+ ln -s /usr/share/clickhouse-test/ci/stress.py /usr/bin/stress + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /stress_tests.lib ++ OK='\tOK\t\N\t' ++ FAIL='\tFAIL\t\N\t' ++ FAILURE_CONTEXT_LINES=100 ++ FAILURE_CONTEXT_MAX_LINE_WIDTH=300 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + install_packages package_folder + dpkg -i package_folder/clickhouse-common-static_24.8.14.10546.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48696 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10546.altinitytest_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10546.altinitytest) ... Setting up clickhouse-common-static (24.8.14.10546.altinitytest) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10546.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48723 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10546.altinitytest_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10546.altinitytest) ... Setting up clickhouse-common-static-dbg (24.8.14.10546.altinitytest) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10546.altinitytest_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48730 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10546.altinitytest_amd64.deb ... Unpacking clickhouse-server (24.8.14.10546.altinitytest) ... Setting up clickhouse-server (24.8.14.10546.altinitytest) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10546.altinitytest_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48747 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10546.altinitytest_amd64.deb ... Unpacking clickhouse-client (24.8.14.10546.altinitytest) ... Setting up clickhouse-client (24.8.14.10546.altinitytest) ... + export THREAD_FUZZER_CPU_TIME_PERIOD_US=1000 + THREAD_FUZZER_CPU_TIME_PERIOD_US=1000 + export THREAD_FUZZER_SLEEP_PROBABILITY=0.1 + THREAD_FUZZER_SLEEP_PROBABILITY=0.1 + export THREAD_FUZZER_SLEEP_TIME_US_MAX=100000 + THREAD_FUZZER_SLEEP_TIME_US_MAX=100000 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY=0.01 + THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY=0.01 + export THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY=0.01 + THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY=0.01 + export ZOOKEEPER_FAULT_INJECTION=1 + ZOOKEEPER_FAULT_INJECTION=1 + configure + export USE_DATABASE_ORDINARY=1 + USE_DATABASE_ORDINARY=1 + export EXPORT_S3_STORAGE_POLICIES=1 + EXPORT_S3_STORAGE_POLICIES=1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + rm -f /etc/clickhouse-server/config.d/zookeeper.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_fault_injection.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=31987712 + sed --follow-symlinks -i 's|[[:digit:]]\+|31987712|' /etc/clickhouse-server/config.d/keeper_port.xml + value=38852608 + sed --follow-symlinks -i 's|[[:digit:]]\+|38852608|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/users.d/database_ordinary.xml /etc/clickhouse-server/users.d/ + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|100000|10000|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value filtered_list keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value multi_read keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value check_not_exists keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value create_if_not_exists keeper_port + value=1 + sed 's|[01]|1|' + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + sudo chown clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + sudo chgrp clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value use_compression zookeeper_fault_injection + value=0 + sudo cat /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml.tmp /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + randomize_config_boolean_value enable_block_number_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + randomize_config_boolean_value enable_block_offset_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + echo 'ASAN_OPTIONS='\''malloc_context_size=10 verbosity=1 allocator_release_to_os_interval_ms=10000'\''' + export 'ASAN_OPTIONS=malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + ASAN_OPTIONS='malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + sudo chown root: /var/lib/clickhouse + local total_mem ++ awk '/MemTotal/ { print $(NF-1) }' /proc/meminfo Setting max_server_memory_usage_to_ram_ratio to 0.5 + total_mem=32086448 + total_mem=32856522752 + max_server_memory_usage_to_ram_ratio=0.5 + echo 'Setting max_server_memory_usage_to_ram_ratio to 0.5' + cat Setting max_memory_usage_for_user=9856956825 and max_memory_usage for queries to 10G + local max_users_mem + max_users_mem=9856956825 + echo 'Setting max_memory_usage_for_user=9856956825 and max_memory_usage for queries to 10G' + cat + cat + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + ./minio server --address :11111 ./minio_data + curl --silent --verbose http://localhost:11111 + grep AccessDenied + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. Azurite Blob service is starting on 0.0.0.0:10000 MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:41737 http://127.0.0.1:41737 Docs: https://min.io/docs/minio/linux/index.html Azurite Blob service successfully listens on http://0.0.0.0:10000 + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./18BFD21204FCFD817dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 275 root 8u IPv4 38019 0t0 TCP localhost:11111 (LISTEN) minio 275 root 9u IPv6 38020 0t0 TCP *:11111 (LISTEN) minio 275 root 10u IPv6 38021 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 102.86 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + export CLICKHOUSE_MAX_THREADS=8 + CLICKHOUSE_MAX_THREADS=8 + export CLICKHOUSE_MAX_CONCURRENT_QUERIES=4 + CLICKHOUSE_MAX_CONCURRENT_QUERIES=4 + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 7 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=8 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 8 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=9 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 9 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=10 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 10 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=11 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 11 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=12 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 12 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=13 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 13 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=14 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 14 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=15 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 15 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=16 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 16 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=17 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 17 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=18 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 18 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "PUT /devstoreaccount1/cont/gggvutngfatjwchmsddiqgqgfgzrtzwt HTTP/1.1" 201 - 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "GET /devstoreaccount1/cont/gggvutngfatjwchmsddiqgqgfgzrtzwt HTTP/1.1" 206 4 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "GET /devstoreaccount1/cont/gggvutngfatjwchmsddiqgqgfgzrtzwt HTTP/1.1" 206 2 127.0.0.1 - - [06/Jul/2026:21:56:11 +0000] "DELETE /devstoreaccount1/cont/gggvutngfatjwchmsddiqgqgfgzrtzwt HTTP/1.1" 202 - + counter=19 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 415 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + clickhouse-client --query 'CREATE DATABASE datasets' + clickhouse-client --multiquery + clickhouse-client --query 'SHOW TABLES FROM datasets' hits_v1 visits_v1 + clickhouse-client --query 'CREATE DATABASE IF NOT EXISTS test' + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=415 + clickhouse stop --max-tries 90 --do-not-kill script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Sent terminate signal to process with pid 415. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 415. The process with pid = 415 is running. Waiting for server to stop Found pid = 415 in the list of running processes. The process with pid = 415 is running. Waiting for server to stop Now there is no clickhouse-server process. Server stopped + return + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.initial.log + cache_policy= + '[' 0 -eq 1 ']' + cache_policy=LRU + echo 'Using cache policy: LRU' + '[' LRU = SLRU ']' + sudo cat /etc/clickhouse-server/users.d/stress_tests_overrides.xml Using cache policy: LRU cat: /etc/clickhouse-server/users.d/stress_tests_overrides.xml: No such file or directory + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 7 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=8 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 8 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=9 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 9 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=10 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 10 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=11 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 11 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [06/Jul/2026:21:57:28 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - 127.0.0.1 - - [06/Jul/2026:21:57:28 +0000] "PUT /devstoreaccount1/cont/cmnqndnywwfwchigemmfahrgqittgqcb HTTP/1.1" 201 - + counter=12 + clickhouse-client --query 'SELECT 1' 127.0.0.1 - - [06/Jul/2026:21:57:28 +0000] "GET /devstoreaccount1/cont/cmnqndnywwfwchigemmfahrgqittgqcb HTTP/1.1" 206 4 127.0.0.1 - - [06/Jul/2026:21:57:28 +0000] "GET /devstoreaccount1/cont/cmnqndnywwfwchigemmfahrgqittgqcb HTTP/1.1" 206 2 127.0.0.1 - - [06/Jul/2026:21:57:28 +0000] "DELETE /devstoreaccount1/cont/cmnqndnywwfwchigemmfahrgqittgqcb HTTP/1.1" 202 - Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 12 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=13 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 13 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=14 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 14 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=15 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 15 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=16 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 16 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=17 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 17 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=18 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 18 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=19 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 19 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=20 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 20 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=21 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 21 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=22 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 22 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=23 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 23 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=24 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 24 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=25 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 25 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=26 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 26 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=27 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 27 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=28 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 28 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=29 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 29 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=30 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 30 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=31 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 31 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=32 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 32 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=33 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 33 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=34 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 1425 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + clickhouse-client --query 'SHOW TABLES FROM datasets' hits_v1 visits_v1 + clickhouse-client --query 'SHOW TABLES FROM test' + [[ '' == \1 ]] + [[ '' == \1 ]] + TEMP_POLICY=default + clickhouse-client --query 'CREATE TABLE test.hits_s3 (WatchID UInt64, JavaEnable UInt8, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RegionID UInt32, UserID UInt64, CounterClass Int8, OS UInt8, UserAgent UInt8, URL String, Referer String, URLDomain String, RefererDomain String, Refresh UInt8, IsRobot UInt8, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), ResolutionWidth UInt16, ResolutionHeight UInt16, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, FlashMinor2 String, NetMajor UInt8, NetMinor UInt8, UserAgentMajor UInt16, UserAgentMinor FixedString(2), CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, MobilePhone UInt8, MobilePhoneModel String, Params String, IPNetworkID UInt32, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, IsArtifical UInt8, WindowClientWidth UInt16, WindowClientHeight UInt16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 UInt8, SilverlightVersion2 UInt8, SilverlightVersion3 UInt32, SilverlightVersion4 UInt16, PageCharset String, CodeVersion UInt32, IsLink UInt8, IsDownload UInt8, IsNotBounce UInt8, FUniqID UInt64, HID UInt32, IsOldCounter UInt8, IsEvent UInt8, IsParameter UInt8, DontCountHits UInt8, WithHash UInt8, HitColor FixedString(1), UTCEventTime DateTime, Age UInt8, Sex UInt8, Income UInt8, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), RemoteIP UInt32, RemoteIP6 FixedString(16), WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage FixedString(2), BrowserCountry FixedString(2), SocialNetwork String, SocialAction String, HTTPError