37 sec. 2025-10-03 23:32:17 02375_pretty_formats: [ OK ] 0.23 sec. 2025-10-03 23:32:17 01682_gather_utils_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:32:17 00386_has_column_in_table: [ OK ] 0.28 sec. 2025-10-03 23:32:17 02995_index_3: [ OK ] 5.19 sec. 2025-10-03 23:32:18 01860_Distributed__shard_num_GROUP_BY: [ OK ] 0.27 sec. 2025-10-03 23:32:18 03156_tuple_map_low_cardinality: [ OK ] 1.58 sec. 2025-10-03 23:32:18 03094_grouparraysorted_memory: [ OK ] 2.63 sec. 2025-10-03 23:32:19 01050_clickhouse_dict_source_with_subquery: [ OK ] 0.22 sec. 2025-10-03 23:32:19 01600_benchmark_query: [ OK ] 0.52 sec. 2025-10-03 23:32:19 01370_client_autocomplete_word_break_characters: [ OK ] 1.48 sec. 2025-10-03 23:32:19 02704_keeper_map_zk_nodes: [ OK ] 2.33 sec. 2025-10-03 23:32:19 01018_empty_aggregation_filling: [ OK ] 0.37 sec. 2025-10-03 23:32:19 00547_named_tuples: [ OK ] 0.13 sec. 2025-10-03 23:32:19 02310_clickhouse_local_INSERT_progress_profile_events: [ SKIPPED ] 0.00 sec. 2025-10-03 23:32:19 Reason: not running for current build 2025-10-03 23:32:19 00027_simple_argMinArray: [ OK ] 0.12 sec. 2025-10-03 23:32:19 01655_window_functions_null: [ OK ] 0.12 sec. 2025-10-03 23:32:20 00417_system_build_options: [ OK ] 0.42 sec. 2025-10-03 23:32:20 01346_array_join_mrxotey: [ OK ] 0.17 sec. 2025-10-03 23:32:20 03094_one_thousand_joins: [ OK ] 4.24 sec. 2025-10-03 23:32:20 00674_join_on_syntax: [ OK ] 0.63 sec. 2025-10-03 23:32:20 00926_multimatch: [ OK ] 0.97 sec. 2025-10-03 23:32:20 03262_test_parquet_native_reader_int_logical_type: [ OK ] 0.77 sec. 2025-10-03 23:32:20 00557_array_resize: [ OK ] 0.17 sec. 2025-10-03 23:32:20 00931_low_cardinality_set_index_in_key_condition: [ OK ] 0.19 sec. 2025-10-03 23:32:21 02463_julian_day_ubsan: [ OK ] 0.14 sec. 2025-10-03 23:32:21 01272_offset_without_limit: [ OK ] 0.17 sec. 2025-10-03 23:32:21 03290_final_replacing: [ OK ] 0.22 sec. 2025-10-03 23:32:21 00195_shard_union_all_and_global_in: [ OK ] 0.17 sec. 2025-10-03 23:32:21 03037_precent_rank: [ OK ] 0.22 sec. 2025-10-03 23:32:21 00927_asof_join_noninclusive: [ OK ] 0.27 sec. 2025-10-03 23:32:21 01504_view_type_conversion: [ OK ] 0.18 sec. 2025-10-03 23:32:21 02725_null_group_key_with_rollup: [ OK ] 0.17 sec. 2025-10-03 23:32:22 02354_vector_search_queries: [ OK ] 0.32 sec. 2025-10-03 23:32:22 00386_long_in_pk: [ OK ] 8.76 sec. 2025-10-03 23:32:22 00717_low_cardinaliry_group_by: [ OK ] 0.28 sec. 2025-10-03 23:32:22 01499_json_named_tuples: [ OK ] 0.18 sec. 2025-10-03 23:32:22 01054_random_printable_ascii_ubsan: [ OK ] 1.23 sec. 2025-10-03 23:32:22 00268_aliases_without_as_keyword: [ OK ] 0.17 sec. 2025-10-03 23:32:22 01801_s3_cluster: [ OK ] 1.48 sec. 2025-10-03 23:32:22 02516_projections_and_context: [ OK ] 0.22 sec. 2025-10-03 23:32:23 01064_array_auc: [ OK ] 0.22 sec. 2025-10-03 23:32:23 03152_dynamic_type_simple: [ OK ] 0.27 sec. 2025-10-03 23:32:23 00516_is_inf_nan: [ OK ] 0.17 sec. 2025-10-03 23:32:23 03038_ambiguous_column: [ OK ] 0.17 sec. 2025-10-03 23:32:23 01227_distributed_merge_global_in_primary_key: [ OK ] 0.58 sec. 2025-10-03 23:32:23 01555_or_fill: [ OK ] 0.23 sec. 2025-10-03 23:32:23 01325_freeze_mutation_stuck: [ OK ] 0.23 sec. 2025-10-03 23:32:23 01310_enum_comparison: [ OK ] 0.17 sec. 2025-10-03 23:32:23 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.23 sec. 2025-10-03 23:32:23 01942_untuple_transformers_msan: [ OK ] 0.17 sec. 2025-10-03 23:32:24 02841_remote_parameter_parsing_error: [ OK ] 0.33 sec. 2025-10-03 23:32:24 01825_type_json_ephemeral: [ OK ] 0.17 sec. 2025-10-03 23:32:24 02731_auto_convert_dictionary_layout_to_complex_by_complex_keys: [ OK ] 0.39 sec. 2025-10-03 23:32:25 00169_join_constant_keys: [ OK ] 0.33 sec. 2025-10-03 23:32:25 01632_tinylog_read_write: [ OK ] 10.27 sec. 2025-10-03 23:32:25 02905_csv_unquoted_string_with_cr: [ OK ] 1.59 sec. 2025-10-03 23:32:25 01712_no_adaptive_granularity_vertical_merge: [ OK ] 0.22 sec. 2025-10-03 23:32:25 03145_non_loaded_projection_backup: [ OK ] 1.73 sec. 2025-10-03 23:32:25 03154_recursive_cte_distributed: [ OK ] 0.32 sec. 2025-10-03 23:32:26 02941_projections_external_aggregation: [ OK ] 0.48 sec. 2025-10-03 23:32:26 01277_random_fixed_string: [ OK ] 1.14 sec. 2025-10-03 23:32:26 02811_insert_schema_inference: [ OK ] 0.17 sec. 2025-10-03 23:32:26 01593_functions_in_order_by: [ OK ] 0.12 sec. 2025-10-03 23:32:26 02286_function_wyhash: [ OK ] 0.17 sec. 2025-10-03 23:32:26 02885_create_distributed_table_without_as: [ OK ] 0.23 sec. 2025-10-03 23:32:27 02869_http_headers_elapsed_ns: [ OK ] 0.48 sec. 2025-10-03 23:32:27 02403_enable_extended_results_for_datetime_functions: [ OK ] 0.60 sec. 2025-10-03 23:32:27 02099_tsv_raw_format_2: [ OK ] 2.03 sec. 2025-10-03 23:32:27 02035_isNull_isNotNull_format: [ OK ] 0.42 sec. 2025-10-03 23:32:27 01032_duplicate_column_insert_query: [ OK ] 0.17 sec. 2025-10-03 23:32:27 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.17 sec. 2025-10-03 23:32:28 00088_distinct_of_arrays_of_strings: [ OK ] 0.13 sec. 2025-10-03 23:32:28 01765_move_to_table_overlapping_block_number: [ OK ] 0.27 sec. 2025-10-03 23:32:28 02374_analyzer_array_join: [ OK ] 0.37 sec. 2025-10-03 23:32:29 00688_low_cardinality_in: [ OK ] 0.27 sec. 2025-10-03 23:32:29 02122_parallel_formatting_JSONCompactStringsEachRowWithNamesAndTypes: [ OK ] 1.58 sec. 2025-10-03 23:32:29 01602_max_distributed_connections: [ OK ] 7.36 sec. 2025-10-03 23:32:29 02562_native_tskv_default_for_omitted_fields: [ OK ] 1.99 sec. 2025-10-03 23:32:29 02462_distributions: [ OK ] 0.32 sec. 2025-10-03 23:32:29 00804_test_custom_compression_codecs: [ OK ] 0.72 sec. 2025-10-03 23:32:29 02933_ephemeral_mv: [ OK ] 0.19 sec. 2025-10-03 23:32:29 00568_empty_function_with_fixed_string: [ OK ] 0.17 sec. 2025-10-03 23:32:30 01047_no_alias_columns_with_table_aliases: [ OK ] 0.17 sec. 2025-10-03 23:32:30 02366_kql_func_binary: [ OK ] 0.23 sec. 2025-10-03 23:32:30 00215_primary_key_order_zookeeper_long: [ OK ] 0.28 sec. 2025-10-03 23:32:30 00809_add_days_segfault: [ OK ] 0.24 sec. 2025-10-03 23:32:30 03125_analyzer_CTE_two_joins: [ OK ] 0.17 sec. 2025-10-03 23:32:30 02789_object_type_invalid_num_of_rows: [ OK ] 0.22 sec. 2025-10-03 23:32:30 02832_alter_delete_indexes_projections: [ OK ] 0.42 sec. 2025-10-03 23:32:30 01142_with_ties_and_aliases: [ OK ] 0.25 sec. 2025-10-03 23:32:31 02270_client_name: [ OK ] 0.58 sec. 2025-10-03 23:32:31 00747_contributors: [ OK ] 0.29 sec. 2025-10-03 23:32:31 02456_keeper_retries_during_insert: [ OK ] 1.49 sec. 2025-10-03 23:32:31 00178_function_replicate: [ OK ] 0.18 sec. 2025-10-03 23:32:31 00763_create_query_as_table_engine_bug: [ OK ] 0.30 sec. 2025-10-03 23:32:32 02689_meaningless_data_types: [ OK ] 0.18 sec. 2025-10-03 23:32:32 02383_analyzer_merge_tree_self_join: [ OK ] 0.50 sec. 2025-10-03 23:32:32 00448_to_string_cut_to_zero: [ OK ] 0.27 sec. 2025-10-03 23:32:32 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.54 sec. 2025-10-03 23:32:34 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 3.10 sec. 2025-10-03 23:32:34 03047_analyzer_alias_join: [ OK ] 0.27 sec. 2025-10-03 23:32:35 02241_parquet_bad_column: [ OK ] 2.60 sec. 2025-10-03 23:32:35 01780_column_sparse_distinct: [ OK ] 0.33 sec. 2025-10-03 23:32:39 03352_concurrent_rename_alter: [ OK ] 8.76 sec. 2025-10-03 23:32:39 00757_enum_defaults: [ OK ] 0.27 sec. 2025-10-03 23:32:40 02915_input_table_function_in_subquery: [ OK ] 0.90 sec. 2025-10-03 23:32:40 00063_check_query: [ OK ] 0.22 sec. 2025-10-03 23:32:40 03034_dynamic_conversions: [ OK ] 0.34 sec. 2025-10-03 23:32:41 02594_msgpack_more_types: [ OK ] 0.52 sec. 2025-10-03 23:32:41 02497_remote_disk_fat_column: [ OK ] 15.55 sec. 2025-10-03 23:32:41 00120_join_and_group_by: [ OK ] 0.17 sec. 2025-10-03 23:32:41 01475_read_subcolumns_3: [ OK ] 0.32 sec. 2025-10-03 23:32:41 01912_bad_cast_join_fuzz: [ OK ] 0.12 sec. 2025-10-03 23:32:42 02421_new_type_json_empty_parts: [ OK ] 10.29 sec. 2025-10-03 23:32:43 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.27 sec. 2025-10-03 23:32:43 02840_merge__table_or_filter: [ OK ] 0.27 sec. 2025-10-03 23:32:43 02099_hashed_array_dictionary_complex_key: [ OK ] 7.56 sec. 2025-10-03 23:32:43 02681_undrop_query_uuid: [ OK ] 1.68 sec. 2025-10-03 23:32:43 02207_subseconds_intervals: [ OK ] 0.32 sec. 2025-10-03 23:32:44 02340_parts_refcnt_mergetree: [ OK ] 2.14 sec. 2025-10-03 23:32:44 02703_keeper_map_concurrent_create_drop: [ OK ] 23.69 sec. 2025-10-03 23:32:44 01521_format_readable_time_delta2: [ OK ] 0.27 sec. 2025-10-03 23:32:44 01704_transform_with_float_key: [ OK ] 0.17 sec. 2025-10-03 23:32:44 03146_tpc_ds_grouping: [ OK ] 0.17 sec. 2025-10-03 23:32:44 00222_sequence_aggregate_function_family: [ OK ] 0.42 sec. 2025-10-03 23:32:44 00595_insert_into_view: [ OK ] 1.12 sec. 2025-10-03 23:32:44 01944_range_max_elements: [ OK ] 0.17 sec. 2025-10-03 23:32:44 00930_arrayIntersect: [ OK ] 0.27 sec. 2025-10-03 23:32:44 00502_sum_map: [ OK ] 0.42 sec. 2025-10-03 23:32:44 01711_cte_subquery_fix: [ OK ] 0.17 sec. 2025-10-03 23:32:44 02933_replicated_database_forbid_create_as_select: [ OK ] 1.58 sec. 2025-10-03 23:32:45 00948_values_interpreter_template: [ OK ] 0.27 sec. 2025-10-03 23:32:45 01811_datename: [ OK ] 0.17 sec. 2025-10-03 23:32:45 02481_xxh3_hash_function: [ OK ] 0.12 sec. 2025-10-03 23:32:45 02417_null_variadic_behaviour: [ OK ] 0.47 sec. 2025-10-03 23:32:45 01091_insert_with_default_json: [ OK ] 0.22 sec. 2025-10-03 23:32:45 01086_regexp_input_format_skip_unmatched: [ OK ] 0.77 sec. 2025-10-03 23:32:45 00703_join_crash: [ OK ] 0.22 sec. 2025-10-03 23:32:45 02456_test_zero_copy_mutation: [ OK ] 0.27 sec. 2025-10-03 23:32:45 01854_HTTP_dict_decompression: [ OK ] 0.67 sec. 2025-10-03 23:32:45 02969_archive_seek: [ OK ] 0.47 sec. 2025-10-03 23:32:46 02597_column_delete_and_replication: [ OK ] 1.23 sec. 2025-10-03 23:32:46 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.17 sec. 2025-10-03 23:32:46 02883_array_scalar_mult_div_modulo: [ OK ] 0.22 sec. 2025-10-03 23:32:46 01031_semi_anti_join: [ OK ] 0.22 sec. 2025-10-03 23:32:46 02436_system_zookeeper_context: [ OK ] 0.17 sec. 2025-10-03 23:32:46 02241_short_circuit_short_column: [ OK ] 0.12 sec. 2025-10-03 23:32:46 01280_null_in: [ OK ] 0.17 sec. 2025-10-03 23:32:46 02499_monotonicity_toUnixTimestamp64: [ OK ] 0.82 sec. 2025-10-03 23:32:47 01422_array_nullable_element_nullable_index: [ OK ] 0.12 sec. 2025-10-03 23:32:47 01601_temporary_table_session_scope: [ OK ] 0.42 sec. 2025-10-03 23:32:47 01845_add_testcase_for_arrayElement: [ OK ] 0.17 sec. 2025-10-03 23:32:47 03208_array_of_json_read_subcolumns_2_memory: [ OK ] 30.45 sec. 2025-10-03 23:32:47 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.22 sec. 2025-10-03 23:32:47 03037_recursive_cte_postgres_3: [ OK ] 0.22 sec. 2025-10-03 23:32:47 00330_view_subqueries: [ OK ] 0.17 sec. 2025-10-03 23:32:47 02475_positive_modulo: [ OK ] 0.12 sec. 2025-10-03 23:32:47 00643_cast_zookeeper_long: [ OK ] 0.27 sec. 2025-10-03 23:32:48 03230_anyHeavy_merge: [ OK ] 0.17 sec. 2025-10-03 23:32:48 02737_arrayJaccardIndex: [ OK ] 0.32 sec. 2025-10-03 23:32:48 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.17 sec. 2025-10-03 23:32:48 02247_read_bools_as_numbers_json: [ OK ] 2.43 sec. 2025-10-03 23:32:48 03013_parser_regexp_recompilation: [ OK ] 0.37 sec. 2025-10-03 23:32:48 02478_projection_and_alter_low_cardinality: [ OK ] 0.17 sec. 2025-10-03 23:32:48 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.12 sec. 2025-10-03 23:32:48 00368_format_option_collision: [ OK ] 0.47 sec. 2025-10-03 23:32:49 03203_hive_style_partitioning: [ OK ] 1.83 sec. 2025-10-03 23:32:49 01372_wrong_order_by_removal: [ OK ] 0.12 sec. 2025-10-03 23:32:49 01293_show_settings: [ OK ] 0.12 sec. 2025-10-03 23:32:49 02429_offset_pipeline_stuck_bug: [ OK ] 0.17 sec. 2025-10-03 23:32:49 02907_backup_mv_with_no_inner_table: [ OK ] 0.98 sec. 2025-10-03 23:32:49 01825_type_json_2: [ OK ] 0.32 sec. 2025-10-03 23:32:50 02267_file_globs_schema_inference: [ OK ] 1.07 sec. 2025-10-03 23:32:50 02438_sync_replica_lightweight: [ OK ] 0.42 sec. 2025-10-03 23:32:50 01045_bloom_filter_null_array: [ OK ] 0.22 sec. 2025-10-03 23:32:50 02359_send_logs_source_regexp: [ OK ] 0.52 sec. 2025-10-03 23:32:50 01586_storage_join_low_cardinality_key: [ OK ] 0.17 sec. 2025-10-03 23:32:50 00452_left_array_join_and_nullable: [ OK ] 0.17 sec. 2025-10-03 23:32:50 03273_select_from_explain_ast_non_select: [ OK ] 0.12 sec. 2025-10-03 23:32:51 00321_pk_set: [ OK ] 0.22 sec. 2025-10-03 23:32:51 00948_format_in_with_single_element: [ OK ] 0.58 sec. 2025-10-03 23:32:51 02884_async_insert_native_protocol_2: [ OK ] 5.75 sec. 2025-10-03 23:32:51 02911_analyzer_remove_unused_projection_columns: [ OK ] 0.22 sec. 2025-10-03 23:32:51 01584_distributed_buffer_cannot_find_column: [ OK ] 0.27 sec. 2025-10-03 23:32:51 02366_kql_native_interval_format: [ OK ] 0.22 sec. 2025-10-03 23:32:51 02212_h3_point_dist: [ OK ] 0.27 sec. 2025-10-03 23:32:51 02357_query_cancellation_race: [ OK ] 6.04 sec. 2025-10-03 23:32:51 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 3.23 sec. 2025-10-03 23:32:51 01213_alter_rename_column: [ OK ] 0.32 sec. 2025-10-03 23:32:52 02292_h3_unidirectional_funcs: [ OK ] 0.22 sec. 2025-10-03 23:32:52 02834_timestamp_function: [ OK ] 0.22 sec. 2025-10-03 23:32:52 01041_create_dictionary_if_not_exists: [ OK ] 0.17 sec. 2025-10-03 23:32:52 02874_analysis_of_variance_overflow: [ OK ] 0.12 sec. 2025-10-03 23:32:52 02541_multiple_ignore_with_nested_select: [ OK ] 0.12 sec. 2025-10-03 23:32:52 00351_select_distinct_arrays_tuples: [ OK ] 0.17 sec. 2025-10-03 23:32:52 03146_bug47862: [ OK ] 0.12 sec. 2025-10-03 23:32:52 01600_encode_XML: [ OK ] 0.17 sec. 2025-10-03 23:32:52 02807_math_unary_crash: [ OK ] 0.17 sec. 2025-10-03 23:32:52 01097_one_more_range_reader_test: [ OK ] 0.22 sec. 2025-10-03 23:32:52 00503_cast_const_nullable: [ OK ] 0.12 sec. 2025-10-03 23:32:52 00969_roundDuration: [ OK ] 0.17 sec. 2025-10-03 23:32:53 00937_ipv4_cidr_range: [ OK ] 0.22 sec. 2025-10-03 23:32:53 01607_arrays_as_nested_csv: [ OK ] 0.82 sec. 2025-10-03 23:32:54 01293_client_interactive_vertical_multiline: [ OK ] 0.87 sec. 2025-10-03 23:32:54 01079_alter_default_zookeeper_long: [ OK ] 1.43 sec. 2025-10-03 23:32:55 02033_join_engine_deadlock_long: [ OK ] 1.53 sec. 2025-10-03 23:32:55 01495_subqueries_in_with_statement_2: [ OK ] 0.17 sec. 2025-10-03 23:32:55 00534_functions_bad_arguments12: [ OK ] 5.74 sec. 2025-10-03 23:32:55 02686_bson3: [ OK ] 0.12 sec. 2025-10-03 23:32:57 01455_opentelemetry_distributed: [ OK ] 2.34 sec. 2025-10-03 23:32:57 02476_query_parameters_insert: [ OK ] 0.17 sec. 2025-10-03 23:32:57 02842_vertical_merge_after_add_drop_column: [ OK ] 0.17 sec. 2025-10-03 23:32:59 03207_json_read_subcolumns_2_memory: [ OK ] 24.41 sec. 2025-10-03 23:32:59 01062_pm_all_join_with_block_continuation: [ OK ] 3.94 sec. 2025-10-03 23:33:00 00825_protobuf_format_persons: [ OK ] 7.41 sec. 2025-10-03 23:33:00 02151_hash_table_sizes_stats_joins: [ OK ] 2.88 sec. 2025-10-03 23:33:00 02947_merge_tree_index_table_2: [ OK ] 0.17 sec. 2025-10-03 23:33:01 02841_valid_json_and_xml_on_http_exception: [ OK ] 9.67 sec. 2025-10-03 23:33:01 02377_analyzer_in_function_set: [ OK ] 0.17 sec. 2025-10-03 23:33:01 02293_part_log_has_merge_reason: [ OK ] 2.23 sec. 2025-10-03 23:33:01 01066_window_view_event_tumble_to_strict_asc_lateness: [ OK ] 1.07 sec. 2025-10-03 23:33:01 00704_arrayCumSumLimited_arrayDifference: [ OK ] 0.22 sec. 2025-10-03 23:33:01 03006_parallel_replicas_prewhere: [ OK ] 0.22 sec. 2025-10-03 23:33:01 00712_prewhere_with_alias_bug_2: [ OK ] 0.17 sec. 2025-10-03 23:33:01 02797_join_nested_lowcardinality_convert: [ OK ] 0.27 sec. 2025-10-03 23:33:02 01060_window_view_event_tumble_to_asc: [ OK ] 1.03 sec. 2025-10-03 23:33:02 02008_materialize_column: [ OK ] 0.32 sec. 2025-10-03 23:33:02 02044_url_glob_parallel_connection_refused: [ OK ] 11.37 sec. 2025-10-03 23:33:02 02532_json_missing_named_tuple_elements: [ OK ] 1.13 sec. 2025-10-03 23:33:03 00953_moving_functions: [ OK ] 0.27 sec. 2025-10-03 23:33:03 01344_alter_enum_partition_key: [ OK ] 0.27 sec. 2025-10-03 23:33:03 02874_array_random_sample: [ OK ] 3.74 sec. 2025-10-03 23:33:03 02294_dictionaries_hierarchical_index: [ OK ] 0.27 sec. 2025-10-03 23:33:03 01026_char_utf8: [ OK ] 0.17 sec. 2025-10-03 23:33:03 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.12 sec. 2025-10-03 23:33:03 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 2.08 sec. 2025-10-03 23:33:03 00500_point_in_polygon_bug_2: [ OK ] 0.17 sec. 2025-10-03 23:33:04 02813_array_agg: [ OK ] 0.17 sec. 2025-10-03 23:33:04 02515_generate_ulid: [ OK ] 0.12 sec. 2025-10-03 23:33:04 02133_classification: [ OK ] 0.33 sec. 2025-10-03 23:33:04 01660_join_or_subqueries: [ OK ] 0.27 sec. 2025-10-03 23:33:04 00980_merge_alter_settings: [ OK ] 0.37 sec. 2025-10-03 23:33:04 03087_analyzer_subquery_with_alias: [ OK ] 0.12 sec. 2025-10-03 23:33:04 03020_order_by_SimpleAggregateFunction: [ OK ] 0.27 sec. 2025-10-03 23:33:04 02771_ignore_data_skipping_indices: [ OK ] 0.22 sec. 2025-10-03 23:33:04 02430_initialize_aggregation_with_combinators: [ OK ] 0.12 sec. 2025-10-03 23:33:05 02496_remove_redundant_sorting_analyzer: [ OK ] 4.64 sec. 2025-10-03 23:33:05 03031_filter_float64_logical_error: [ OK ] 0.17 sec. 2025-10-03 23:33:05 01034_with_fill_and_push_down_predicate: [ OK ] 0.12 sec. 2025-10-03 23:33:05 02588_parquet_bug: [ OK ] 0.62 sec. 2025-10-03 23:33:05 03008_index_small: [ OK ] 0.17 sec. 2025-10-03 23:33:05 2025-10-03 23:33:05 Having 2 errors! 