UInt16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, RedirectTiming Int32, DOMInteractiveTiming Int32, DOMContentLoadedTiming Int32, DOMCompleteTiming Int32, LoadEventStartTiming Int32, LoadEventEndTiming Int32, NSToDOMContentLoadedTiming Int32, FirstPaintTiming Int32, RedirectCount Int8, SocialSourceNetworkID UInt8, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency FixedString(3), ParamCurrencyID UInt16, GoalsReached Array(UInt32), OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, RefererHash UInt64, URLHash UInt64, CLID UInt32, YCLID UInt64, ShareService String, ShareURL String, ShareTitle String, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), IslandID FixedString(16), RequestNum UInt32, RequestTry UInt8) ENGINE = MergeTree() PARTITION BY toYYYYMM(EventDate) ORDER BY (CounterID, EventDate, intHash32(UserID)) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'CREATE TABLE test.hits (WatchID UInt64, JavaEnable UInt8, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RegionID UInt32, UserID UInt64, CounterClass Int8, OS UInt8, UserAgent UInt8, URL String, Referer String, URLDomain String, RefererDomain String, Refresh UInt8, IsRobot UInt8, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), ResolutionWidth UInt16, ResolutionHeight UInt16, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, FlashMinor2 String, NetMajor UInt8, NetMinor UInt8, UserAgentMajor UInt16, UserAgentMinor FixedString(2), CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, MobilePhone UInt8, MobilePhoneModel String, Params String, IPNetworkID UInt32, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, IsArtifical UInt8, WindowClientWidth UInt16, WindowClientHeight UInt16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 UInt8, SilverlightVersion2 UInt8, SilverlightVersion3 UInt32, SilverlightVersion4 UInt16, PageCharset String, CodeVersion UInt32, IsLink UInt8, IsDownload UInt8, IsNotBounce UInt8, FUniqID UInt64, HID UInt32, IsOldCounter UInt8, IsEvent UInt8, IsParameter UInt8, DontCountHits UInt8, WithHash UInt8, HitColor FixedString(1), UTCEventTime DateTime, Age UInt8, Sex UInt8, Income UInt8, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), RemoteIP UInt32, RemoteIP6 FixedString(16), WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage FixedString(2), BrowserCountry FixedString(2), SocialNetwork String, SocialAction String, HTTPError UInt16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, RedirectTiming Int32, DOMInteractiveTiming Int32, DOMContentLoadedTiming Int32, DOMCompleteTiming Int32, LoadEventStartTiming Int32, LoadEventEndTiming Int32, NSToDOMContentLoadedTiming Int32, FirstPaintTiming Int32, RedirectCount Int8, SocialSourceNetworkID UInt8, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency FixedString(3), ParamCurrencyID UInt16, GoalsReached Array(UInt32), OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, RefererHash UInt64, URLHash UInt64, CLID UInt32, YCLID UInt64, ShareService String, ShareURL String, ShareTitle String, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), IslandID FixedString(16), RequestNum UInt32, RequestTry UInt8) ENGINE = MergeTree() PARTITION BY toYYYYMM(EventDate) ORDER BY (CounterID, EventDate, intHash32(UserID)) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'CREATE TABLE test.visits (CounterID UInt32, StartDate Date, Sign Int8, IsNew UInt8, VisitID UInt64, UserID UInt64, StartTime DateTime, Duration UInt32, UTCStartTime DateTime, PageViews Int32, Hits Int32, IsBounce UInt8, Referer String, StartURL String, RefererDomain String, StartURLDomain String, EndURL String, LinkURL String, IsDownload UInt8, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, PlaceID Int32, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), IsYandex UInt8, GoalReachesDepth Int32, GoalReachesURL Int32, GoalReachesAny Int32, SocialSourceNetworkID UInt8, SocialSourcePage String, MobilePhoneModel String, ClientEventTime DateTime, RegionID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RemoteIP UInt32, RemoteIP6 FixedString(16), IPNetworkID UInt32, SilverlightVersion3 UInt32, CodeVersion UInt32, ResolutionWidth UInt16, ResolutionHeight UInt16, UserAgentMajor UInt16, UserAgentMinor UInt16, WindowClientWidth UInt16, WindowClientHeight UInt16, SilverlightVersion2 UInt8, SilverlightVersion4 UInt16, FlashVersion3 UInt16, FlashVersion4 UInt16, ClientTimeZone Int16, OS UInt8, UserAgent UInt8, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, NetMajor UInt8, NetMinor UInt8, MobilePhone UInt8, SilverlightVersion1 UInt8, Age UInt8, Sex UInt8, Income UInt8, JavaEnable UInt8, CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, BrowserLanguage UInt16, BrowserCountry UInt16, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), Params