1005 tests passed. 2 tests skipped. 954.23 s elapsed (Process-5). 2025-10-03 23:33:06 01509_parallel_quorum_insert_no_replicas_long: [ OK ] 0.57 sec. 2025-10-03 23:33:06 2025-10-03 23:33:06 688 tests passed. 3 tests skipped. 954.53 s elapsed (Process-3). 2025-10-03 23:33:06 02275_full_sort_join_long: [ OK ] 47.09 sec. 2025-10-03 23:33:06 2025-10-03 23:33:06 665 tests passed. 1 tests skipped. 954.77 s elapsed (Process-8). 2025-10-03 23:33:06 01961_roaring_memory_tracking: [ OK ] 3.59 sec. 2025-10-03 23:33:06 2025-10-03 23:33:06 824 tests passed. 0 tests skipped. 954.82 s elapsed (Process-9). 2025-10-03 23:33:06 01504_rocksdb: [ OK ] 1.43 sec. 2025-10-03 23:33:06 2025-10-03 23:33:06 727 tests passed. 0 tests skipped. 954.87 s elapsed (Process-6). 2025-10-03 23:33:10 01042_system_reload_dictionary_reloads_completely: [ OK ] 6.65 sec. 2025-10-03 23:33:10 2025-10-03 23:33:10 947 tests passed. 2 tests skipped. 958.76 s elapsed (Process-4). 2025-10-03 23:33:15 02067_lost_part_s3: [ OK ] 12.48 sec. 2025-10-03 23:33:15 2025-10-03 23:33:15 Having 1 errors! 655 tests passed. 1 tests skipped. 963.77 s elapsed (Process-7). 2025-10-03 23:33:43 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ OK ] 47.88 sec. 2025-10-03 23:33:43 2025-10-03 23:33:43 Having 1 errors! 977 tests passed. 2 tests skipped. 992.30 s elapsed (Process-10). 2025-10-03 23:33:52 Running 571 stateless tests (MainProcess). 2025-10-03 23:33:58 03276_parquet_output_compression_level: [ OK ] 5.24 sec. 2025-10-03 23:34:16 03254_session_expire_in_use_in_http_interface: [ OK ] 18.38 sec. 2025-10-03 23:34:18 03231_restore_user_with_existing_role: [ OK ] 1.83 sec. 2025-10-03 23:34:23 03206_replication_lag_metric: [ OK ] 5.19 sec. 2025-10-03 23:34:23 03198_table_function_directory_path: [ OK ] 0.17 sec. 2025-10-03 23:34:24 03198_dynamic_read_subcolumns: [ OK ] 0.27 sec. 2025-10-03 23:34:24 03174_exact_rows_before_aggregation: [ OK ] 0.37 sec. 2025-10-03 23:34:24 03168_loop_engine_with_parallel_replicas: [ OK ] 0.17 sec. 2025-10-03 23:34:25 03164_s3_settings_for_queries_and_merges: [ OK ] 0.77 sec. 2025-10-03 23:34:25 03164_orc_signedness: [ OK ] 0.33 sec. 2025-10-03 23:34:27 03154_lazy_token_iterator: [ OK ] 1.53 sec. 2025-10-03 23:34:39 03151_unload_index_race: [ OK ] 11.84 sec. 2025-10-03 23:34:48 03147_system_columns_access_checks: [ OK ] 7.67 sec. 2025-10-03 23:34:48 03147_table_function_loop: [ OK ] 0.17 sec. 2025-10-03 23:34:48 03147_parquet_memory_tracking: [ OK ] 0.52 sec. 2025-10-03 23:35:15 03144_parallel_alter_add_drop_column_zookeeper_on_steroids: [ OK ] 26.14 sec. 2025-10-03 23:35:16 03141_fetches_errors_stress: [ OK ] 1.32 sec. 2025-10-03 23:35:18 03128_system_unload_primary_key: [ OK ] 1.78 sec. 2025-10-03 23:35:18 03101_analyzer_identifiers_3: [ OK ] 0.17 sec. 2025-10-03 23:35:19 03096_http_interface_role_query_param: [ OK ] 0.77 sec. 2025-10-03 23:35:19 03033_index_definition_sql_udf_bug: [ OK ] 0.19 sec. 2025-10-03 23:35:20 03032_dynamically_resize_filesystem_cache_2: [ OK ] 1.28 sec. 2025-10-03 23:35:54 03008_deduplication_several_mv_into_one_table_replicated: [ OK ] 33.12 sec. 2025-10-03 23:35:55 03008_s3_plain_rewritable_fault: [ OK ] 1.83 sec. 2025-10-03 23:36:19 03008_deduplication_mv_generates_several_blocks_nonreplicated: [ OK ] 23.65 sec. 2025-10-03 23:36:40 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 21.04 sec. 2025-10-03 23:37:02 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 21.75 sec. 2025-10-03 23:37:37 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 35.00 sec. 2025-10-03 23:38:11 03008_deduplication_insert_several_blocks_replicated: [ OK ] 33.70 sec. 2025-10-03 23:38:12 03002_part_log_rmt_fetch_merge_error: [ OK ] 1.12 sec. 2025-10-03 23:38:16 03002_part_log_rmt_fetch_mutate_error: [ OK ] 4.04 sec. 2025-10-03 23:38:16 03000_traverse_shadow_system_data_paths: [ OK ] 0.42 sec. 2025-10-03 23:38:17 02990_rmt_replica_path_uuid: [ OK ] 0.27 sec. 2025-10-03 23:38:17 02989_system_tables_metadata_version: [ OK ] 0.32 sec. 2025-10-03 23:38:17 02983_const_sharding_key: [ OK ] 0.22 sec. 2025-10-03 23:38:19 02980_dist_insert_readonly_replica: [ OK ] 2.28 sec. 2025-10-03 23:38:20 02977_csv_format_support_tuple: [ OK ] 0.12 sec. 2025-10-03 23:38:20 02976_system_zookeeper_filters: [ OK ] 0.72 sec. 2025-10-03 23:38:21 02975_system_zookeeper_retries: [ OK ] 0.22 sec. 2025-10-03 23:38:22 02973_backup_of_in_memory_compressed: [ OK ] 0.97 sec. 2025-10-03 23:38:57 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 35.31 sec. 2025-10-03 23:38:57 02961_drop_tables: [ OK ] 0.27 sec. 2025-10-03 23:38:58 02961_storage_config_volume_priority: [ OK ] 0.62 sec. 2025-10-03 23:38:58 02960_validate_database_engines: [ OK ] 0.12 sec. 2025-10-03 23:38:58 02960_partition_by_udf: [ OK ] 0.22 sec. 2025-10-03 23:38:59 02951_parallel_parsing_json_compact_each_row: [ OK ] 0.72 sec. 2025-10-03 23:39:00 02950_distributed_initial_query_event: [ OK ] 1.42 sec. 2025-10-03 23:39:01 02950_dictionary_short_circuit: [ OK ] 0.72 sec. 2025-10-03 23:39:02 02947_non_post_request_should_be_readonly: [ OK ] 0.37 sec. 2025-10-03 23:39:04 02944_dynamically_change_filesystem_cache_size: [ OK ] 2.28 sec. 2025-10-03 23:39:06 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 1.57 sec. 2025-10-03 23:39:07 02940_system_stacktrace_optimizations: [ OK ] 1.52 sec. 2025-10-03 23:39:09 02933_change_cache_setting_without_restart: [ OK ] 1.93 sec. 2025-10-03 23:39:09 02931_max_num_to_warn: [ OK ] 0.42 sec. 2025-10-03 23:39:11 02919_insert_meet_eternal_hardware_error: [ OK ] 1.27 sec. 2025-10-03 23:39:12 02918_fuzzjson_table_function: [ OK ] 0.82 sec. 2025-10-03 23:39:15 02916_move_partition_inactive_replica: [ OK ] 3.68 sec. 2025-10-03 23:39:18 02915_move_partition_inactive_replica: [ OK ] 2.88 sec. 2025-10-03 23:39:18 02911_support_alias_column_in_indices: [ OK ] 0.22 sec. 2025-10-03 23:39:19 02911_row_policy_on_cluster: [ OK ] 0.47 sec. 2025-10-03 23:39:19 02910_prefetch_unexpceted_exception: [ OK ] 0.17 sec. 2025-10-03 23:39:19 02908_empty_named_collection: [ OK ] 0.12 sec. 2025-10-03 23:39:22 02908_many_requests_to_system_replicas: [ OK ] 1.98 sec. 2025-10-03 23:39:26 02907_suggestions_readonly_user: [ OK ] 4.29 sec. 2025-10-03 23:39:27 02906_orc_tuple_field_prune: [ OK ] 0.27 sec. 2025-10-03 23:39:27 02895_npy_output_format: [ OK ] 0.83 sec. 2025-10-03 23:39:28 02892_orc_filter_pushdown: [ OK ] 0.97 sec. 2025-10-03 23:39:30 02888_replicated_merge_tree_creation: [ OK ] 1.48 sec. 2025-10-03 23:39:30 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.32 sec. 2025-10-03 23:39:31 02884_async_insert_native_protocol_3: [ OK ] 1.07 sec. 2025-10-03 23:39:32 02884_async_insert_native_protocol_1: [ OK ] 0.93 sec. 2025-10-03 23:39:36 02884_authentication_quota: [ OK ] 4.07 sec. 2025-10-03 23:39:37 02884_async_insert_skip_settings: [ OK ] 0.42 sec. 2025-10-03 23:39:44 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 7.55 sec. 2025-10-03 23:39:48 02871_peak_threads_usage: [ OK ] 4.09 sec. 2025-10-03 23:39:49 02867_create_user_ssh: [ OK ] 0.13 sec. 2025-10-03 23:39:49 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.27 sec. 2025-10-03 23:39:50 02845_threads_count_in_distributed_queries: [ OK ] 0.97 sec. 2025-10-03 23:39:50 02843_insertion_table_schema_infer: [ OK ] 0.42 sec. 2025-10-03 23:39:51 02842_truncate_database: [ OK ] 0.42 sec. 2025-10-03 23:39:52 02841_parquet_filter_pushdown: [ OK ] 1.18 sec. 2025-10-03 23:39:52 02833_multiprewhere_extra_column: [ OK ] 0.22 sec. 2025-10-03 23:39:55 02832_alter_max_sessions_for_user: [ OK ] 2.93 sec. 2025-10-03 23:39:56 02813_avro_union_with_one_type: [ OK ] 0.47 sec. 2025-10-03 23:39:57 02808_filesystem_cache_drop_query: [ OK ] 1.53 sec. 2025-10-03 23:40:00 02796_calculate_text_stack_trace: [ OK ] 3.04 sec. 2025-10-03 23:40:03 02789_filesystem_cache_alignment: [ OK ] 3.03 sec. 2025-10-03 23:40:04 02789_table_functions_errors: [ OK ] 0.62 sec. 2025-10-03 23:40:20 02782_uniq_exact_parallel_merging_bug: [ OK ] 15.66 sec. 2025-10-03 23:40:20 02775_show_columns_called_from_clickhouse: [ OK ] 0.18 sec. 2025-10-03 23:40:20 02775_show_columns_called_from_mysql: [ OK ] 0.47 sec. 2025-10-03 23:40:21 02771_multidirectory_globs_storage_file: [ OK ] 0.88 sec. 2025-10-03 23:40:21 02762_replicated_database_no_args: [ OK ] 0.12 sec. 2025-10-03 23:40:22 02751_ip_types_aggregate_functions_states: [ OK ] 0.37 sec. 2025-10-03 23:40:23 02736_reading_and_writing_structure_fields: [ OK ] 0.77 sec. 2025-10-03 23:40:23 02735_capnp_case_insensitive_names_matching: [ OK ] 0.42 sec. 2025-10-03 23:40:24 02735_parquet_encoder: [ OK ] 1.38 sec. 2025-10-03 23:40:26 02726_async_insert_flush_queue: [ OK ] 1.17 sec. 2025-10-03 23:40:36 02726_async_insert_flush_stress: [ OK ] 10.48 sec. 2025-10-03 23:40:38 02725_database_hdfs: [ OK ] 1.63 sec. 2025-10-03 23:40:38 02725_local_query_parameters: [ OK ] 0.37 sec. 2025-10-03 23:40:38 02725_url_support_virtual_column: [ OK ] 0.22 sec. 2025-10-03 23:41:01 02725_start_stop_fetches: [ OK ] 22.59 sec. 2025-10-03 23:41:02 02724_decompress_filename_exception: [ OK ] 1.33 sec. 2025-10-03 23:41:04 02724_database_s3: [ OK ] 1.23 sec. 2025-10-03 23:41:04 02724_show_indexes: [ OK ] 0.43 sec. 2025-10-03 23:41:05 02724_limit_num_mutations: [ OK ] 1.28 sec. 2025-10-03 23:41:06 02723_parallelize_output_setting: [ OK ] 0.17 sec. 2025-10-03 23:41:09 02722_database_filesystem: [ OK ] 3.16 sec. 2025-10-03 23:41:09 02718_insert_meet_hardware_error: [ OK ] 0.22 sec. 2025-10-03 23:41:13 02713_create_user_substitutions: [ OK ] 3.89 sec. 2025-10-03 23:41:13 02710_show_table: [ OK ] 0.17 sec. 2025-10-03 23:41:13 02710_default_replicated_parameters: [ OK ] 0.22 sec. 2025-10-03 23:41:14 02706_show_columns: [ OK ] 0.43 sec. 2025-10-03 23:41:14 02705_capnp_more_types: [ OK ] 0.63 sec. 2025-10-03 23:41:30 02700_s3_part_INT_MAX: [ OK ] 16.05 sec. 2025-10-03 23:41:31 02686_postgres_protocol_decimal_256: [ OK ] 0.47 sec. 2025-10-03 23:41:34 02597_column_update_tricky_expression_and_replication: [ OK ] 2.84 sec. 2025-10-03 23:41:42 02581_share_big_sets_between_multiple_mutations_tasks_long: [ OK ] 7.75 sec. 2025-10-03 23:41:50 02581_share_big_sets_between_mutation_tasks_long: [ OK ] 8.67 sec. 2025-10-03 23:41:51 02578_parameterized_rename_queries: [ OK ] 0.22 sec. 2025-10-03 23:41:51 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.37 sec. 2025-10-03 23:41:53 02566_ipv4_ipv6_binary_formats: [ OK ] 1.64 sec. 2025-10-03 23:41:53 02563_analyzer_merge: [ OK ] 0.32 sec. 2025-10-03 23:41:53 02561_temporary_table_sessions: [ OK ] 0.47 sec. 2025-10-03 23:41:54 02554_rewrite_count_distinct_if_with_count_distinct_implementation: [ OK ] 0.17 sec. 2025-10-03 23:41:54 02541_arrow_duration_type: [ OK ] 0.47 sec. 2025-10-03 23:41:54 02536_hdfs_cluster_use_structure_from_table: [ OK ] 0.22 sec. 2025-10-03 23:42:01 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 6.81 sec. 2025-10-03 23:42:08 02535_max_parallel_replicas_custom_key_mt: [ OK ] 6.66 sec. 2025-10-03 23:42:08 02522_avro_complicate_schema: [ OK ] 0.52 sec. 2025-10-03 23:42:09 02521_avro_union_null_nested: [ OK ] 0.53 sec. 2025-10-03 23:42:19 02515_cleanup_async_insert_block_ids: [ OK ] 9.87 sec. 2025-10-03 23:42:20 02513_insert_without_materialized_columns: [ OK ] 1.28 sec. 2025-10-03 23:42:21 02511_parquet_orc_missing_columns: [ OK ] 1.03 sec. 2025-10-03 23:42:22 02510_orc_map_indexes: [ OK ] 0.43 sec. 2025-10-03 23:42:23 02504_regexp_dictionary_yaml_source: [ OK ] 1.58 sec. 2025-10-03 23:42:24 02503_cache_on_write_with_small_segment_size: [ OK ] 1.03 sec. 2025-10-03 23:42:26 02503_insert_storage_snapshot: [ OK ] 1.78 sec. 2025-10-03 23:42:27 02501_deep_recusion_schema_inference: [ OK ] 0.62 sec. 2025-10-03 23:42:37 02497_trace_events_stress_long: [ OK ] 10.08 sec. 2025-10-03 23:42:37 02496_storage_s3_profile_events: [ OK ] 0.32 sec. 2025-10-03 23:42:38 02495_s3_filter_by_file: [ OK ] 0.32 sec. 2025-10-03 23:42:38 02494_query_cache_user_quotas_after_drop: [ OK ] 0.17 sec. 2025-10-03 23:42:38 02494_query_cache_key: [ OK ] 0.27 sec. 2025-10-03 23:42:38 02494_query_cache_min_query_duration: [ OK ] 0.12 sec. 2025-10-03 23:42:38 02494_query_cache_exception_handling: [ OK ] 0.18 sec. 2025-10-03 23:42:40 02494_trace_log_profile_events: [ OK ] 1.18 sec. 2025-10-03 23:42:40 02494_query_cache_tag: [ OK ] 0.17 sec. 2025-10-03 23:42:40 02494_query_cache_asynchronous_metrics: [ OK ] 0.17 sec. 2025-10-03 23:42:40 02494_query_cache_totals_extremes: [ OK ] 0.22 sec. 2025-10-03 23:42:41 02494_query_cache_squash_partial_results: [ OK ] 0.37 sec. 2025-10-03 23:42:41 02494_query_cache_min_query_runs: [ OK ] 0.22 sec. 2025-10-03 23:42:41 02494_query_cache_normalize_ast: [ OK ] 0.28 sec. 2025-10-03 23:42:41 02494_query_cache_events: [ OK ] 0.22 sec. 2025-10-03 23:42:42 02494_query_cache_secrets: [ OK ] 0.17 sec. 2025-10-03 23:42:43 02494_query_cache_nested_query_bug: [ OK ] 1.38 sec. 2025-10-03 23:42:43 02494_query_cache_user_quotas: [ OK ] 0.22 sec. 2025-10-03 23:42:48 02494_query_cache_user_isolation: [ OK ] 4.74 sec. 2025-10-03 23:42:54 02494_query_cache_ttl_long: [ OK ] 6.20 sec. 2025-10-03 23:42:55 02494_query_cache_system_tables: [ OK ] 0.32 sec. 2025-10-03 23:42:55 02494_query_cache_query_log: [ OK ] 0.57 sec. 2025-10-03 23:42:55 02494_query_cache_passive_usage: [ OK ] 0.32 sec. 2025-10-03 23:42:56 02494_query_cache_bugs: [ OK ] 0.22 sec. 2025-10-03 23:42:56 02494_query_cache_case_agnostic_matching: [ OK ] 0.27 sec. 2025-10-03 23:42:56 02494_query_cache_explain: [ OK ] 0.17 sec. 2025-10-03 23:42:56 02494_query_cache_sparse_columns: [ OK ] 0.17 sec. 2025-10-03 23:42:57 02494_query_cache_nondeterministic_functions: [ OK ] 0.17 sec. 2025-10-03 23:42:57 02494_query_cache_drop_cache: [ OK ] 0.18 sec. 2025-10-03 23:42:57 02494_query_cache_compression: [ OK ] 0.22 sec. 2025-10-03 23:42:57 02494_query_cache_eligible_queries: [ OK ] 0.22 sec. 2025-10-03 23:42:58 02484_substitute_udf_storage_args: [ OK ] 0.22 sec. 2025-10-03 23:42:58 02483_substitute_udf_create: [ OK ] 0.22 sec. 2025-10-03 23:42:58 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.18 sec. 2025-10-03 23:42:59 02483_capnp_decimals: [ OK ] 0.63 sec. 2025-10-03 23:42:59 02483_add_engine_full_column_to_system_databases: [ OK ] 0.17 sec. 2025-10-03 23:42:59 02482_new_json_nested_arrays_with_same_keys: [ OK ] 0.42 sec. 2025-10-03 23:43:00 02482_capnp_list_of_structs: [ OK ] 0.88 sec. 2025-10-03 23:43:01 02482_json_nested_arrays_with_same_keys: [ OK ] 0.43 sec. 2025-10-03 23:43:01 02481_s3_throw_if_mismatch_files: [ OK ] 0.22 sec. 2025-10-03 23:43:02 02481_custom_separated_and_template_with_csv_field: [ OK ] 0.77 sec. 2025-10-03 23:43:02 02480_s3_support_wildcard: [ OK ] 0.57 sec. 2025-10-03 23:43:03 02477_projection_materialize_and_zero_copy: [ OK ] 1.07 sec. 2025-10-03 23:43:04 02473_infile_progress: [ OK ] 0.47 sec. 2025-10-03 23:43:05 02459_glob_for_recursive_directory_traversal: [ OK ] 0.82 sec. 2025-10-03 23:43:05 02458_use_structure_from_insertion_table: [ OK ] 0.32 sec. 2025-10-03 23:43:05 02458_default_setting: [ OK ] 0.17 sec. 2025-10-03 23:43:06 02458_hdfs_cluster_schema_inference: [ OK ] 0.32 sec. 2025-10-03 23:43:12 02455_one_row_from_csv_memory_usage: [ OK ] 6.36 sec. 2025-10-03 23:43:12 02454_json_object_each_row_column_for_object_name: [ OK ] 0.17 sec. 2025-10-03 23:43:51 02447_drop_database_replica: [ OK ] 39.31 sec. 2025-10-03 23:43:55 02440_mutations_finalization: [ OK ] 3.24 sec. 2025-10-03 23:43:56 02422_allow_implicit_no_password: [ OK ] 1.64 sec. 2025-10-03 23:43:57 02422_msgpack_uuid_wrong_column: [ OK ] 0.17 sec. 2025-10-03 23:44:02 02421_record_errors_row_by_input_format: [ OK ] 5.14 sec. 2025-10-03 23:44:02 02417_json_object_each_row_format: [ OK ] 0.18 sec. 2025-10-03 23:44:04 02417_load_marks_async: [ OK ] 1.58 sec. 2025-10-03 23:44:04 02416_rename_database_rbac: [ OK ] 0.47 sec. 2025-10-03 23:44:04 02416_input_json_formats: [ OK ] 0.17 sec. 2025-10-03 23:44:04 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.17 sec. 2025-10-03 23:44:05 02405_avro_read_nested: [ OK ] 0.17 sec. 2025-10-03 23:44:07 02404_memory_bound_merging: [ OK ] 2.63 sec. 2025-10-03 23:44:08 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.42 sec. 2025-10-03 23:44:08 02402_capnp_format_segments_overflow: [ OK ] 0.48 sec. 2025-10-03 23:44:10 02402_external_disk_mertrics: [ OK ] 1.48 sec. 2025-10-03 23:44:10 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. 