Array(String), Goals Nested(ID UInt32, Serial UInt32, EventTime DateTime, Price Int64, OrderID String, CurrencyID UInt32), WatchIDs Array(UInt64), ParamSumPrice Int64, ParamCurrency FixedString(3), ParamCurrencyID UInt16, ClickLogID UInt64, ClickEventID Int32, ClickGoodEvent Int32, ClickEventTime DateTime, ClickPriorityID Int32, ClickPhraseID Int32, ClickPageID Int32, ClickPlaceID Int32, ClickTypeID Int32, ClickResourceID Int32, ClickCost UInt32, ClickClientIP UInt32, ClickDomainID UInt32, ClickURL String, ClickAttempt UInt8, ClickOrderID UInt32, ClickBannerID UInt32, ClickMarketCategoryID UInt32, ClickMarketPP UInt32, ClickMarketCategoryName String, ClickMarketPPName String, ClickAWAPSCampaignName String, ClickPageName String, ClickTargetType UInt16, ClickTargetPhraseID UInt64, ClickContextType UInt8, ClickSelectType Int8, ClickOptions String, ClickGroupBannerID Int32, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, FirstVisit DateTime, PredLastVisit Date, LastVisit Date, TotalVisits UInt32, TraficSource Nested(ID Int8, SearchEngineID UInt16, AdvEngineID UInt8, PlaceID UInt16, SocialSourceNetworkID UInt8, Domain String, SearchPhrase String, SocialSourcePage String), Attendance FixedString(16), CLID UInt32, YCLID UInt64, NormalizedRefererHash UInt64, SearchPhraseHash UInt64, RefererDomainHash UInt64, NormalizedStartURLHash UInt64, StartURLDomainHash UInt64, NormalizedEndURLHash UInt64, TopLevelDomain UInt64, URLScheme UInt64, OpenstatServiceNameHash UInt64, OpenstatCampaignIDHash UInt64, OpenstatAdIDHash UInt64, OpenstatSourceIDHash UInt64, UTMSourceHash UInt64, UTMMediumHash UInt64, UTMCampaignHash UInt64, UTMContentHash UInt64, UTMTermHash UInt64, FromHash UInt64, WebVisorEnabled UInt8, WebVisorActivity UInt32, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), Market Nested(Type UInt8, GoalID UInt32, OrderID String, OrderPrice Int64, PP UInt32, DirectPlaceID UInt32, DirectOrderID UInt32, DirectBannerID UInt32, GoodID String, GoodName String, GoodQuantity Int32, GoodPrice Int64), IslandID FixedString(16)) ENGINE = CollapsingMergeTree(Sign) PARTITION BY toYYYYMM(StartDate) ORDER BY (CounterID, StartDate, intHash32(UserID), VisitID) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'INSERT INTO test.hits_s3 SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' Received exception from server (version 24.8.14): Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (for user) exceeded: would use 9.18 GiB (attempt to allocate chunk of 1066096 bytes), maximum: 9.18 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.: (while reading column ShareService): (while reading from part store/78e/78ebf6a1-d987-4579-b3ec-00c1a087b1f3/201403_1_1_2/ in table datasets.hits_v1 (78ebf6a1-d987-4579-b3ec-00c1a087b1f3) located on disk __tmp_internal_262634248876485800814430204900764312493 of type web, from mark 360 with max_rows_to_read = 8192): While executing MergeTreeSelect(pool: ReadPool, algorithm: Thread). (MEMORY_LIMIT_EXCEEDED) (query: INSERT INTO test.hits_s3 SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16) + clickhouse-client --query 'INSERT INTO test.hits SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' Received exception from server (version 24.8.14): Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 17.38 GiB (attempt to allocate chunk of 1055893 bytes), maximum: 15.30 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.: (while reading column TraficSourceID): (while reading from part store/78e/78ebf6a1-d987-4579-b3ec-00c1a087b1f3/201403_1_1_2/ in table datasets.hits_v1 (78ebf6a1-d987-4579-b3ec-00c1a087b1f3) located on disk __tmp_internal_262634248876485800814430204900764312493 of type web, from mark 88 with max_rows_to_read = 8192): While executing MergeTreeSelect(pool: ReadPool, algorithm: Thread). (MEMORY_LIMIT_EXCEEDED) (query: INSERT INTO test.hits SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16) + clickhouse-client --query 'INSERT INTO test.visits SELECT * FROM datasets.visits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' + clickhouse-client --query 'DROP TABLE datasets.visits_v1 SYNC' + clickhouse-client --query 'DROP TABLE datasets.hits_v1 SYNC' + clickhouse-client --query 'SHOW TABLES FROM test' hits hits_s3 visits + clickhouse-client --query 'SYSTEM STOP THREAD FUZZER' + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=1425 + clickhouse stop --max-tries 90 --do-not-kill /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1425. The process with pid = 1425 is running. Sent terminate signal to process with pid 1425. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1425. The process with pid = 1425 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1425. The process with pid = 1425 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1425. The process with pid = 1425 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1425. The process with pid = 1425 is running. Waiting for server to stop Now there is no clickhouse-server process. Server stopped + return + export RANDOMIZE_OBJECT_KEY_TYPE=1 + RANDOMIZE_OBJECT_KEY_TYPE=1 + export ZOOKEEPER_FAULT_INJECTION=1 + ZOOKEEPER_FAULT_INJECTION=1 + export THREAD_POOL_FAULT_INJECTION=1 + THREAD_POOL_FAULT_INJECTION=1 + configure + export USE_DATABASE_ORDINARY=1 + USE_DATABASE_ORDINARY=1 + export EXPORT_S3_STORAGE_POLICIES=1 + EXPORT_S3_STORAGE_POLICIES=1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ script.gdb:13: Error in sourced command file: No stack. + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + rm -f /etc/clickhouse-server/config.d/zookeeper.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_fault_injection.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/cannot_allocate_thread_injection.xml /etc/clickhouse-server/config.d/ + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=33677312 + sed --follow-symlinks -i 's|[[:digit:]]\+|33677312|' /etc/clickhouse-server/config.d/keeper_port.xml + value=22272000 + sed --follow-symlinks -i 's|[[:digit:]]\+|22272000|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/users.d/database_ordinary.xml /etc/clickhouse-server/users.d/ + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|100000|10000|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value filtered_list keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value multi_read keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value check_not_exists keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value create_if_not_exists keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + sudo chown clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + sudo chgrp clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value use_compression zookeeper_fault_injection + value=1 + sudo cat /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml.tmp /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + randomize_config_boolean_value enable_block_number_column block_number + value=0 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + randomize_config_boolean_value enable_block_offset_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + echo 'ASAN_OPTIONS='\''malloc_context_size=10 verbosity=1 allocator_release_to_os_interval_ms=10000'\''' + export 'ASAN_OPTIONS=malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + ASAN_OPTIONS='malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + sudo chown root: /var/lib/clickhouse + local total_mem ++ awk '/MemTotal/ { print $(NF-1) }' /proc/meminfo + total_mem=32086448 + total_mem=32856522752 + max_server_memory_usage_to_ram_ratio=0.5 + echo 'Setting max_server_memory_usage_to_ram_ratio to 0.5' + cat Setting max_server_memory_usage_to_ram_ratio to 0.5 Setting max_memory_usage_for_user=9856956825 and max_memory_usage for queries to 10G + local max_users_mem + max_users_mem=9856956825 + echo 'Setting max_memory_usage_for_user=9856956825 and max_memory_usage for queries to 10G' + cat + cat + [[ '' == \1 ]] + [[ '' == \1 ]] + sudo cat /etc/clickhouse-server/config.d/logger_trace.xml + sed 's|trace|test|' + mv /etc/clickhouse-server/config.d/logger_trace.xml.tmp /etc/clickhouse-server/config.d/logger_trace.xml + '[' LRU = SLRU ']' ++ date +%-d + '[' 1 -eq 1 ']' + sudo echo 'true' + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 7 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=8 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 8 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=9 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 9 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=10 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 10 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=11 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 11 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=12 + clickhouse-client --query 'SELECT 1' 127.0.0.1 - - [06/Jul/2026:22:01:41 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 12 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [06/Jul/2026:22:01:41 +0000] "PUT /devstoreaccount1/cont/uugpftogcvlmoyrvakgrpnzyggfkrcdg HTTP/1.1" 201 - 127.0.0.1 - - [06/Jul/2026:22:01:41 +0000] "GET /devstoreaccount1/cont/uugpftogcvlmoyrvakgrpnzyggfkrcdg HTTP/1.1" 206 4 127.0.0.1 - - [06/Jul/2026:22:01:41 +0000] "GET /devstoreaccount1/cont/uugpftogcvlmoyrvakgrpnzyggfkrcdg HTTP/1.1" 206 2 127.0.0.1 - - [06/Jul/2026:22:01:42 +0000] "DELETE /devstoreaccount1/cont/uugpftogcvlmoyrvakgrpnzyggfkrcdg HTTP/1.1" 202 - + counter=13 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 13 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=14 