2025-10-03 23:44:10 Reason: disabled 2025-10-03 23:44:10 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. 2025-10-03 23:44:10 Reason: disabled 2025-10-03 23:44:10 02391_recursive_buffer: [ OK ] 0.17 sec. 2025-10-03 23:44:10 02385_profile_events_overflow: [ OK ] 0.22 sec. 2025-10-03 23:44:11 02378_part_log_profile_events_replicated: [ OK ] 0.47 sec. 2025-10-03 23:44:11 02377_quota_key_http: [ OK ] 0.42 sec. 2025-10-03 23:44:12 02377_quota_key: [ OK ] 0.93 sec. 2025-10-03 23:44:12 02376_arrow_dict_with_string: [ OK ] 0.12 sec. 2025-10-03 23:44:12 02375_system_schema_inference_cache: [ OK ] 0.17 sec. 2025-10-03 23:44:13 02373_heap_buffer_overflow_in_avro: [ OK ] 0.47 sec. 2025-10-03 23:44:21 02372_data_race_in_avro: [ OK ] 7.90 sec. 2025-10-03 23:44:21 02364_window_view_segfault: [ OK ] 0.67 sec. 2025-10-03 23:44:22 02360_clickhouse_local_config-option: [ OK ] 0.63 sec. 2025-10-03 23:44:43 02352_rwlock: [ OK ] 20.68 sec. 2025-10-03 23:44:43 02350_views_max_insert_threads: [ OK ] 0.32 sec. 2025-10-03 23:44:43 02346_additional_filters_distr: [ OK ] 0.17 sec. 2025-10-03 23:45:14 02344_insert_profile_events_stress: [ OK ] 30.52 sec. 2025-10-03 23:45:14 02343_read_from_s3_compressed_blocks: [ OK ] 0.32 sec. 2025-10-03 23:45:15 02339_analyzer_matcher_basic: [ OK ] 0.47 sec. 2025-10-03 23:45:15 02337_analyzer_columns_basic: [ OK ] 0.32 sec. 2025-10-03 23:45:16 02337_drop_filesystem_cache_access: [ OK ] 0.67 sec. 2025-10-03 23:45:18 02336_sparse_columns_s3: [ OK ] 1.73 sec. 2025-10-03 23:45:19 02327_capnproto_protobuf_empty_messages: [ OK ] 1.73 sec. 2025-10-03 23:45:19 02323_null_modifier_in_table_function: [ OK ] 0.17 sec. 2025-10-03 23:45:20 02322_sql_insert_format: [ OK ] 0.17 sec. 2025-10-03 23:45:20 02314_avro_null_as_default: [ OK ] 0.72 sec. 2025-10-03 23:45:21 02314_csv_tsv_skip_first_lines: [ OK ] 0.17 sec. 2025-10-03 23:45:21 02313_avro_records_and_maps: [ OK ] 0.17 sec. 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/liwsbkogebbgtimwvdwvzvirqqmaswva HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/nqhzruveylrirmxkxetiotmgumgvuozx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/zhkkvvuoilliobczwxdqgvgyiefqpmav HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/mglxcnjfrlgfxohfgywchxmrugbtvcoh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/ywjvxarwnislbbmgzoeanupykajpveya HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/oqymlbmgpprgorhqhagafksyvuuonjvj HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/qjoxlfynlcshywswnynanzdiobxniryp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/dbktospmcsmqcdtdxlpxasxduqbyfcoh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "PUT /devstoreaccount1/cont/saszblbcjwljmrpthxosyixihgabauje HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "GET /devstoreaccount1/cont/zhkkvvuoilliobczwxdqgvgyiefqpmav HTTP/1.1" 206 184 127.0.0.1 - - [03/Oct/2025:22:45:25 +0000] "GET /devstoreaccount1/cont/nqhzruveylrirmxkxetiotmgumgvuozx HTTP/1.1" 206 1001805 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/saszblbcjwljmrpthxosyixihgabauje HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/oqymlbmgpprgorhqhagafksyvuuonjvj HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/mglxcnjfrlgfxohfgywchxmrugbtvcoh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/zhkkvvuoilliobczwxdqgvgyiefqpmav HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/nqhzruveylrirmxkxetiotmgumgvuozx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/ywjvxarwnislbbmgzoeanupykajpveya HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/dbktospmcsmqcdtdxlpxasxduqbyfcoh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/qjoxlfynlcshywswnynanzdiobxniryp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:26 +0000] "DELETE /devstoreaccount1/cont/liwsbkogebbgtimwvdwvzvirqqmaswva HTTP/1.1" 202 - 2025-10-03 23:45:26 02313_filesystem_cache_seeks: [ OK ] 5.66 sec. 2025-10-03 23:45:27 02311_system_zookeeper_insert_priv: [ OK ] 0.52 sec. 2025-10-03 23:45:27 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.17 sec. 2025-10-03 23:45:27 02302_defaults_in_columnar_formats: [ OK ] 0.17 sec. 2025-10-03 23:45:28 02302_s3_file_pruning: [ OK ] 0.48 sec. 2025-10-03 23:45:29 02297_regex_parsing_file_names: [ OK ] 0.77 sec. 2025-10-03 23:45:29 02294_fp_seconds_profile: [ OK ] 0.12 sec. 2025-10-03 23:45:40 02294_overcommit_overflow: [ OK ] 10.68 sec. 2025-10-03 23:45:42 02293_formats_json_columns: [ OK ] 2.18 sec. 2025-10-03 23:45:42 02293_test_zstd_window_log_max: [ OK ] 0.67 sec. 2025-10-03 23:45:43 02293_arrow_dictionary_indexes: [ OK ] 0.12 sec. 2025-10-03 23:45:43 02286_use_file_descriptor_in_table_function_file: [ OK ] 0.67 sec. 2025-10-03 23:45:53 02286_mysql_dump_input_format: [ OK ] 9.93 sec. 127.0.0.1 - - [03/Oct/2025:22:45:57 +0000] "PUT /devstoreaccount1/cont/inuqowtpksrfhayrfqlzqvainmxerzjx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/jkepbcasomciectdwokcpgppmfevfnde HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/xsaqgahmpenxydgjcogjgdivkvmdakes HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/pjtumkvunthwbncnlgkxtxdynezuonpr HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/peyyvlqnbbfpwhyrkcyzulsfdcdurbtv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/pwtzurpubexeokeonbydiaxpqblmyswk HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/ocbycemjfaepaguocxcaaxrjnkfaidul HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/iuyjhvagifbccdfdnmdqwqdutcuudrem HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/bybdumeukxgfcdbreqorxnufqljsulwj HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "PUT /devstoreaccount1/cont/vumyrvubsnsbwdsmyvodvmtjhbntefre HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "GET /devstoreaccount1/cont/xsaqgahmpenxydgjcogjgdivkvmdakes HTTP/1.1" 206 60 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "GET /devstoreaccount1/cont/jkepbcasomciectdwokcpgppmfevfnde HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:45:58 +0000] "GET /devstoreaccount1/cont/jkepbcasomciectdwokcpgppmfevfnde HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/vumyrvubsnsbwdsmyvodvmtjhbntefre HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/ocbycemjfaepaguocxcaaxrjnkfaidul HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/peyyvlqnbbfpwhyrkcyzulsfdcdurbtv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/xsaqgahmpenxydgjcogjgdivkvmdakes HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/jkepbcasomciectdwokcpgppmfevfnde HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/pjtumkvunthwbncnlgkxtxdynezuonpr HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/pwtzurpubexeokeonbydiaxpqblmyswk HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/bybdumeukxgfcdbreqorxnufqljsulwj HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/iuyjhvagifbccdfdnmdqwqdutcuudrem HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:45:59 +0000] "DELETE /devstoreaccount1/cont/inuqowtpksrfhayrfqlzqvainmxerzjx HTTP/1.1" 202 - 2025-10-03 23:45:59 02286_drop_filesystem_cache: [ OK ] 5.95 sec. 2025-10-03 23:46:00 02270_stdin_with_query_or_infile_data: [ OK ] 1.04 sec. 2025-10-03 23:47:21 02265_test_dns_profile_events: [ OK ] 81.05 sec. 2025-10-03 23:47:21 02265_rename_join_ordinary_to_atomic: [ OK ] 0.17 sec. 2025-10-03 23:47:23 02263_lazy_mark_load: [ OK ] 1.02 sec. 2025-10-03 23:47:23 02262_column_ttl: [ OK ] 0.82 sec. 2025-10-03 23:47:24 02252_jit_profile_events: [ OK ] 0.32 sec. 2025-10-03 23:47:27 02247_written_bytes_quota: [ OK ] 2.83 sec. 2025-10-03 23:47:28 02247_names_order_in_json_and_tskv: [ OK ] 1.17 sec. 2025-10-03 23:47:31 02246_async_insert_quota: [ OK ] 2.93 sec. 2025-10-03 23:47:31 02245_parquet_skip_unknown_type: [ OK ] 0.69 sec. 2025-10-03 23:47:32 02244_lowcardinality_hash_join: [ OK ] 0.17 sec. 2025-10-03 23:47:32 02244_column_names_in_shcmea_inference: [ OK ] 0.17 sec. 2025-10-03 23:47:33 02244_hdfs_cluster: [ OK ] 0.93 sec. 2025-10-03 23:47:44 02243_drop_user_grant_race: [ OK ] 10.78 sec. 2025-10-03 23:47:45 02242_arrow_orc_parquet_nullable_schema_inference: [ OK ] 1.68 sec. 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/rjdclycradnhoylxzfafpxwncmnfohig HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/kzhkfbgeedsvnpfzilnnqpcwewrnxsgc HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/jcqznxinzcmqjmvfcbuumchvhlpgqxqe HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/oanfouluvcrtmlcftlrrxzplbydvjbhl HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/vuaouxwvjmcyuqjdcjytnklihjzsivun HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/ybleelrtxjfdnoxewoybhvwpxepukwya HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/buswqywywfrnmkuiordddculgecvscjh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/frzqrcxwmvdsplmegcpxeifcxclztgsm HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/jijbhivngxwqwxbvujhgpvjvgvsvmxka HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "PUT /devstoreaccount1/cont/njwubpyjplklwrcukidwcpwfirbxpwgb HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "GET /devstoreaccount1/cont/jcqznxinzcmqjmvfcbuumchvhlpgqxqe HTTP/1.1" 206 520 127.0.0.1 - - [03/Oct/2025:22:47:48 +0000] "GET /devstoreaccount1/cont/kzhkfbgeedsvnpfzilnnqpcwewrnxsgc HTTP/1.1" 206 808111 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/njwubpyjplklwrcukidwcpwfirbxpwgb HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/buswqywywfrnmkuiordddculgecvscjh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/vuaouxwvjmcyuqjdcjytnklihjzsivun HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/kzhkfbgeedsvnpfzilnnqpcwewrnxsgc HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/jcqznxinzcmqjmvfcbuumchvhlpgqxqe HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/oanfouluvcrtmlcftlrrxzplbydvjbhl HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/ybleelrtxjfdnoxewoybhvwpxepukwya HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/jijbhivngxwqwxbvujhgpvjvgvsvmxka HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/frzqrcxwmvdsplmegcpxeifcxclztgsm HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:47:49 +0000] "DELETE /devstoreaccount1/cont/rjdclycradnhoylxzfafpxwncmnfohig HTTP/1.1" 202 - 2025-10-03 23:47:49 02242_system_filesystem_cache_log_table: [ OK ] 3.29 sec. 2025-10-03 23:47:59 02242_delete_user_race: [ OK ] 10.57 sec. 127.0.0.1 - - [03/Oct/2025:22:48:09 +0000] "PUT /devstoreaccount1/cont/ofuxcyfwynibtfiyatududtthajzpihf HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/mhmjnzfufabiqsflnqvuluuptfeqzrwf HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/qolnbhlabfyekvbnfknaipxetaughyxp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/gjacgrkmkvamhzlnzzudurzhqhfoagde HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/ejuwjjkfbassjlocqsloxcangvoumckb HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/aqrlikbgpkvpwokjvtxvuuhuivvonoqo HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/tnfryiwnexwnoblllpwkfuhplpvjutfl HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/yscosskmprpcujusnyjnottqntarhfkr HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:10 +0000] "PUT /devstoreaccount1/cont/zmhnapnxcpaixawrynrwaodehttfbptm HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/avyfyzttovpttxtboymarbhoccwqmwov HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/nxxemhkqtwhektiumnevjletcuhuvbhh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/dxqnaavdwqyixwaxfguqnzxxzrbcapxo HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/fuhzstujuyskqlqmzbtuqnpnzwpvctte HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/kvqzicvthzzlhttlrmrjurpfcfjhyzhx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/lnpgbalovpgtapwirahzebdxmawwihof HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/zkxhhgdjjwvehokmzfqtnumjtudcdvlh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:11 +0000] "PUT /devstoreaccount1/cont/wzitbvcphrytnskyhuuzztzsodowwzkt HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/fyvkxapfdpybhvsrewtunitgdyzjungz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/ccckyvursuexycchfhzdndyhdhrpdleh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/bpkahmwqemwbozxtuadzrcpijgqatweh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/gcvrvqrppebjjyjahpmrfftzenflugww HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/zjqoozegeqizgtpmpscntdchgzatrlbl HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vfpbsmhcxtarcuoppvzvqflfshrpnimo HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/wwhrzpfwlcwptnfiuhjlfvqjfsidmvfg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/tjemfbwmlcydpddmjnycvdsvgyahnako HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vuvmygnoaizlgtvgfuezgxfdcdonrzfb HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/odlvjqxmykuttdysbffhaimtymapmuxx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/otzspidjofzdnolwhftarcwbgdfrrdnn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/shoersumgeckmfbgebbnhyhgxeatpeak HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/jsckqnfpabqfkgzkeohunuhtvrnscbwy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/jcsnzdqhktthfvxjumkhhijaeydwdykr HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/wtaheezqchbnsykgyklxvegwalonjvbv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/cwvjqprkptgjmvoknwuxslyuwrdwtign HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/aiaygbvpoqninvxxxxdybpnechipztzy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/ifddalnomockuumcyrlisuhefclqepdw HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/jevexrbypmbnwuyyvikhajtesplfbzwc HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vtqbuafmbacgiqofervqlqjpdudndtft HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/flesnuaktieinburtofagscvhkctjzgj HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/yucowthmypdtabfyssikcxwzaixjivsm HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/tyaazbbfjcutudhuogdmjuxitwfsgrbu HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/qlnnsgfwefebuhofieazudfzbnrzhnuy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "GET /devstoreaccount1/cont/ccckyvursuexycchfhzdndyhdhrpdleh HTTP/1.1" 206 80 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "GET /devstoreaccount1/cont/mhmjnzfufabiqsflnqvuluuptfeqzrwf HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "GET /devstoreaccount1/cont/fyvkxapfdpybhvsrewtunitgdyzjungz HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/zybijneyxfzkjzsxnqffpsnsmehngozw HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/drcrmxlsdbzgsmjkmkvobjikqpwgofcp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/gpescmazrwzebbzpylgdrbbdzpkeeinp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/xmdqqvwohrunvnhjblifaxqgtrwdpojp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vplflwyqwponhcmamrdiziudcwqpudqf HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/egwfhjrwebfccepghlpztxtszexmqgki HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/mkvzauprxbpulcwfwfkelewuwoofoqru HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/okzavvgpapdvudmdllrwkriifyqockdu HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/lgbxdvfyvqbaoemhxhsonsuerjrticml HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/dagnmjpbrrmadabnspmcjcipwdvfpkdv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/yiagrjrqnksszrqztcvtteirvyuykyzc HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vzbmkfsimcvzhryjtzgauydfszplhkou HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/olvsozukdrqlgthgupsoffhkapfuvetd HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/yakhujszaxmmoowsngesbcgjhoraurqf HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/gxrrfqmhljntynuyknrkfwppnqtnkaix HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/edgtsvgijtlxgwhnmktmjzcmxltwpjwd HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:12 +0000] "PUT /devstoreaccount1/cont/vqjkuwjyltspukmjlstlurkswmmznmrl HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/diepfrfkxsmnbdjwxnbrfhqqojyujdva HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/gfqbtyegnoiuokralwwrklcappcjkzee HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/xmaslsqixeyvdvxhqvjqilmrrqkybcif HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/lsgdhvkqdpmkgtnjwucljudnkbasyqcg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/neugajfsfwvryyyrehrflylymfymjsmp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/zgpfbwmswzbeandsomlqivkmfwrpgqzx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/opopezjipognxnlgqlpknsjtscvpsxtr HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/nlolcaptkwiclufjbtpgrcvizobgmxff HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/mexejrgwhfzorkduktcznrpgarnnevku HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/vxjspttezsxyjfzkbqgtmhazegaoxczx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/ehegkmblegrvcatsqdstyeqawcwkimmg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/tfsdogowokbpamnitslghprlgikjwotd HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/scyzmonbrcpindllwojcnwzjtwzpdbuu HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/wijjkhlksuvdojcmyrirtmrgyieiowhb HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/jgkenqejcjzmweyysweplnhprxjzoxie HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/wrwjsnntbcbcjwsazaxygzqzretqfkkv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/jdfmdlursrwxcqffmtnbixlekdktegjq HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/xyfyfvcgsgqkriqpzvyzvhstgullxcou HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/ymtdgahunrmmsffyukaosgyavjbgrhqo HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/onoujuizxdfjiphnartvhhluxewwctmz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/qdfqdajvjimnqnkqpaenrkhaupvoenad HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/pyasktdfrxiwwrgvgdwzmmehuofecxja HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/upformdvnhykiiksqcuywnpqwybtspov HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/ohqwjfdwbqybpkhhrtdrqragsmrkxcnz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/renqxsehniohiddosmoncaauacaqzljz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/lvlmqhrszueaasvfbflgprwydydpobyz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/qjklkacuognlhggxufnepaihquxydbrh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/euqdmqcuebygqozpgdfcjzptuoewnbdq HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/ensbfnqawyaemjrafcscwqorftffekds HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/aqzuwykuuttnigrhfuflvtflxbrftkck HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/nrbsxxgftptwenraovuvvxixpbevzcpg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/mazjimymispcnnzqlzgyqrkthgffgqff HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/omhurcfyoikzukonztgedfueuqsvnqdn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/husltbyqhutpmqugjbnkezbcmmvmoaey HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/buzgekurwaryqslodlfygfrjqcsfmsjy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/pafymywgaakhlhefsmnclksqyasvlwul HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/djpzbjyzuvujhzrqovnfxnhwkwrhkblu HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/ksbpfcskkbsvywgmwwbfklqyjkdbqimn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/lwvlvkypkbbgnyomhktwquhkdpcxawep HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/fwyomppzxynrtbnlmutzblwyuoilikvf HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/pqthtkjqkjvccrpqthymtrpzhpnryyrw HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:13 +0000] "PUT /devstoreaccount1/cont/szzqnvnssnembhblshxfazfklegpfkma HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/kkupkcuqgjqroussjdtfkrlgzxbbqplv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/kfvcgvvnchyzrugdkxcrwiamdfapezfw HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/wegxjanrpnozbsaepvsfxlvtodypgkke HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/zirqlqrjqyopxlquuksufdhmwszsfkej HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/xkzkdmvajgiulmfpijtviyhxexewoatg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/pefdpzzthjsscwktmyjsakhcxzruayzg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/osnmmircxexfksjmymcttcfxikodertc HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "PUT /devstoreaccount1/cont/rrzcvcnzlduqwdicuzuqzroyxjbmggzn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zmhnapnxcpaixawrynrwaodehttfbptm HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/aqrlikbgpkvpwokjvtxvuuhuivvonoqo HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ejuwjjkfbassjlocqsloxcangvoumckb HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/mhmjnzfufabiqsflnqvuluuptfeqzrwf HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/qolnbhlabfyekvbnfknaipxetaughyxp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/gjacgrkmkvamhzlnzzudurzhqhfoagde HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/yscosskmprpcujusnyjnottqntarhfkr HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/tnfryiwnexwnoblllpwkfuhplpvjutfl HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/okzavvgpapdvudmdllrwkriifyqockdu HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vplflwyqwponhcmamrdiziudcwqpudqf HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/xmdqqvwohrunvnhjblifaxqgtrwdpojp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zybijneyxfzkjzsxnqffpsnsmehngozw HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/drcrmxlsdbzgsmjkmkvobjikqpwgofcp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/gpescmazrwzebbzpylgdrbbdzpkeeinp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/mkvzauprxbpulcwfwfkelewuwoofoqru HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/egwfhjrwebfccepghlpztxtszexmqgki HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vqjkuwjyltspukmjlstlurkswmmznmrl HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/yakhujszaxmmoowsngesbcgjhoraurqf HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/olvsozukdrqlgthgupsoffhkapfuvetd HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/dagnmjpbrrmadabnspmcjcipwdvfpkdv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/yiagrjrqnksszrqztcvtteirvyuykyzc HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vzbmkfsimcvzhryjtzgauydfszplhkou HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/edgtsvgijtlxgwhnmktmjzcmxltwpjwd HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/gxrrfqmhljntynuyknrkfwppnqtnkaix HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wzitbvcphrytnskyhuuzztzsodowwzkt HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/kvqzicvthzzlhttlrmrjurpfcfjhyzhx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/fuhzstujuyskqlqmzbtuqnpnzwpvctte HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/avyfyzttovpttxtboymarbhoccwqmwov HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/nxxemhkqtwhektiumnevjletcuhuvbhh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/dxqnaavdwqyixwaxfguqnzxxzrbcapxo HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zkxhhgdjjwvehokmzfqtnumjtudcdvlh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/lnpgbalovpgtapwirahzebdxmawwihof HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/tjemfbwmlcydpddmjnycvdsvgyahnako HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zjqoozegeqizgtpmpscntdchgzatrlbl HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/gcvrvqrppebjjyjahpmrfftzenflugww HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/fyvkxapfdpybhvsrewtunitgdyzjungz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ccckyvursuexycchfhzdndyhdhrpdleh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/bpkahmwqemwbozxtuadzrcpijgqatweh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wwhrzpfwlcwptnfiuhjlfvqjfsidmvfg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vfpbsmhcxtarcuoppvzvqflfshrpnimo HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/cwvjqprkptgjmvoknwuxslyuwrdwtign HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/jsckqnfpabqfkgzkeohunuhtvrnscbwy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/shoersumgeckmfbgebbnhyhgxeatpeak HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vuvmygnoaizlgtvgfuezgxfdcdonrzfb HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/odlvjqxmykuttdysbffhaimtymapmuxx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/otzspidjofzdnolwhftarcwbgdfrrdnn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wtaheezqchbnsykgyklxvegwalonjvbv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/jcsnzdqhktthfvxjumkhhijaeydwdykr HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/qlnnsgfwefebuhofieazudfzbnrzhnuy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/flesnuaktieinburtofagscvhkctjzgj HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vtqbuafmbacgiqofervqlqjpdudndtft HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/aiaygbvpoqninvxxxxdybpnechipztzy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ifddalnomockuumcyrlisuhefclqepdw HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/jevexrbypmbnwuyyvikhajtesplfbzwc HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/tyaazbbfjcutudhuogdmjuxitwfsgrbu HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/yucowthmypdtabfyssikcxwzaixjivsm HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/vxjspttezsxyjfzkbqgtmhazegaoxczx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/diepfrfkxsmnbdjwxnbrfhqqojyujdva HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zgpfbwmswzbeandsomlqivkmfwrpgqzx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/gfqbtyegnoiuokralwwrklcappcjkzee HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/opopezjipognxnlgqlpknsjtscvpsxtr HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/neugajfsfwvryyyrehrflylymfymjsmp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/xmaslsqixeyvdvxhqvjqilmrrqkybcif HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/lsgdhvkqdpmkgtnjwucljudnkbasyqcg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/mexejrgwhfzorkduktcznrpgarnnevku HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/nlolcaptkwiclufjbtpgrcvizobgmxff HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/onoujuizxdfjiphnartvhhluxewwctmz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ehegkmblegrvcatsqdstyeqawcwkimmg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wrwjsnntbcbcjwsazaxygzqzretqfkkv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/tfsdogowokbpamnitslghprlgikjwotd HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/jdfmdlursrwxcqffmtnbixlekdktegjq HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/jgkenqejcjzmweyysweplnhprxjzoxie HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/scyzmonbrcpindllwojcnwzjtwzpdbuu HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wijjkhlksuvdojcmyrirtmrgyieiowhb HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ymtdgahunrmmsffyukaosgyavjbgrhqo HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/xyfyfvcgsgqkriqpzvyzvhstgullxcou HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/aqzuwykuuttnigrhfuflvtflxbrftkck HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/qdfqdajvjimnqnkqpaenrkhaupvoenad HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/lvlmqhrszueaasvfbflgprwydydpobyz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/pyasktdfrxiwwrgvgdwzmmehuofecxja HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/qjklkacuognlhggxufnepaihquxydbrh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/renqxsehniohiddosmoncaauacaqzljz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/upformdvnhykiiksqcuywnpqwybtspov HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ohqwjfdwbqybpkhhrtdrqragsmrkxcnz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ensbfnqawyaemjrafcscwqorftffekds HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/euqdmqcuebygqozpgdfcjzptuoewnbdq HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/fwyomppzxynrtbnlmutzblwyuoilikvf HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/nrbsxxgftptwenraovuvvxixpbevzcpg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/pafymywgaakhlhefsmnclksqyasvlwul HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/mazjimymispcnnzqlzgyqrkthgffgqff HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/djpzbjyzuvujhzrqovnfxnhwkwrhkblu HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/buzgekurwaryqslodlfygfrjqcsfmsjy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/omhurcfyoikzukonztgedfueuqsvnqdn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/husltbyqhutpmqugjbnkezbcmmvmoaey HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/lwvlvkypkbbgnyomhktwquhkdpcxawep HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ksbpfcskkbsvywgmwwbfklqyjkdbqimn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/rrzcvcnzlduqwdicuzuqzroyxjbmggzn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/pqthtkjqkjvccrpqthymtrpzhpnryyrw HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/zirqlqrjqyopxlquuksufdhmwszsfkej HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/szzqnvnssnembhblshxfazfklegpfkma HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/xkzkdmvajgiulmfpijtviyhxexewoatg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/wegxjanrpnozbsaepvsfxlvtodypgkke HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/kkupkcuqgjqroussjdtfkrlgzxbbqplv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/kfvcgvvnchyzrugdkxcrwiamdfapezfw HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/osnmmircxexfksjmymcttcfxikodertc HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/pefdpzzthjsscwktmyjsakhcxzruayzg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/ofuxcyfwynibtfiyatududtthajzpihf HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:14 +0000] "DELETE /devstoreaccount1/cont/lgbxdvfyvqbaoemhxhsonsuerjrticml HTTP/1.1" 202 - 2025-10-03 23:48:14 02241_filesystem_cache_on_write_operations: [ OK ] 14.80 sec. 2025-10-03 23:48:15 02240_tskv_schema_inference_bug: [ OK ] 0.52 sec. 2025-10-03 23:48:15 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.22 sec. 2025-10-03 23:48:15 02240_filesystem_query_cache: [ OK ] 0.22 sec. 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/dkrepmumblmsawflhglhpxzicsbtbwwd HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/bcyifaqjzkpmvldqmqgjxlnsxyklxqxx HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/cyiopygjcnlclalhvsualwcotqvbkvvr HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/aofykjvpguxsbimxkfewgrlmcqzzmjxa HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/htdyrccaecmxniiitowlnsbiltngsfwm HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/ofbdauhqpyxpwzxqlayjeabebmeyymxe HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/eezinohmupgcqbjtlbienfnnwbmqeqwe HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/oxliyldgidfbixlqblvcdzucvhkjtfao HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/wehsuuhxezzbvqamlzsracvrpfyzsrda HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "PUT /devstoreaccount1/cont/owpwusihkuevtcaksctisecvbvmvgmqs HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "GET /devstoreaccount1/cont/cyiopygjcnlclalhvsualwcotqvbkvvr HTTP/1.1" 206 80 127.0.0.1 - - [03/Oct/2025:22:48:19 +0000] "GET /devstoreaccount1/cont/bcyifaqjzkpmvldqmqgjxlnsxyklxqxx HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "GET /devstoreaccount1/cont/cyiopygjcnlclalhvsualwcotqvbkvvr HTTP/1.1" 206 80 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "GET /devstoreaccount1/cont/bcyifaqjzkpmvldqmqgjxlnsxyklxqxx HTTP/1.1" 206 746 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/owpwusihkuevtcaksctisecvbvmvgmqs HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/eezinohmupgcqbjtlbienfnnwbmqeqwe HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/htdyrccaecmxniiitowlnsbiltngsfwm HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/bcyifaqjzkpmvldqmqgjxlnsxyklxqxx HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/cyiopygjcnlclalhvsualwcotqvbkvvr HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/aofykjvpguxsbimxkfewgrlmcqzzmjxa HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/ofbdauhqpyxpwzxqlayjeabebmeyymxe HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/wehsuuhxezzbvqamlzsracvrpfyzsrda HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/oxliyldgidfbixlqblvcdzucvhkjtfao HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:20 +0000] "DELETE /devstoreaccount1/cont/dkrepmumblmsawflhglhpxzicsbtbwwd HTTP/1.1" 202 - 2025-10-03 23:48:20 02240_system_filesystem_cache_table: [ OK ] 4.52 sec. 2025-10-03 23:48:20 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec. 2025-10-03 23:48:20 Reason: disabled 2025-10-03 23:48:21 02227_test_create_empty_sqlite_db: [ OK ] 0.62 sec. 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/hbjntfvqwecbajfnqpyjfxwjfuictgay HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/pyqhahhjzloostfvdtrhkotrnkfhczqg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/xigzjbfhawpenpzbyxhtwwdocvjpowhj HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/wpwijkubwhordizoonwhmcbqxxabnxqc HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/xgnbssfcraxinpmepaehfmcdkmjipavy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/fwjohiqtpmwlkecrtykodwuvdsoerdnl HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/ljolygshupirzsscwioqpiwxumjrpojv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/cbubskyzuchwjasgnrgaoynlpgyvnncw HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/fhlygvwpbqosnwsjvthwghjgyxfkzyst HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "PUT /devstoreaccount1/cont/bezzpnxqeygtzrykwnijlpqbolxflwuh HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "GET /devstoreaccount1/cont/xigzjbfhawpenpzbyxhtwwdocvjpowhj HTTP/1.1" 206 62 127.0.0.1 - - [03/Oct/2025:22:48:23 +0000] "GET /devstoreaccount1/cont/pyqhahhjzloostfvdtrhkotrnkfhczqg HTTP/1.1" 206 100160 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/xmigxinpwacksehlmlremansswhjjlgp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/wemihghcsmsieijqbxhxaffcrqefuxqz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/vwjhirjybisovcfuqhlxvqedbzaxemez HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/lashkmcupeavrjpskjmhjhdrwniagveg HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/ppbrlzhqltpaufcetmkrrbjizegwmdjd HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/bezzpnxqeygtzrykwnijlpqbolxflwuh HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/ljolygshupirzsscwioqpiwxumjrpojv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/xgnbssfcraxinpmepaehfmcdkmjipavy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/xigzjbfhawpenpzbyxhtwwdocvjpowhj HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/pyqhahhjzloostfvdtrhkotrnkfhczqg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/wpwijkubwhordizoonwhmcbqxxabnxqc HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/fwjohiqtpmwlkecrtykodwuvdsoerdnl HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/fhlygvwpbqosnwsjvthwghjgyxfkzyst HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/cbubskyzuchwjasgnrgaoynlpgyvnncw HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/musaumpedsacvlymxvminvdczjveboxe HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/beojvlewjnjpwyvfnxlnjtpbdqfasuwi HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/rgrulvzxiearkdbehvcqupsasgrcjhpn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/syihbhogwchzhwfpmctdgzrrcljenhzp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/sdfckxoxhszxheklhitjlyambnosmgxp HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/obsgsiwdviestzqhjcmqtvugtdcjdadn HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/pcodysojjrnsbyqnpkcgctgsgrgbslaz HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/hkfchgbvzpyxdhdhtahkxtbxoiulgsmv HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "PUT /devstoreaccount1/cont/mjwpmnceydeurcjafowghxcizzgnhzfy HTTP/1.1" 201 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/ppbrlzhqltpaufcetmkrrbjizegwmdjd HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/wemihghcsmsieijqbxhxaffcrqefuxqz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/xmigxinpwacksehlmlremansswhjjlgp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/mxzhtphutzzppfnjhbjwoxpgvtdhhqyq HTTP/1.1" 404 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/boeglwsmcpzvnnmqmdqviqzaqfkekeni HTTP/1.1" 404 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/epschaokmmsdrzntvksizibqalapubbo HTTP/1.1" 404 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/lashkmcupeavrjpskjmhjhdrwniagveg HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/vwjhirjybisovcfuqhlxvqedbzaxemez HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/mjwpmnceydeurcjafowghxcizzgnhzfy HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/obsgsiwdviestzqhjcmqtvugtdcjdadn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/syihbhogwchzhwfpmctdgzrrcljenhzp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/beojvlewjnjpwyvfnxlnjtpbdqfasuwi HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/musaumpedsacvlymxvminvdczjveboxe HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/rgrulvzxiearkdbehvcqupsasgrcjhpn HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/sdfckxoxhszxheklhitjlyambnosmgxp HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/hkfchgbvzpyxdhdhtahkxtbxoiulgsmv HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/pcodysojjrnsbyqnpkcgctgsgrgbslaz HTTP/1.1" 202 - 127.0.0.1 - - [03/Oct/2025:22:48:24 +0000] "DELETE /devstoreaccount1/cont/hbjntfvqwecbajfnqpyjfxwjfuictgay HTTP/1.1" 202 - 2025-10-03 23:48:24 02226_filesystem_cache_profile_events: [ OK ] 3.50 sec. 2025-10-03 23:48:25 02225_unwinder_dwarf_version: [ OK ] 0.48 sec. 2025-10-03 23:48:26 02222_create_table_without_columns_metadata: [ OK ] 1.53 sec. 2025-10-03 23:48:26 02211_jsonl_format_extension: [ OK ] 0.12 sec. 2025-10-03 23:48:27 02211_shcema_inference_from_stdin: [ OK ] 0.72 sec. 2025-10-03 23:48:29 02207_allow_plaintext_and_no_password: [ OK ] 1.67 sec. 2025-10-03 23:48:30 02187_msg_pack_uuid: [ OK ] 1.08 sec. 2025-10-03 23:48:31 02185_values_schema_inference: [ OK ] 0.83 sec. 2025-10-03 23:48:32 02184_table_engine_access: [ OK ] 1.33 sec. 2025-10-03 23:48:33 02184_ipv6_parsing: [ OK ] 0.93 sec. 2025-10-03 23:48:34 02182_format_and_schema_from_stdin: [ OK ] 1.23 sec. 2025-10-03 23:48:35 02182_json_each_row_schema_inference: [ OK ] 0.57 sec. 2025-10-03 23:48:35 02181_detect_output_format_by_file_extension: [ OK ] 0.67 sec. 2025-10-03 23:48:36 02181_format_from_file_extension_local: [ OK ] 0.53 sec. 2025-10-03 23:48:36 02179_dict_reload_on_cluster: [ OK ] 0.32 sec. 2025-10-03 23:48:37 02177_temporary_table_current_database_http_session: [ OK ] 0.42 sec. 2025-10-03 23:48:37 02168_avro_bug: [ OK ] 0.17 sec. 2025-10-03 23:48:37 02166_arrow_dictionary_inference: [ OK ] 0.52 sec. 2025-10-03 23:48:38 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.27 sec. 2025-10-03 23:48:39 02152_bool_type_parsing: [ OK ] 0.77 sec. 2025-10-03 23:48:39 02148_sql_user_defined_function_subquery: [ OK ] 0.22 sec. 2025-10-03 23:48:40 02127_plus_before_float: [ OK ] 1.27 sec. 2025-10-03 23:48:40 02126_identity_user_defined_function: [ OK ] 0.17 sec. 2025-10-03 23:48:41 02125_tskv_proper_names_reading: [ OK ] 0.43 sec. 2025-10-03 23:48:41 02125_recursive_sql_user_defined_functions: [ OK ] 0.22 sec. 2025-10-03 23:49:00 02125_many_mutations_2: [ OK ] 19.19 sec. 2025-10-03 23:49:01 02115_rewrite_local_join_right_distribute_table: [ OK ] 0.32 sec. 2025-10-03 23:49:01 02111_modify_table_comment: [ OK ] 0.22 sec. 2025-10-03 23:49:02 02105_table_function_file_partiotion_by: [ OK ] 0.77 sec. 2025-10-03 23:49:02 02104_json_strings_nullable_string: [ OK ] 0.52 sec. 2025-10-03 23:49:06 02103_tsv_csv_custom_null_representation: [ OK ] 3.80 sec. 2025-10-03 23:49:06 02103_sql_user_defined_functions_composition: [ OK ] 0.18 sec. 2025-10-03 23:49:06 02102_sql_user_defined_functions_create_if_not_exists: [ OK ] 0.12 sec. 2025-10-03 23:49:06 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.17 sec. 2025-10-03 23:49:07 02101_sql_user_defined_functions_create_or_replace: [ OK ] 0.17 sec. 2025-10-03 23:49:07 02099_sql_user_defined_functions_lambda: [ OK ] 0.17 sec. 2025-10-03 23:49:07 02098_sql_user_defined_functions_aliases: [ OK ] 0.12 sec. 2025-10-03 23:49:07 02097_default_dict_get_add_database: [ OK ] 0.22 sec. 2025-10-03 23:49:07 02096_rename_atomic_hang: [ OK ] 0.22 sec. 2025-10-03 23:49:08 02096_sql_user_defined_function_alias: [ OK ] 0.12 sec. 2025-10-03 23:49:09 02051_read_settings: [ OK ] 1.63 sec. 2025-10-03 23:49:10 02051_symlinks_to_user_files: [ OK ] 0.67 sec. 2025-10-03 23:49:10 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.57 sec. 2025-10-03 23:49:17 02026_storage_filelog_largefile: [ OK ] 6.20 sec. 2025-10-03 23:49:17 02025_dictionary_view_different_db: [ OK ] 0.27 sec. 2025-10-03 23:49:17 02024_merge_regexp_assert: [ OK ] 0.17 sec. 2025-10-03 23:49:18 02015_global_in_threads: [ OK ] 0.77 sec. 2025-10-03 23:49:18 02015_column_default_dict_get_identifier: [ OK ] 0.17 sec. 2025-10-03 23:49:20 02014_query_parameters: [ OK ] 1.32 sec. 2025-10-03 23:49:20 02011_dictionary_empty_attribute_list: [ OK ] 0.17 sec. 2025-10-03 23:49:20 02008_complex_key_range_hashed_dictionary: [ OK ] 0.47 sec. 2025-10-03 23:49:20 02001_add_default_database_to_system_users: [ OK ] 0.12 sec. 2025-10-03 23:49:21 01999_grant_with_replace: [ OK ] 0.22 sec. 2025-10-03 23:49:21 01948_dictionary_quoted_database_name: [ OK ] 0.22 sec. 2025-10-03 23:49:22 01946_test_zstd_decompression_with_escape_sequence_at_the_end_of_buffer: [ OK ] 0.72 sec. 2025-10-03 23:49:54 01946_test_wrong_host_name_access: [ OK ] 32.48 sec. 2025-10-03 23:49:55 01939_user_with_default_database: [ OK ] 0.98 sec. 2025-10-03 23:49:55 01925_test_storage_merge_aliases_analyzer: [ OK ] 0.22 sec. 2025-10-03 23:49:56 01925_test_storage_merge_aliases: [ OK ] 0.22 sec. 2025-10-03 23:50:06 01923_network_receive_time_metric_insert: [ OK ] 10.53 sec. 2025-10-03 23:50:32 01921_concurrent_ttl_and_normal_merges_zookeeper_long: [ OK ] 25.44 sec. 2025-10-03 23:50:32 01915_create_or_replace_dictionary: [ OK ] 0.27 sec. 2025-10-03 23:50:32 01914_exchange_dictionaries: [ OK ] 0.27 sec. 2025-10-03 23:50:33 01913_exact_rows_before_limit: [ OK ] 0.52 sec. 2025-10-03 23:50:33 01913_replace_dictionary: [ OK ] 0.22 sec. 2025-10-03 23:50:33 01913_exact_rows_before_limit_full: [ OK ] 0.27 sec. 2025-10-03 23:50:33 01910_view_dictionary: [ OK ] 0.22 sec. 2025-10-03 23:50:34 01904_dictionary_default_nullable_type: [ OK ] 0.68 sec. 2025-10-03 23:50:35 01904_ssd_cache_dictionary_default_nullable_type: [ OK ] 0.58 sec. 2025-10-03 23:50:35 01903_ssd_cache_dictionary_array_type: [ OK ] 0.52 sec. 2025-10-03 23:50:36 01902_dictionary_array_type: [ OK ] 0.57 sec. 2025-10-03 23:50:36 01902_table_function_merge_db_repr: [ OK ] 0.42 sec. 2025-10-03 23:50:37 01901_test_attach_partition_from: [ OK ] 0.53 sec. 2025-10-03 23:50:41 01889_sqlite_read_write: [ OK ] 3.89 sec. 2025-10-03 23:50:41 01889_postgresql_protocol_null_fields: [ OK ] 0.47 sec. 2025-10-03 23:50:42 01875_ssd_cache_dictionary_decimal256_type: [ OK ] 0.47 sec. 2025-10-03 23:50:42 01870_buffer_flush: [ OK ] 0.17 sec. 2025-10-03 23:50:42 01856_create_function: [ OK ] 0.22 sec. 2025-10-03 23:50:42 01854_dictionary_range_hashed_min_max_attr: [ OK ] 0.12 sec. 2025-10-03 23:50:43 01853_dictionary_cache_duplicates: [ OK ] 0.77 sec. 2025-10-03 23:50:44 01852_dictionary_found_rate_long: [ OK ] 0.97 sec. 2025-10-03 23:50:44 01850_dist_INSERT_preserve_error: [ OK ] 0.22 sec. 2025-10-03 23:50:45 01837_database_memory_ddl_dictionaries: [ OK ] 0.17 sec. 2025-10-03 23:50:45 01825_type_json_17: [ OK ] 0.32 sec. 2025-10-03 23:50:45 01824_prefer_global_in_and_join: [ OK ] 0.27 sec. 2025-10-03 23:50:46 01821_table_comment: [ OK ] 0.37 sec. 2025-10-03 23:50:46 01821_dictionary_primary_key_wrong_order: [ OK ] 0.17 sec. 2025-10-03 23:50:46 01804_dictionary_decimal256_type: [ OK ] 0.37 sec. 2025-10-03 23:50:47 01802_test_postgresql_protocol_with_row_policy: [ OK ] 1.02 sec. 2025-10-03 23:50:48 01785_dictionary_element_count: [ OK ] 0.37 sec. 2025-10-03 23:50:48 01780_clickhouse_dictionary_source_loop: [ OK ] 0.27 sec. 2025-10-03 23:50:48 01778_hierarchical_dictionaries: [ OK ] 0.32 sec. 2025-10-03 23:50:48 01778_mmap_cache_infra: [ OK ] 0.12 sec. 2025-10-03 23:50:49 01771_bloom_filter_not_has: [ OK ] 0.77 sec. 2025-10-03 23:50:50 01766_hashed_dictionary_complex_key: [ OK ] 0.37 sec. 2025-10-03 23:50:50 01765_hashed_dictionary_simple_key: [ OK ] 0.62 sec. 2025-10-03 23:50:51 01760_polygon_dictionaries: [ OK ] 0.32 sec. 2025-10-03 23:50:51 01760_system_dictionaries: [ OK ] 0.27 sec. 2025-10-03 23:50:51 01759_dictionary_unique_attribute_names: [ OK ] 0.22 sec. 2025-10-03 23:50:52 01754_direct_dictionary_complex_key: [ OK ] 0.47 sec. 2025-10-03 23:50:52 01753_direct_dictionary_simple_key: [ OK ] 0.57 sec. 2025-10-03 23:50:52 01748_dictionary_table_dot: [ OK ] 0.22 sec. 2025-10-03 23:50:53 01747_join_view_filter_dictionary: [ OK ] 0.27 sec. 2025-10-03 23:50:54 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.57 sec. 2025-10-03 23:51:08 01747_system_session_log_long: [ OK ] 13.35 sec. 2025-10-03 23:51:09 01746_executable_pool_dictionary: [ OK ] 1.53 sec. 2025-10-03 23:51:11 01737_clickhouse_server_wait_server_pool_long: [ OK ] 1.58 sec. 2025-10-03 23:51:13 01722_long_brotli_http_compression_json_format: [ OK ] 2.48 sec. 2025-10-03 23:51:14 01721_dictionary_decimal_p_s: [ OK ] 0.27 sec. 2025-10-03 23:51:14 01721_engine_file_truncate_on_insert: [ OK ] 0.17 sec. 2025-10-03 23:51:14 01720_dictionary_create_source_with_functions: [ OK ] 0.22 sec. 2025-10-03 23:51:18 01710_projection_vertical_merges: [ OK ] 3.89 sec. 2025-10-03 23:51:18 01705_normalize_create_alter_function_names: [ OK ] 0.22 sec. 2025-10-03 23:51:19 01702_system_query_log: [ OK ] 0.57 sec. 2025-10-03 23:51:20 01684_ssd_cache_dictionary_simple_key: [ OK ] 0.72 sec. 2025-10-03 23:51:20 01683_flat_dictionary: [ OK ] 0.42 sec. 2025-10-03 23:51:20 01682_cache_dictionary_complex_key: [ OK ] 0.37 sec. 2025-10-03 23:51:21 01681_cache_dictionary_simple_key: [ OK ] 0.47 sec. 2025-10-03 23:51:21 01676_dictget_in_default_expression: [ OK ] 0.27 sec. 2025-10-03 23:51:24 01674_executable_dictionary_implicit_key: [ OK ] 3.04 sec. 2025-10-03 23:51:24 01670_dictionary_create_key_expression: [ OK ] 0.22 sec. 2025-10-03 23:51:27 01658_read_file_to_stringcolumn: [ OK ] 2.39 sec. 2025-10-03 23:51:28 01656_test_query_log_factories_info: [ OK ] 0.62 sec. 2025-10-03 23:51:28 01646_system_restart_replicas_smoke: [ OK ] 0.22 sec. 2025-10-03 23:51:29 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.13 sec. 2025-10-03 23:51:29 01625_constraints_index_append: [ OK ] 0.22 sec. 2025-10-03 23:51:30 01615_random_one_shard_insertion: [ OK ] 0.37 sec. 2025-10-03 23:51:30 01603_rename_overwrite_bug: [ OK ] 0.27 sec. 2025-10-03 23:51:30 01602_show_create_view: [ OK ] 0.22 sec. 2025-10-03 23:51:31 01601_detach_permanently: [ OK ] 0.72 sec. 2025-10-03 23:51:50 01600_detach_permanently: [ OK ] 18.98 sec. 2025-10-03 23:51:50 01600_parts_states_metrics_long: [ OK ] 0.57 sec. 2025-10-03 23:51:53 01600_log_queries_with_extensive_info: [ OK ] 2.28 sec. 2025-10-03 23:51:53 01598_memory_limit_zeros: [ OK ] 0.12 sec. 2025-10-03 23:52:30 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 37.03 sec. 2025-10-03 23:52:56 01593_concurrent_alter_mutations_kill: [ OK ] 25.92 sec. 2025-10-03 23:52:56 01575_disable_detach_table_of_dictionary: [ OK ] 0.17 sec. 2025-10-03 23:52:57 01563_distributed_query_finish: [ OK ] 0.97 sec. 2025-10-03 23:52:58 01545_system_errors: [ OK ] 0.97 sec. 2025-10-03 23:52:59 01543_avro_deserialization_with_lc: [ OK ] 1.07 sec. 2025-10-03 23:53:10 01542_dictionary_load_exception_race: [ OK ] 11.16 sec. 2025-10-03 23:53:29 01541_max_memory_usage_for_user_long: [ OK ] 18.65 sec. 2025-10-03 23:53:30 01533_multiple_nested: [ OK ] 1.12 sec. 2025-10-03 23:53:48 01532_execute_merges_on_single_replica_long: [ OK ] 17.74 sec. 2025-10-03 23:53:48 01530_drop_database_atomic_sync: [ OK ] 0.52 sec. 2025-10-03 23:53:49 01527_dist_sharding_key_dictGet_reload: [ OK ] 0.27 sec. 2025-10-03 23:53:49 01527_clickhouse_local_optimize: [ OK ] 0.72 sec. 2025-10-03 23:53:50 01526_complex_key_dict_direct_layout: [ OK ] 0.22 sec. 2025-10-03 23:53:50 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.58 sec. 2025-10-03 23:53:51 01517_drop_mv_with_inner_table: [ OK ] 0.29 sec. 2025-10-03 23:53:51 01516_create_table_primary_key: [ OK ] 0.37 sec. 2025-10-03 23:53:53 01507_clickhouse_server_start_with_embedded_config: [ OK ] 2.04 sec. 2025-10-03 23:54:24 01502_long_log_tinylog_deadlock_race: [ OK ] 30.75 sec. 2025-10-03 23:54:25 01501_cache_dictionary_all_fields: [ OK ] 0.98 sec. 2025-10-03 23:54:25 01494_storage_join_persistency: [ OK ] 0.22 sec. 2025-10-03 23:54:25 01493_storage_set_persistency: [ OK ] 0.27 sec. 2025-10-03 23:54:26 01475_read_subcolumns: [ OK ] 0.78 sec. 2025-10-03 23:54:29 01474_executable_dictionary: [ OK ] 3.13 sec. 2025-10-03 23:54:30 01471_calculate_ttl_during_merge: [ OK ] 0.27 sec. 2025-10-03 23:54:30 01470_show_databases_like: [ OK ] 0.17 sec. 2025-10-03 23:54:30 01465_ttl_recompression: [ OK ] 0.37 sec. 2025-10-03 