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 14 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=15 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 15 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=16 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 16 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=17 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 17 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=18 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 18 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=19 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 19 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=20 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 20 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=21 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 21 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=22 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 22 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=23 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 23 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=24 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 24 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=25 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 25 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=26 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 26 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=27 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 27 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=28 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 28 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=29 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 29 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=30 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 30 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=31 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 31 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=32 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 32 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=33 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 33 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=34 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 34 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=35 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: fault injected (threads=714, jobs=701). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=1 ++ sleep 5 ++ '[' 1 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 3054 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + stress --hung-check --drop-databases --output-folder test_output --skip-func-tests '' --global-time-limit 1200 2026-07-07 00:02:19,246 Run func tests '/usr/bin/clickhouse-test --client-option ignore_drop_queries_probability=0.5 enable_parallel_replicas=1 max_parallel_replicas=3 cluster_for_parallel_replicas='parallel_replicas' parallel_replicas_for_non_replicated_merge_tree=1 --global_time_limit=1200 ' 2026-07-07 00:02:19,748 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_1 --client-option join_use_nulls=1 join_algorithm='parallel_hash' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:20,249 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_2', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 ignore_drop_queries_probability=0.5 enable_parallel_replicas=1 max_parallel_replicas=3 cluster_for_parallel_replicas='parallel_replicas' parallel_replicas_for_non_replicated_merge_tree=1 --global_time_limit=1200 ' 2026-07-07 00:02:20,751 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_3 --client-option join_algorithm='partial_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:21,253 Run func tests '/usr/bin/clickhouse-test --order=random --client-option join_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:21,754 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_5', 's1', 'r1')" --database=test_5 --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 join_algorithm='full_sorting_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:22,256 Run func tests '/usr/bin/clickhouse-test --order=random --client-option use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:22,757 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_7 --client-option join_use_nulls=1 join_algorithm='grace_hash' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:23,258 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_8', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:23,759 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_9 --client-option join_algorithm='auto' max_rows_in_join=1000 group_by_use_nulls=1 