23:54:47 01459_manual_write_to_replicas: [ OK ] 16.69 sec. 2025-10-03 23:54:53 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 6.50 sec. 2025-10-03 23:55:09 01459_manual_write_to_replicas_quorum: [ OK ] 15.61 sec. 2025-10-03 23:55:09 01457_create_as_table_function_structure: [ OK ] 0.27 sec. 2025-10-03 23:55:10 01455_rank_correlation_spearman: [ OK ] 0.27 sec. 2025-10-03 23:55:30 01454_storagememory_data_race_challenge: [ OK ] 20.02 sec. 2025-10-03 23:55:31 01417_freeze_partition_verbose_zookeeper: [ OK ] 1.68 sec. 2025-10-03 23:55:34 01417_freeze_partition_verbose: [ OK ] 2.78 sec. 2025-10-03 23:55:34 01415_overlimiting_threads_for_repica_bug: [ OK ] 0.27 sec. 2025-10-03 23:55:35 01415_inconsistent_merge_tree_settings: [ OK ] 0.17 sec. 2025-10-03 23:56:18 01414_mutations_and_errors_zookeeper: [ OK ] 42.84 sec. 2025-10-03 23:56:38 01412_cache_dictionary_race: [ OK ] 20.67 sec. 2025-10-03 23:56:41 01410_nullable_key_more_tests: [ OK ] 2.73 sec. 2025-10-03 23:56:41 01383_remote_ambiguous_column_shard: [ OK ] 0.22 sec. 2025-10-03 23:56:41 01376_GROUP_BY_injective_elimination_dictGet: [ OK ] 0.17 sec. 2025-10-03 23:56:42 01375_compact_parts_codecs: [ OK ] 0.27 sec. 2025-10-03 23:56:44 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 2.39 sec. 2025-10-03 23:56:46 01360_materialized_view_with_join_on_query_log: [ OK ] 1.69 sec. 2025-10-03 23:56:46 01358_union_threads_bug: [ OK ] 0.27 sec. 2025-10-03 23:56:46 01356_view_threads: [ OK ] 0.22 sec. 2025-10-03 23:56:57 01320_create_sync_race_condition_zookeeper: [ OK ] 10.41 sec. 2025-10-03 23:57:06 01318_long_unsuccessful_mutation_zookeeper: [ OK ] 8.85 sec. 2025-10-03 23:57:08 01307_multiple_leaders_zookeeper: [ OK ] 2.34 sec. 2025-10-03 23:57:19 01305_replica_create_drop_zookeeper: [ OK ] 10.56 sec. 2025-10-03 23:57:50 01302_aggregate_state_exception_memory_leak: [ OK ] 31.40 sec. 2025-10-03 23:58:21 01301_aggregate_state_exception_memory_leak: [ OK ] 31.01 sec. 2025-10-03 23:58:22 01297_create_quota: [ OK ] 0.58 sec. 2025-10-03 23:58:22 01296_create_row_policy_in_current_database: [ OK ] 0.22 sec. 2025-10-03 23:58:22 01295_create_row_policy: [ OK ] 0.27 sec. 2025-10-03 23:58:23 01294_create_settings_profile: [ OK ] 0.38 sec. 2025-10-03 23:58:23 01294_system_distributed_on_cluster: [ OK ] 0.32 sec. 2025-10-03 23:58:23 01293_create_role: [ OK ] 0.22 sec. 2025-10-03 23:58:23 01293_system_distribution_queue: [ OK ] 0.22 sec. 2025-10-03 23:58:25 01292_create_user: [ OK ] 1.53 sec. 2025-10-03 23:58:25 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.22 sec. 2025-10-03 23:58:29 01281_group_by_limit_memory_tracking: [ OK ] 3.68 sec. 2025-10-03 23:58:29 01280_ttl_where_group_by_negative: [ OK ] 0.17 sec. 2025-10-03 23:58:30 01280_ssd_complex_key_dictionary: [ OK ] 1.33 sec. 2025-10-03 23:59:07 01275_parallel_mv: [ OK ] 37.07 sec. 2025-10-03 23:59:08 01268_dictionary_direct_layout: [ OK ] 0.68 sec. 2025-10-03 23:59:09 01257_dictionary_mismatch_types: [ OK ] 0.38 sec. 2025-10-03 23:59:09 01251_dict_is_in_infinite_loop: [ OK ] 0.37 sec. 2025-10-03 23:59:09 01249_bad_arguments_for_bloom_filter: [ OK ] 0.22 sec. 2025-10-03 23:59:23 01238_http_memory_tracking: [ OK ] 14.20 sec. 2025-10-03 23:59:24 01232_extremes: [ OK ] 0.42 sec. 2025-10-03 23:59:24 01231_distributed_aggregation_memory_efficient_mix_levels: [ OK ] 0.28 sec. 2025-10-03 23:59:24 01225_show_create_table_from_dictionary: [ OK ] 0.17 sec. 2025-10-03 23:59:25 01224_no_superfluous_dict_reload: [ OK ] 0.32 sec. 2025-10-03 23:59:34 01200_mutations_memory_consumption: [ OK ] 9.67 sec. 2025-10-04 00:00:03 01192_rename_database_zookeeper: [ OK ] 28.83 sec. 2025-10-04 00:00:03 01191_rename_dictionary: [ OK ] 0.27 sec. 2025-10-04 00:00:04 01164_alter_memory_database: [ OK ] 0.27 sec. 2025-10-04 00:00:09 01161_all_system_tables: [ OK ] 5.01 sec. 2025-10-04 00:00:09 01155_rename_move_materialized_view: [ OK ] 0.57 sec. 2025-10-04 00:01:05 01154_move_partition_long: [ OK ] 55.74 sec. 2025-10-04 00:01:06 01153_attach_mv_uuid: [ OK ] 0.32 sec. 2025-10-04 00:01:06 01152_cross_replication: [ OK ] 0.47 sec. 2025-10-04 00:01:28 01150_ddl_guard_rwr: [ OK ] 21.94 sec. 2025-10-04 00:01:29 01148_zookeeper_path_macros_unfolding: [ OK ] 0.82 sec. 2025-10-04 00:01:29 01129_dict_get_join_lose_constness: [ OK ] 0.17 sec. 2025-10-04 00:01:29 01119_weird_user_names: [ OK ] 0.17 sec. 2025-10-04 00:06:45 01111_create_drop_replicated_db_stress: [ OK ] 315.65 sec. 2025-10-04 00:06:45 01110_dictionary_layout_without_arguments: [ OK ] 0.17 sec. 2025-10-04 00:06:46 01109_exchange_tables: [ OK ] 0.52 sec. 2025-10-04 00:06:59 01108_restart_replicas_rename_deadlock_zookeeper: [ OK ] 13.79 sec. 2025-10-04 00:07:21 01107_atomic_db_detach_attach: [ OK ] 21.21 sec. 2025-10-04 00:07:21 01103_distributed_product_mode_local_column_renames: [ OK ] 0.37 sec. 2025-10-04 00:07:28 01098_temporary_and_external_tables: [ OK ] 6.65 sec. 2025-10-04 00:07:40 01092_memory_profiler: [ OK ] 12.64 sec. 2025-10-04 00:07:41 01091_num_threads: [ OK ] 0.83 sec. 2025-10-04 00:07:43 01085_max_distributed_connections_http: [ OK ] 1.38 sec. 2025-10-04 00:08:19 01083_expressions_in_engine_arguments: [ OK ] 36.03 sec. 2025-10-04 00:08:20 01082_window_view_watch_limit: [ OK ] 1.03 sec. 2025-10-04 00:08:49 01079_parallel_alter_modify_zookeeper_long: [ OK ] 29.77 sec. 2025-10-04 00:09:10 01079_parallel_alter_detach_table_zookeeper: [ OK ] 20.22 sec. 2025-10-04 00:09:36 01079_parallel_alter_add_drop_column_zookeeper: [ OK ] 26.62 sec. 2025-10-04 00:09:38 01078_window_view_alter_query_watch: [ OK ] 1.93 sec. 2025-10-04 00:10:02 01076_parallel_alter_replicated_zookeeper: [ OK ] 24.11 sec. 2025-10-04 00:10:08 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 5.79 sec. 2025-10-04 00:10:10 01075_window_view_proc_tumble_to_now_populate: [ OK ] 1.88 sec. 2025-10-04 00:10:20 01072_window_view_multiple_columns_groupby: [ OK ] 9.76 sec. 2025-10-04 00:10:20 01070_materialize_ttl: [ OK ] 0.47 sec. 2025-10-04 00:10:21 01070_modify_ttl_recalc_only: [ OK ] 0.57 sec. 2025-10-04 00:10:21 01070_modify_ttl: [ OK ] 0.47 sec. 2025-10-04 00:10:22 01070_mutations_with_dependencies: [ OK ] 0.37 sec. 2025-10-04 00:10:23 01070_window_view_watch_events: [ OK ] 1.33 sec. 2025-10-04 00:10:31 01069_window_view_proc_tumble_watch: [ OK ] 8.30 sec. 2025-10-04 00:10:33 01065_window_view_event_hop_watch_bounded: [ OK ] 1.27 sec. 2025-10-04 00:10:34 01060_shutdown_table_after_detach: [ OK ] 1.18 sec. 2025-10-04 00:10:36 01059_window_view_event_hop_watch_strict_asc: [ OK ] 2.18 sec. 2025-10-04 00:10:41 01056_window_view_proc_hop_watch: [ OK ] 4.34 sec. 2025-10-04 00:10:45 01055_window_view_proc_hop_to: [ OK ] 4.77 sec. 2025-10-04 00:10:46 01054_cache_dictionary_overflow_cell: [ OK ] 0.37 sec. 2025-10-04 00:10:55 01054_window_view_proc_tumble_to: [ OK ] 9.31 sec. 2025-10-04 00:11:00 01053_window_view_proc_hop_to_now: [ OK ] 4.84 sec. 2025-10-04 00:11:02 01053_ssd_dictionary: [ OK ] 1.78 sec. 2025-10-04 00:11:10 01052_window_view_proc_tumble_to_now: [ OK ] 8.21 sec. 2025-10-04 00:11:11 01048_window_view_parser: [ OK ] 0.97 sec. 2025-10-04 00:11:11 01048_exists_query: [ OK ] 0.27 sec. 2025-10-04 00:11:14 01045_zookeeper_system_mutations_with_parts_names: [ OK ] 2.88 sec. 2025-10-04 00:11:20 01038_dictionary_lifetime_min_zero_sec: [ OK ] 5.90 sec. 2025-10-04 00:11:20 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.27 sec. 2025-10-04 00:11:21 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.22 sec. 2025-10-04 00:11:47 01035_concurrent_move_partition_from_table_zookeeper: [ OK ] 26.07 sec. 2025-10-04 00:11:47 01023_materialized_view_query_context: [ OK ] 0.27 sec. 2025-10-04 00:11:48 01018_ddl_dictionaries_bad_queries: [ OK ] 1.27 sec. 2025-10-04 00:11:59 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 10.85 sec. 2025-10-04 00:12:00 01018_ddl_dictionaries_create: [ OK ] 0.37 sec. 2025-10-04 00:12:00 01018_dictionaries_from_dictionaries: [ OK ] 0.27 sec. 2025-10-04 00:12:22 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 21.90 sec. 2025-10-04 00:12:35 01014_lazy_database_basic: [ OK ] 13.46 sec. 2025-10-04 00:12:37 01013_sync_replica_timeout_zookeeper: [ OK ] 1.72 sec. 2025-10-04 00:12:38 01010_pmj_right_table_memory_limits: [ OK ] 0.67 sec. 2025-10-04 00:12:48 01007_r1r2_w_r2r1_deadlock: [ OK ] 10.81 sec. 2025-10-04 00:12:59 01005_rwr_shard_deadlock: [ OK ] 10.57 sec. 2025-10-04 00:13:11 01004_rename_deadlock: [ OK ] 11.82 sec. 2025-10-04 00:13:21 01003_kill_query_race_condition: [ OK ] 10.36 sec. 2025-10-04 00:14:25 00993_system_parts_race_condition_drop_zookeeper: [ OK ] 63.95 sec. 2025-10-04 00:14:39 00992_system_parts_race_condition_zookeeper_long: [ OK ] 13.49 sec. 2025-10-04 00:14:39 00985_merge_stack_overflow: [ OK ] 0.52 sec. 2025-10-04 00:14:40 00971_query_id_in_logs: [ OK ] 0.42 sec. 2025-10-04 00:14:40 00963_achimbab: [ OK ] 0.17 sec. 2025-10-04 00:14:40 00950_dict_get: [ OK ] 0.42 sec. 2025-10-04 00:14:42 00933_test_fix_extra_seek_on_compressed_cache: [ OK ] 1.17 sec. 2025-10-04 00:14:46 00899_long_attach_memory_limit: [ OK ] 4.94 sec. 2025-10-04 00:14:48 00877_memory_limit_for_new_delete: [ OK ] 1.22 sec. 2025-10-04 00:15:16 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 28.21 sec. 2025-10-04 00:15:17 00834_cancel_http_readonly_queries_on_client_close: [ OK ] 1.42 sec. 2025-10-04 00:15:18 00722_inner_join: [ OK ] 0.22 sec. 2025-10-04 00:15:18 00693_max_block_size_system_tables_columns: [ OK ] 0.22 sec. 2025-10-04 00:15:19 00623_truncate_table_throw_exception: [ OK ] 1.48 sec. 2025-10-04 00:15:20 00612_http_max_query_size: [ OK ] 0.67 sec. 2025-10-04 00:15:21 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.57 sec. 2025-10-04 00:15:21 00474_readonly_settings: [ OK ] 0.77 sec. 2025-10-04 00:15:29 00463_long_sessions_in_http_interface: [ OK ] 7.29 sec. 2025-10-04 00:15:29 00332_quantile_timing_memory_leak: [ OK ] 0.17 sec. 2025-10-04 00:15:29 00309_formats_case_insensitive: [ OK ] 0.17 sec. 2025-10-04 00:15:32 00110_external_sort: [ OK ] 2.98 sec. 2025-10-04 00:16:03 00002_log_and_exception_messages_formatting: [ OK ] 30.62 sec. 2025-10-04 00:16:03 2025-10-04 00:16:03 568 tests passed. 3 tests skipped. 2530.37 s elapsed (MainProcess). 2025-10-04 00:16:03 Won't run stateful tests because test data wasn't loaded. 2025-10-04 00:16:03 Checking the hung queries: done 2025-10-04 00:16:03 2025-10-04 00:16:03 No queries hung. 2025-10-04 00:16:03 All tests have finished. 2025-10-04 00:16:03 2025-10-04 00:16:03 Top patterns of log messages: 2025-10-04 00:16:03 2025-10-04 00:16:03 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2025-10-04 00:16:03 2025-10-04 00:16:03 1. 652827 0.079 30.79 MiB 0.034 1 1220 ['Trace'] 1 is disk {} eligible for search: {} 2025-10-04 00:16:03 2. 375826 0.046 78.94 MiB 0.086 1 434 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 2025-10-04 00:16:03 3. 375553 0.046 56.25 MiB 0.061 135341 430 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 2025-10-04 00:16:03 4. 311151 0.038 8.24 MiB 0.009 1 422 ['Debug'] 0 Processed in {} sec. 2025-10-04 00:16:03 5. 303495 0.037 13.32 MiB 0.015 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2025-10-04 00:16:03 6. 256757 0.031 6.22 MiB 0.007 1 1193 ['Trace'] 0.001 Query to stage {}{} 2025-10-04 00:16:03 7. 253323 0.031 11.99 MiB 0.013 1 1192 ['Trace'] 0.001 Query from stage {} to stage {}{} 2025-10-04 00:16:03 8. 198098 0.024 26.82 MiB 0.029 1 2 ['Trace'] 1 Creating part at path {} 2025-10-04 00:16:03 9. 173027 0.021 13.70 MiB 0.015 1 398 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 2025-10-04 00:16:03 10. 166397 0.02 11.43 MiB 0.012 1 2018 ['Trace'] 0.475 Reserved {} on local disk {}, having unreserved {}. 2025-10-04 00:16:03 11. 148967 0.018 6.55 MiB 0.007 1 449 ['Debug'] 0.148 Peak memory usage{}: {}. 2025-10-04 00:16:03 12. 145933 0.018 16.51 MiB 0.018 6025 1652 ['Trace'] 0.352 Renaming temporary part {} to {} with tid {}. 2025-10-04 00:16:03 13. 144232 0.017 9.77 MiB 0.011 6005 2020 ['Trace'] 0.444 Trying to reserve {} using storage policy from min volume index {} 2025-10-04 00:16:03 14. 139140 0.017 6.49 MiB 0.007 139140 763 ['Debug'] 0.997 Authenticating user '{}' from {} 2025-10-04 00:16:03 15. 138803 0.017 15.22 MiB 0.017 138803 763 ['Debug'] 0.997 {} Authenticated with global context as user {} 2025-10-04 00:16:03 16. 138717 0.017 11.91 MiB 0.013 138717 757 ['Debug'] 0.997 {} Logout, user_id: {} 2025-10-04 00:16:03 17. 137187 0.017 9.81 MiB 0.011 137187 432 ['Debug'] 1 Creating session context with user_id: {} 2025-10-04 00:16:03 18. 118470 0.014 10.33 MiB 0.011 742 602 ['Trace'] 0.976 Insert entry {} to queue with type {} 2025-10-04 00:16:03 19. 110985 0.013 3.47 MiB 0.004 1 1681 ['Trace'] 0 Aggregation method: {} 2025-10-04 00:16:03 20. 110355 0.013 5.05 MiB 0.006 1 1635 ['Trace'] 0.104 filled checksums {} 2025-10-04 00:16:03 21. 100302 0.012 7.79 MiB 0.009 3330 508 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 2025-10-04 00:16:03 22. 99732 0.012 20.70 MiB 0.023 3 370 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 2025-10-04 00:16:03 23. 99709 0.012 64.02 MiB 0.07 2 370 ['Trace'] 1 Request URI: {} 2025-10-04 00:16:03 24. 98203 0.012 3.84 MiB 0.004 445 716 ['Debug'] 0.486 Will use old analyzer to prepare mutation 2025-10-04 00:16:03 25. 93642 0.011 1.88 MiB 0.002 2 369 ['Debug'] 0.406 Done processing query 2025-10-04 00:16:03 26. 91006 0.011 8.09 MiB 0.009 1 1675 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 2025-10-04 00:16:03 27. 89560 0.011 962.07 KiB 0.001 1 1622 ['Trace'] 0 Aggregating 2025-10-04 00:16:03 28. 83813 0.01 6.48 MiB 0.007 1233 1666 ['Trace'] 0.94 Part {} is not stored on zero-copy replicated disk, blobs can be removed 2025-10-04 00:16:03 29. 82460 0.01 2.63 MiB 0.003 2 431 ['Trace'] 1 TCP Request. Address: {} 2025-10-04 00:16:03 30. 82443 0.01 7.81 MiB 0.009 1 431 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 2025-10-04 00:16:03 31. 82221 0.01 2.12 MiB 0.002 1 425 ['Debug'] 1 Done processing connection. 2025-10-04 00:16:03 32. 65609 0.008 5.21 MiB 0.006 1 1632 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 2025-10-04 00:16:03 33. 65450 0.008 1.62 MiB 0.002 736 601 ['Debug'] 0.977 Pulled {} entries to queue. 2025-10-04 00:16:03 34. 65450 0.008 3.68 MiB 0.004 736 601 ['Debug'] 0.977 Pulling {} entries to queue: {} - {} 2025-10-04 00:16:03 35. 64166 0.008 6.50 MiB 0.007 1 118 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 2025-10-04 00:16:03 36. 61415 0.007 2.37 MiB 0.003 605 122 ['Debug'] 0.65 Committing part {} to zookeeper 2025-10-04 00:16:03 37. 59812 0.007 4.91 MiB 0.005 1553 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 2025-10-04 00:16:03 38. 55722 0.007 7.58 MiB 0.008 1129 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 2025-10-04 00:16:03 39. 54945 0.007 2.07 MiB 0.002 600 32 ['Debug'] 0.692 Part {} committed to zookeeper 2025-10-04 00:16:03 40. 50566 0.006 5.98 MiB 0.007 446 33 ['Debug'] 1 Fetching part {} from {}:{} 2025-10-04 00:16:03 41. 48540 0.006 1.06 MiB 0.001 1 1357 ['Trace'] 0 Merging aggregated data 2025-10-04 00:16:03 42. 44386 0.005 4.11 MiB 0.004 1 178 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 2025-10-04 00:16:03 43. 43525 0.005 3.65 MiB 0.004 445 36 ['Trace'] 0.999 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 2025-10-04 00:16:03 44. 43525 0.005 1.54 MiB 0.002 445 36 ['Trace'] 0.999 Checking disk {} with type {} 2025-10-04 00:16:03 45. 43060 0.005 1.37 MiB 0.001 398 217 ['Information'] 0.001 Added mutation: {}{} 2025-10-04 00:16:03 46. 41152 0.005 2.46 MiB 0.003 3737 654 ['Debug'] 0.006 Key condition: {} 2025-10-04 00:16:03 47. 40829 0.005 1.42 MiB 0.002 10 11 ['Trace'] 0.508 Removing mutation: {} 2025-10-04 00:16:03 48. 39798 0.005 1.71 MiB 0.002 3730 654 ['Trace'] 0.006 Filtering marks by primary and secondary keys 2025-10-04 00:16:03 49. 39198 0.005 4.38 MiB 0.005 3688 654 ['Debug'] 0.006 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 2025-10-04 00:16:03 50. 38210 0.005 737.02 KiB 0.001 445 37 ['Debug'] 0.999 Downloading files {} 2025-10-04 00:16:03 51. 38210 0.005 887.49 KiB 0.001 364 138 ['Trace'] 1 Sending part {} 2025-10-04 00:16:03 52. 38202 0.005 3.17 MiB 0.003 445 37 ['Trace'] 0.999 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 2025-10-04 00:16:03 53. 38177 0.005 2.88 MiB 0.003 1 401 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 2025-10-04 00:16:03 54. 38150 0.005 1.70 MiB 0.002 432 36 ['Debug'] 0.999 Downloading part {} onto disk {}. 2025-10-04 00:16:03 55. 37988 0.005 4.63 MiB 0.005 442 33 ['Debug'] 0.999 Fetched part {} from {}:{}{} 2025-10-04 00:16:03 56. 37950 0.005 2.02 MiB 0.002 430 36 ['Debug'] 0.999 Download of part {} onto disk {} finished. 2025-10-04 00:16:03 57. 35906 0.004 1.81 MiB 0.002 3242 648 ['Trace'] 0.007 Spreading mark ranges among streams (default reading) 2025-10-04 00:16:03 58. 30160 0.004 1.75 MiB 0.002 7251 599 ['Debug'] 0.021 There are {} detached tables. Start searching non used tables. 2025-10-04 00:16:03 59. 30160 0.004 1.24 MiB 0.001 7251 599 ['Debug'] 0.021 Found {} non used tables in detached tables. 2025-10-04 00:16:03 60. 24496 0.003 3.04 MiB 0.003 1 267 ['Trace'] 0 Have {} pending inserts with total {} bytes of data for query '{}' 2025-10-04 00:16:03 61. 23979 0.003 2.83 MiB 0.003 10964 16 ['Trace'] 1 Executing log entry to merge parts {} to {} 2025-10-04 00:16:03 62. 19828 0.002 1.42 MiB 0.002 741 1071 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 2025-10-04 00:16:03 63. 19187 0.002 932.55 KiB 0.001 1412 731 ['Debug'] 0.842 Selected {} parts from {} to {} 2025-10-04 00:16:03 64. 17929 0.002 3.07 MiB 0.003 12 1189 ['Information','Trace','Error','Warning'] 0.908 2025-10-04 00:16:03 65. 17713 0.002 10.47 MiB 0.011 1 1151 ['Information'] 0.91 {}: {} 2025-10-04 00:16:03 66. 17311 0.002 524.06 KiB 0.001 1 1134 ['Information'] 0.931 Response status: {}, {} 2025-10-04 00:16:03 67. 16505 0.002 3.22 MiB 0.004 1 1220 ['Information'] 1 Removing metadata {} of dropped table {} 2025-10-04 00:16:03 68. 16478 0.002 1.85 MiB 0.002 1 268 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {} 2025-10-04 00:16:03 69. 16478 0.002 1.19 MiB 0.001 1 268 ['Debug'] 0 Waiting for table {} to be finally dropped 2025-10-04 00:16:03 70. 16156 0.002 1.26 MiB 0.001 1 1241 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 2025-10-04 00:16:03 71. 16116 0.002 3.25 MiB 0.004 3457 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it 2025-10-04 00:16:03 72. 15740 0.002 445.76 KiB 0 1 1255 ['Debug'] 1 Stop worker in {} 2025-10-04 00:16:03 73. 15740 0.002 614.85 KiB 0.001 1 1440 ['Debug'] 0.493 Spawn loader worker #{} in {} 2025-10-04 00:16:03 74. 15740 0.002 1.17 MiB 0.001 1 237 ['Debug'] 0 Schedule load job '{}' into {} 2025-10-04 00:16:03 75. 15740 0.002 1.06 MiB 0.001 1 1207 ['Debug'] 1 Finish load job '{}' with status {} 2025-10-04 00:16:03 76. 15740 0.002 1.12 MiB 0.001 1 1207 ['Debug'] 1 Execute load job '{}' in {} 2025-10-04 00:16:03 77. 15739 0.002 1.42 MiB 0.002 1 237 ['Debug'] 0 Prioritize load job '{}': {} -> {} 2025-10-04 00:16:03 78. 15655 0.002 3.11 MiB 0.003 1 270 ['Trace'] 0.012 PREWHERE condition was split into {} steps: {} 2025-10-04 00:16:03 79. 15359 0.002 449.97 KiB 0 1550 555 ['Debug'] 0.978 Updating strategy picker state 2025-10-04 00:16:03 80. 15296 0.002 507.88 KiB 0.001 1 1445 ['Debug'] 0.5 Change current priority: {} -> {} 2025-10-04 00:16:03 81. 15047 0.002 132.25 KiB 0 2 237 ['Trace'] 0 No tables 2025-10-04 00:16:03 82. 14782 0.002 502.30 KiB 0.001 1 185 ['Debug'] 0 Selected MergeAlgorithm: {} 2025-10-04 00:16:03 83. 14782 0.002 1.16 MiB 0.001 1 185 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 2025-10-04 00:16:03 84. 14696 0.002 1.84 MiB 0.002 1 185 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 2025-10-04 00:16:03 85. 14662 0.002 899.21 KiB 0.001 1199 185 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 2025-10-04 00:16:03 86. 14355 0.002 1.01 MiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables 2025-10-04 00:16:03 87. 14309 0.002 1.75 MiB 0.002 29 512 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 2025-10-04 00:16:03 88. 13858 0.002 2.63 MiB 0.003 1 902 ['Trace'] 0.002 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {} 2025-10-04 00:16:03 89. 13748 0.002 891.58 KiB 0.001 134 479 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem 2025-10-04 00:16:03 90. 13627 0.002 1004.81 KiB 0.001 1783 32 ['Debug'] 1 Skipping action for part {} because part {} already exists. 2025-10-04 00:16:03 91. 13538 0.002 993.08 KiB 0.001 1 270 ['Trace'] 0.006 Condition {} moved to PREWHERE 2025-10-04 00:16:03 92. 13066 0.002 1.92 MiB 0.002 1 508 ['Debug'] 0.001 Merged partially aggregated blocks for bucket #{}. Got {} rows, {} from {} source rows in {} sec. ({:.3f} rows/sec., {}/sec.) 2025-10-04 00:16:03 93. 13066 0.002 642.32 KiB 0.001 1 508 ['Trace'] 0.001 Merging partially aggregated blocks (bucket = {}). 2025-10-04 00:16:03 94. 12524 0.002 5.06 MiB 0.006 2 48 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {} 2025-10-04 00:16:03 95. 12057 0.001 753.32 KiB 0.001 71 32 ['Debug'] 0.996 Part {} is rendered obsolete by fetching part {} 2025-10-04 00:16:03 96. 11708 0.001 411.61 KiB 0 1 1114 ['Trace'] 0.016 Converting aggregated data to blocks 2025-10-04 00:16:03 97. 11670 0.001 945.48 KiB 0.001 824 237 ['Debug'] 0 MinMax index condition: {} 2025-10-04 00:16:03 98. 11622 0.001 1.19 MiB 0.001 1 1112 ['Debug'] 0.013 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.) 2025-10-04 00:16:03 99. 11486 0.001 403.82 KiB 0 1 111 ['Trace'] 1 Keeper request. Address: {} 2025-10-04 00:16:03 100. 11360 0.001 370.65 KiB 0 20 134 ['Debug'] 0 Requested flush up to offset {} 2025-10-04 00:16:03 2025-10-04 00:16:03 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2025-10-04 00:16:03 2025-10-04 00:16:03 2025-10-04 00:16:03 2025-10-04 00:16:03 Top messages without format string (fmt::runtime): 2025-10-04 00:16:03 2025-10-04 00:16:03 count pattern runtime_message line 2025-10-04 00:16:03 2025-10-04 00:16:03 1. 17311 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71) 2025-10-04 00:16:03 2. 108 CodeDBExceptionOkwhileexecutingF Code: 395. DB::Exception: Ok: while executing 'FUNCTION throwIf(greater(__table1.number, 10000000_UInt32) :: 1, 'Ok'_String :: 4) -> throwIf(greater(__table1.number, 10000000_UInt32), 'Ok'_String) UInt8 : 3'. (FUNCTION_THROW_IF_VALUE_IS_NON_ZERO) (version ('/executeQuery.cpp',221) 2025-10-04 00:16:03 3. 75 Connectiontomysqlfailedtimes Connection to mysql failed 1 times ('',0) 2025-10-04 00:16:03 4. 67 DBExceptionThereisnouserinvalids DB::Exception: There is no user `invalid_session_log_test_xml_user` in user directories ('',0) 2025-10-04 00:16:03 5. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 55 ('by'): by LastName;. Max query size exceeded: 'by'. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:44216) (comment: 02366_kql_tabular.sql) (in query: Customers ('/executeQuery.cpp',221) 2025-10-04 00:16:03 6. 45 CodeDBExceptionReceivedfromDBExc Code: 649. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Transaction Control Language queries are allowed only inside session: while starting a transaction with 'implicit_transaction'. Stack trace: 2025-10-04 00:16:03 2025-10-04 00:16:03 0. ./contrib/llvm-project/libcxx/include/ve ('/executeQuery.cpp',221) 2025-10-04 00:16:03 7. 39 DBExceptionsessionlogtestuserdbd DB::Exception: session_log_test_user_dbd8d20778f72bdc6466f86718aa11c6_plaintext_password_no_profiles_no_roles: Authentication failed: password is incorrect, or there is no user with such name. ('',0) 2025-10-04 00:16:03 8. 39 Connectiontosystemasuserinvalids Connection to system@127.0.0.1:9004 as user invalid_session_log_test_xml_user failed: mysqlxx::ConnectionFailed: There is no user `invalid_session_log_test_xml_user` in user directories ((nullptr):9004) ('',0) 2025-10-04 00:16:03 9. 27 Connectiontosystemasusersessionl Connection to system@127.0.0.1:9004 as user session_log_test_user_dbd8d20778f72bdc6466f86718aa11c6_plaintext_password_no_profiles_no_roles failed: mysqlxx::ConnectionFailed: session_log_test_user_dbd8d20778f72bdc6466f86718aa11c6_plaintext_password_no_profi ('',0) 2025-10-04 00:16:03 10. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT defaultValueOfTypeName(''). (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:58296) (comment: 00534_functions_bad_arguments7.sh) (in query: SELECT defaultValueOfTypeName( ('/executeQuery.cpp',221) 2025-10-04 00:16:03 11. 10 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace: 2025-10-04 00:16:03 2025-10-04 00:16:03 0. ./contrib/llvm-project/libcxx/include/vector:676: DB::Exception::Exception(DB::Exception::M ('/executeQuery.cpp',221) 2025-10-04 00:16:03 12. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:41028) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221) 2025-10-04 00:16:03 13. 8 CodeDBExceptionSyntaxerrorMultis Code: 62. DB::Exception: Syntax error (Multi-statements are not allowed): failed at position 9 (end of query): ; S. . (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:51782) (comment: 00366_multi_statements.sh) ('/executeQuery.cpp',221) 2025-10-04 00:16:03 14. 6 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'LINESTRING'' in () (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:58296) (comment: 00534_functions_bad_arguments7.sh) ('/executeQuery.cpp',221) 2025-10-04 00:16:03 15. 6 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 1 (''): . Unrecognized token: ''. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:58244) (comment: 00746_sql_fuzzy.sh) (in query: SELEC ('/executeQuery.cpp',221) 2025-10-04 00:16:03 16. 6 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:38000) (comment: 01256_negative_generate_random.sql) (in query: SELECT * FROM generateRandom('', 1, 10, 10);), Stack trace (when copying ('/executeQuery.cpp',221) 2025-10-04 00:16:03 17. 6 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10503.a ('/executeQuery.cpp',221) 2025-10-04 00:16:03 18. 6 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'LINESTRING'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',765) 2025-10-04 00:16:03 19. 5 PocoExceptionCodeecodeTimeoutcon Poco::Exception. Code: 1000, e.code() = 0, Timeout: connect timed out: 128.0.0.1:8123 (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:60320) (comment: 02044_url_glob_parallel_connection_refused.sh) (in query: SELECT * FROM url('http://128 ('/executeQuery.cpp',221) 2025-10-04 00:16:03 20. 5 CodeDBExceptionTimeoutconnecttim Code: 1000. DB::Exception: Timeout: connect timed out: 128.0.0.1:8123. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2025-10-04 00:16:03 2025-10-04 00:16:03 0. ./base/poco/Foundation/src/Exception.cpp:148: Poco::Net::SocketImpl::connect(Poco::Net::So ('/TCPHandler.cpp',765) 2025-10-04 00:16:03 21. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:58182) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221) 2025-10-04 00:16:03 22. 4 CodeDBExceptionSQLitedatabasefil Code: 481. DB::Exception: SQLite database file path '/etc/passwd' must be inside 'user_files' directory. (PATH_ACCESS_DENIED) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:54524) (comment: 02918_sqlite_path_check.sh) (in query: Select * ('/executeQuery.cpp',221) 2025-10-04 00:16:03 23. 4 creatingasnapshotforindex creating a snapshot for index 300000 ('/LoggerWrapper.h',43) 2025-10-04 00:16:03 24. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221) 2025-10-04 00:16:03 25. 4 snapshotidxlogtermcreatedcompact snapshot idx 300000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43) 2025-10-04 00:16:03 26. 4 CodeDBExceptionExpectedguidasarg Code: 395. DB::Exception: Expected guid as argument: while executing 'FUNCTION if(_CAST(1_UInt8, 'UInt8'_String) :: 1, toString(throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected guid as argument'_String)) :: 3, _CAST(NULL_Nullable(Nothing), 'Nullable(Noth ('/executeQuery.cpp',221) 2025-10-04 00:16:03 27. 4 createsnapshotidxlogterm create snapshot idx 300000 log_term 1 ('/LoggerWrapper.h',43) 2025-10-04 00:16:03 28. 4 createsnapshotidxlogtermdoneusel create snapshot idx 300000 log_term 1 done: 47 us elapsed ('/LoggerWrapper.h',43) 2025-10-04 00:16:03 29. 3 Connectiontoconvmainasusermetrik Connection to conv_main@127.0.0.1:3456 as user metrika failed: mysqlxx::ConnectionFailed: Can't connect to MySQL server on '127.0.0.1' (115) ((nullptr):0) ('',0) 2025-10-04 00:16:05 30. 3 ConnectiontosystemasuserMYSQLUSE Connection to system@127.0.0.1:9004 as user 02833_MYSQL_USER_301614 failed: mysqlxx::ConnectionFailed: 02833_MYSQL_USER_301614: Authentication failed: password is incorrect, or there is no user with such name. ((nullptr):9004) ('',0) 2025-10-04 00:16:05 2025-10-04 00:16:05 2025-10-04 00:16:05 2025-10-04 00:16:05 Top messages not matching their format strings: 2025-10-04 00:16:05 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 1. 17516 If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:37052) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below): 2025-10-04 00:16:05 2025-10-04 00:16:05 0. ./contrib/llvm-project/libcxx/include/vector:676: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000bcb6264 2025-10-04 00:16:05 1. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x00000000075f979c 2025-10-04 00:16:05 2. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007ce37c8 2025-10-04 00:16:05 3. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007ce3574 2025-10-04 00:16:05 4. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x0000000007cec1e4 2025-10-04 00:16:05 5. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007ceb8fc 2025-10-04 00:16:05 6. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d4922c 2025-10-04 00:16:05 7. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d49a10 2025-10-04 00:16:05 8. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d4af68 2025-10-04 00:16:05 9. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000000f0d9754 2025-10-04 00:16:05 10. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:27: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x00000000108f8548 2025-10-04 00:16:05 11. ./contrib/llvm-project/libcxx/include/__utility/swap.h:36: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000bf889e0 2025-10-04 00:16:05 12. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x00000000106b8544 2025-10-04 00:16:05 13. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:52: DB::ExecutionThreadContext::executeTask() @ 0x00000000106cebf0 2025-10-04 00:16:05 14. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x00000000106c5430 2025-10-04 00:16:05 15. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x00000000106c4b08 2025-10-04 00:16:05 16. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x00000000106d229c 2025-10-04 00:16:05 17. ./base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000bd716e4 2025-10-04 00:16:05 18. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000bd77f5c 2025-10-04 00:16:05 19. ? @ 0x000000000007d5c8 2025-10-04 00:16:05 20. ? @ 0x00000000000e5edc 2025-10-04 00:16:05 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 3. (from {}{}{}){}{} {} (stage: {}) 8 (from [::1]:56702) (comment: 02685_bson2.sql) -- It correctly throws exception about incorrect data: 2025-10-04 00:16:05 SELECT * FROM format('BSONEachRow', 'WatchID Int64, JavaEnable Int16, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID Int32, ClientIP Int32, RegionID Int32, UserID Int64, CounterClass Int16, OS Int16, UserAgent Int16, URL String, Referer String, IsRefresh Int16, RefererCategoryID Int16, RefererRegionID Int32, URLCategoryID Int16, URLRegionID Int32, ResolutionWidth Int16, ResolutionHeight Int16, ResolutionDepth Int16, FlashMajor Int16, FlashMinor Int16, FlashMinor2 String, NetMajor Int16, NetMinor Int16, UserAgentMajor Int16, UserAgentMinor String, CookieEnable Int16, JavascriptEnable Int16, IsMobile Int16, MobilePhone Int16, MobilePhoneModel String, Params String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, SocialSourceNetworkID Int16, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency String, ParamCurrencyID Int16, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int32', $$^WatchIDc*5/ !p~JavaEnableTitleGoodEventEventTime7�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion2SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTime&�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchID�F�ӓ2qJavaEnableTitleGoodEventEventTimen$�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeǘ�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchIDl!�|�@HJavaEnableTitleGoodEventEventTime�)�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTime}�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchID�ǐ=ЌWJavaEnableTitleGoodEventEventTime8*�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeݞ�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID�WatchID�E&LyJavaEnableTitleGoodEventEventTimeJ�QEventDate>CounterIDClientIP�I`RegionID'UserIDq�Jd8CounterClassOSUserAgentURL-http://holodilnik.ru/russia/05jul2013&model=0RefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryID�9URLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajor UserAgentMinorD�CookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�d9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqID%�l�+kOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTime'�QAgeSexIncomeInterests�:RobotnessRemoteIP9�3NWindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash� 2025-10-04 00:16:05 o�eCLID�WatchID�k=�pJavaEnableTitleGoodEventEventTime� �QEventDate>CounterIDClientIP�z�RegionIDGUserID �Ks}�CounterClassOSUserAgentURLHhttp://afisha.mail.ru/catalog/314/women.ru/ency=1&page3/?errovat-pinnikiRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryID0=URLRegionID�ResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinorD�CookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqID:�W�mOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeA�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash� �#�\CLID�WatchID�1� o�CJavaEnableTitleGoodEventEventTime�0�QEventDate>CounterIDClientIP�^{]RegionID�UserID&n%�t"6CounterClassOS'UserAgentURL>http://bonprix.ru/index.ru/cinema/art/0 986 424 233 сезонRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionID�ResolutionWidthResolutionHeightResolutionDepthFlashMajorFla⋯ 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 4. Close WriteBufferFromAzureBlobStorage. {}. 6 Close WriteBufferFromAzureBlobStorage. inuqowtpksrfhayrfqlzqvainmxerzjx. (LogSeriesLimiter: on interval from 2025-10-03 23:45:25 to 2025-10-03 23:45:57 accepted series 1 / 9 for the logger WriteBufferFromAzureBlobStorage) 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 5. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:52972) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests 2025-10-04 00:16:05 -- Even if the fallback is used, invalid substitutions must throw an exception. 2025-10-04 00:16:05 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below): 2025-10-04 00:16:05 2025-10-04 00:16:05 0. ./contrib/llvm-project/libcxx/include/vector:676: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000bcb6264 2025-10-04 00:16:05 1. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x00000000075f979c 2025-10-04 00:16:05 2. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000ad71f9c 2025-10-04 00:16:05 3. DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000ad75340 2025-10-04 00:16:05 4. DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const (.535e5163d1dcb49a63f83dc276d8eca6) @ 0x000000000ad73020 2025-10-04 00:16:05 5. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d4920c 2025-10-04 00:16:05 6. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d49a10 2025-10-04 00:16:05 7. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007d4af68 2025-10-04 00:16:05 8. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x000000000ef28068 2025-10-04 00:16:05 9. ./contrib/llvm-project/libcxx/include/vector:1348: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x000000000ef272fc 2025-10-04 00:16:05 10. ./contrib/llvm-project/libcxx/include/string:1570: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x0000000010a2307c 2025-10-04 00:16:05 11. ./contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x000000000e413008 2025-10-04 00:16:05 12. ./build_docker/./src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x000000000f46106c 2025-10-04 00:16:05 13. ./contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000000f45ae18 2025-10-04 00:16:05 14. ./build_docker/./src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000000f455c68 2025-10-04 00:16:05 15. ./build_docker/./src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x000000000f713ca8 2025-10-04 00:16:05 16. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000000f7103a8 2025-10-04 00:16:05 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x000000001064c8ec 2025-10-04 00:16:05 18. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:594: DB::TCPHandler::run() @ 0x0000000010664168 2025-10-04 00:16:05 19. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000012dbdc38 2025-10-04 00:16:05 20. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x0000000012dbe114 2025-10-04 00:16:05 21. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x0000000012d89154 2025-10-04 00:16:05 22. ./base/poco/Foundation/include/Poco/SharedPtr.h:231: Poco::ThreadImpl::runnableEntry(void*) @ 0x0000000012d87590 2025-10-04 00:16:05 23. ? @ 0x000000000007d5c8 2025-10-04 00:16:05 24. ? @ 0x00000000000e5edc 2025-10-04 00:16:05 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:05 6. Condition {} moved to PREWHERE 2 Condition equals(address, 'Ӈ�Jl�X��X̊�Y') moved to PREWHERE 2025-10-04 00:16:05 message_format_string count() any_message 2025-10-04 00:16:05 2025-10-04 00:16:06 7. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 1 /var/lib/clickhouse/store/a7d/a7d05258-59f4-47e9-9305-d3fbf74f6612/tmp_merge_9_32_107_12/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages) 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 Top short messages: 2025-10-04 00:16:06 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 1. 226 {} Code: 243. DB::Exception: Unable to parse fragment %Y from because readNumber4 requires size >= 4: In scope SELECT tumb 91 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 2. 32 Creating {}: {} Creating table test_tryzstls_2.src: CREATE TABLE IF NOT EXISTS test_tryzstls_2.src UUID 'ad7a3ae0-ddff-40ca-a175-745c912 120 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 3. 14 Froze {} parts Froze 1 parts -13 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10503.altinitytest (altinity buil 29 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 5. 4 Resetting nice Resetting nice -12 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 6. 4 Database {} does not exist Code: 81. DB::Exception: Database kek does not exist. (UNKNOWN_DATABASE), Stack trace (when copying this message, always 28 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 7. 4 Substitution {} is not set Code: 456. DB::Exception: Substitution `n` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10503.altinitytest (al 29 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 8. 4 Illegal HDFS URI: {} Code: 36. DB::Exception: Illegal HDFS URI: //abcd. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build)) 25 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 9. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10503.altinitytest (altinity buil 29 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 10. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10503.altinitytest (altinity bui 27 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 11. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10503.altinitytest (altinity build) 24 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 12. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build 27 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 13. 2 User has been dropped Code: 192. DB::Exception: User has been dropped. (UNKNOWN_USER) (version 24.8.14.10503.altinitytest (altinity build)) (f 23 2025-10-04 00:16:06 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-04 00:16:06 2025-10-04 00:16:06 14. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10503.altinitytest (altinity build 25 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 Top messages by level: 2025-10-04 00:16:06 2025-10-04 00:16:06 (0.002172631172803975,'') Error 2025-10-04 00:16:06 (0.00009633787619940656,'Not enabled four letter command {}') Warning 2025-10-04 00:16:06 (0.0052179986781716306,'Added mutation: {}{}') Information 2025-10-04 00:16:06 (0.04554248888115493,'(from {}{}{}){}{} {} (stage: {})') Debug 2025-10-04 00:16:06 (0.07910939208255344,'is disk {} eligible for search: {}') Trace 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 The following functions were not covered by tests: 2025-10-04 00:16:06 2025-10-04 00:16:06 catboostEvaluate 2025-10-04 00:16:06 dynamicElement 2025-10-04 00:16:06 structureToCapnProtoSchema 2025-10-04 00:16:06 structureToProtobufSchema 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 2025-10-04 00:16:06 The following aggregate functions were not covered by tests: 2025-10-04 00:16:06 2025-10-04 00:16:06 flameGraph 2025-10-04 00:16:06 2025-10-04 00:16:06 + set -e Files in current directory + echo 'Files in current directory' + ls -la ./ total 124224 drwxr-xr-x 1 root root 4096 Oct 3 23:56 . drwxr-xr-x 1 root root 4096 Oct 3 23:56 .. -rw-rw-r-- 1 1000 1000 119 Oct 3 23:13 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 9 Oct 3 23:51 a.txt -rw-r--r-- 1 root root 1544 Oct 3 23:48 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 3 23:48 __azurite_db_blob__.json -rw-r--r-- 1 root root 2193802 Oct 4 00:15 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 3 23:17 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 3 23:13 broken_tests.json -rw-r--r-- 1 root root 9 Oct 3 23:51 b.txt -rw-r--r-- 1 root root 9 Oct 3 23:51 c.txt drwxr-x--- 4 root root 4096 Oct 3 23:43 data drwxr-xr-x 14 root root 3780 Oct 3 23:16 dev drwxr-xr-x 2 root root 4096 Oct 3 23:51 dir -rwxr-xr-x 1 root root 0 Oct 3 23:16 .dockerenv drwxr-xr-x 1 root root 4096 Oct 3 23:16 etc drwxr-x--- 2 root root 4096 Oct 3 23:43 flags drwxr-x--- 2 root root 4096 Oct 3 23:43 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 3 23:16 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib -rwxr-xr-x 1 root root 25690264 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Oct 3 23:43 metadata drwxr-x--- 2 root root 4096 Oct 3 23:43 metadata_dropped -rwxr-xr-x 1 root root 98959512 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Oct 3 23:16 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 3 23:16 package_folder drwxr-x--- 2 root root 4096 Oct 3 23:51 preprocessed_configs dr-xr-xr-x 314 root root 0 Oct 3 23:16 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 3 23:21 queries_02352 -rw-r----- 1 root root 1 Oct 3 23:43 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Oct 3 23:43 roles.list drwx------ 1 root root 4096 Oct 4 00:10 root -rw-r----- 1 root root 1 Oct 3 23:43 row_policies.list drwxr-xr-x 1 root root 4096 Oct 3 23:16 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Oct 3 23:17 script.gdb -rw-r--r-- 1 root root 65223 Oct 3 23:53 server.log -rw-r----- 1 root root 1 Oct 3 23:43 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 60 Oct 3 23:51 status drwxr-x--- 4 root root 4096 Oct 3 23:43 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 3 23:16 sys drwxrwxr-x 2 1000 1000 4096 Oct 3 23:17 test_output drwxrwxrwt 1 root root 4096 Oct 4 00:16 tmp drwxr-x--- 2 root root 4096 Oct 3 23:43 user_files -rw-r----- 1 root root 1 Oct 3 23:48 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Oct 3 23:43 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + echo 'Files in root directory' + ls -la / Files in root directory total 124224 drwxr-xr-x 1 root root 4096 Oct 3 23:56 . drwxr-xr-x 1 root root 4096 Oct 3 23:56 .. -rw-rw-r-- 1 1000 1000 119 Oct 3 23:13 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 9 Oct 3 23:51 a.txt -rw-r--r-- 1 root root 1544 Oct 3 23:48 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 3 23:48 __azurite_db_blob__.json -rw-r--r-- 1 root root 2193802 Oct 4 00:15 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 3 23:17 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 3 23:13 broken_tests.json -rw-r--r-- 1 root root 9 Oct 3 23:51 b.txt -rw-r--r-- 1 root root 9 Oct 3 23:51 c.txt drwxr-x--- 4 root root 4096 Oct 3 23:43 data drwxr-xr-x 14 root root 3780 Oct 3 23:16 dev drwxr-xr-x 2 root root 4096 Oct 3 23:51 dir -rwxr-xr-x 1 root root 0 Oct 3 23:16 .dockerenv drwxr-xr-x 1 root root 4096 Oct 3 23:16 etc drwxr-x--- 2 root root 4096 Oct 3 23:43 flags drwxr-x--- 2 root root 4096 Oct 3 23:43 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 3 23:16 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib -rwxr-xr-x 1 root root 25690264 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Oct 3 23:43 metadata drwxr-x--- 2 root root 4096 Oct 3 23:43 metadata_dropped -rwxr-xr-x 1 root root 98959512 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Oct 3 23:16 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 3 23:16 package_folder drwxr-x--- 2 root root 4096 Oct 3 23:51 preprocessed_configs dr-xr-xr-x 314 root root 0 Oct 3 23:16 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 3 23:21 queries_02352 -rw-r----- 1 root root 1 Oct 3 23:43 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Oct 3 23:43 roles.list drwx------ 1 root root 4096 Oct 4 00:10 root -rw-r----- 1 root root 1 Oct 3 23:43 row_policies.list drwxr-xr-x 1 root root 4096 Oct 3 23:16 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Oct 3 23:17 script.gdb -rw-r--r-- 1 root root 65223 Oct 3 23:53 server.log -rw-r----- 1 root root 1 Oct 3 23:43 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 60 Oct 3 23:51 status drwxr-x--- 4 root root 4096 Oct 3 23:43 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 3 23:16 sys drwxrwxr-x 2 1000 1000 4096 Oct 3 23:17 test_output drwxrwxrwt 1 root root 4096 Oct 4 00:16 tmp drwxr-x--- 2 root root 4096 Oct 3 23:43 user_files -rw-r----- 1 root root 1 Oct 3 23:48 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Oct 3 23:43 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + /process_functional_tests_result.py 2025-10-04 00:16:06,387 File /analyzer_tech_debt.txt with broken tests found 2025-10-04 00:16:06,388 File /broken_tests.json with broken tests found 2025-10-04 00:16:06,388 Broken tests in the list: 4 2025-10-04 00:16:06,389 Find files in result folder minio.log,run.log,gdb.log,hdfs_minicluster.log,test_result.txt 2025-10-04 00:16:06,428 Is flaky check: False 2025-10-04 00:16:06,429 Result parsed 2025-10-04 00:16:06,446 Result written + clickhouse-client -q 'system flush logs' + stop_logs_replication + echo 'Detach all logs replication' Detach all logs replication + clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')' + tee /dev/stderr + timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}' xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value + failed_to_save_logs=0 + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + sleep 1 + clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE' + clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow' + clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow' + sudo clickhouse stop script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Sent terminate signal to process with pid 633. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 633. The process with pid = 633 does not exist. Server stopped + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + kill 1519 + rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log API: SYSTEM.config Time: 23:16:34 UTC 10/03/2025 DeploymentID: 86245b89-0d29-4d0f-9172-482a1029123b Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError) 4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf() 3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf() 2: cmd/logging.go:132:cmd.configLogOnceConsoleIf() 1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor() + : + rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log + : + data_path_config=--path=/var/lib/clickhouse/ + [[ -n '' ]] + zstd --threads=0 + '[' 0 -ne 0 ']' + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''CPU'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Memory'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Real'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep -v a.myext + echo -e 'No lost s3 keys\tOK\t\N\t' + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep SharedMergeTreePartCheckThread + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst + rg -Fa ' received signal ' /test_output/gdb.log + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + rm /var/log/clickhouse-server/clickhouse-server.log + mv /var/log/clickhouse-server/stderr.log /test_output/ + [[ -n '' ]] + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/ + tar -chf /test_output/store.tar /var/lib/clickhouse/store tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/database_02416.sql /var/lib/clickhouse/metadata/db1_03101.sql /var/lib/clickhouse/metadata/db2_03101.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_01048.sql /var/lib/clickhouse/metadata/test_8cgjxa6q_1.sql /var/lib/clickhouse/metadata/test_c7a15iui.sql /var/lib/clickhouse/metadata/test_hrml5uiu.sql /var/lib/clickhouse/metadata/test_htcbpczj.sql /var/lib/clickhouse/metadata/test_i653x5cr.sql /var/lib/clickhouse/metadata/test_rg7hjvwa_1.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_u50drbm2_1.sql tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core