http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:24,261 Run func tests '/usr/bin/clickhouse-test --order=random --client-option join_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:24,763 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_11', 's1', 'r1')" --database=test_11 --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 join_algorithm='parallel_hash' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:25,264 Run func tests '/usr/bin/clickhouse-test --order=random --client-option implicit_transaction=1 throw_on_unsupported_query_inside_transaction=0 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:25,765 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_13 --client-option join_use_nulls=1 join_algorithm='partial_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:26,267 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_14', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:26,768 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_15 --client-option join_algorithm='full_sorting_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-07-07 00:02:27,269 Will wait functests to finish 2026-07-07 00:02:27,270 Finished 6 from 16 processes 2026-07-07 00:02:32,273 Finished 6 from 16 processes 2026-07-07 00:02:37,277 Finished 6 from 16 processes 2026-07-07 00:02:42,281 Finished 6 from 16 processes 2026-07-07 00:02:47,286 Finished 6 from 16 processes 2026-07-07 00:02:52,289 Finished 6 from 16 processes 2026-07-07 00:02:57,295 Finished 6 from 16 processes 2026-07-07 00:03:02,297 Finished 6 from 16 processes 2026-07-07 00:03:07,299 Finished 6 from 16 processes 2026-07-07 00:03:12,301 Finished 6 from 16 processes 2026-07-07 00:03:17,305 Finished 6 from 16 processes 2026-07-07 00:03:22,309 Finished 6 from 16 processes 2026-07-07 00:03:27,312 Finished 6 from 16 processes 2026-07-07 00:03:32,317 Finished 6 from 16 processes 2026-07-07 00:03:37,321 Finished 6 from 16 processes 2026-07-07 00:03:42,325 Finished 6 from 16 processes 2026-07-07 00:03:47,329 Finished 6 from 16 processes 2026-07-07 00:03:52,333 Finished 6 from 16 processes 2026-07-07 00:03:57,337 Finished 6 from 16 processes 2026-07-07 00:04:02,341 Finished 7 from 16 processes 2026-07-07 00:04:07,345 Finished 7 from 16 processes 2026-07-07 00:04:12,349 Finished 7 from 16 processes 2026-07-07 00:04:17,353 Finished 7 from 16 processes 2026-07-07 00:04:22,357 Finished 7 from 16 processes 2026-07-07 00:04:27,361 Finished 7 from 16 processes 2026-07-07 00:04:32,365 Finished 7 from 16 processes 2026-07-07 00:04:37,369 Finished 8 from 16 processes 2026-07-07 00:04:42,373 Finished 8 from 16 processes 2026-07-07 00:04:47,378 Finished 8 from 16 processes 2026-07-07 00:04:52,381 Finished 8 from 16 processes 2026-07-07 00:04:57,385 Finished 8 from 16 processes 2026-07-07 00:05:02,389 Finished 9 from 16 processes 2026-07-07 00:05:07,393 Finished 9 from 16 processes 2026-07-07 00:05:12,396 Finished 11 from 16 processes 2026-07-07 00:05:17,400 Finished 11 from 16 processes 2026-07-07 00:05:22,403 Finished 11 from 16 processes 2026-07-07 00:05:27,405 Finished 11 from 16 processes 2026-07-07 00:05:32,409 Finished 11 from 16 processes 2026-07-07 00:05:37,413 Finished 12 from 16 processes 2026-07-07 00:05:42,418 Finished 12 from 16 processes 2026-07-07 00:05:47,419 Finished 12 from 16 processes 2026-07-07 00:05:52,421 Finished 12 from 16 processes 2026-07-07 00:05:57,425 Finished 12 from 16 processes 2026-07-07 00:06:02,429 Finished 12 from 16 processes 2026-07-07 00:06:07,433 Finished 12 from 16 processes 2026-07-07 00:06:12,437 Finished 12 from 16 processes 2026-07-07 00:06:17,441 Finished 12 from 16 processes 2026-07-07 00:06:22,445 Finished 12 from 16 processes 2026-07-07 00:06:27,449 Finished 12 from 16 processes 2026-07-07 00:06:32,453 Finished 12 from 16 processes 2026-07-07 00:06:37,457 Finished 12 from 16 processes 2026-07-07 00:06:42,461 Finished 12 from 16 processes 2026-07-07 00:06:47,465 Finished 12 from 16 processes 2026-07-07 00:06:52,468 Finished 12 from 16 processes 2026-07-07 00:06:57,473 Finished 12 from 16 processes 2026-07-07 00:07:02,477 Finished 12 from 16 processes 2026-07-07 00:07:07,482 Finished 12 from 16 processes 2026-07-07 00:07:12,485 Finished 12 from 16 processes 2026-07-07 00:07:17,489 Finished 12 from 16 processes 2026-07-07 00:07:22,493 Finished 12 from 16 processes 2026-07-07 00:07:27,497 Finished 12 from 16 processes 2026-07-07 00:07:32,501 Finished 12 from 16 processes 2026-07-07 00:07:37,505 Finished 12 from 16 processes 2026-07-07 00:07:42,509 Finished 12 from 16 processes 2026-07-07 00:07:47,513 Finished 12 from 16 processes 2026-07-07 00:07:52,517 Finished 12 from 16 processes 2026-07-07 00:07:57,521 Finished 12 from 16 processes 2026-07-07 00:08:02,525 Finished 12 from 16 processes 2026-07-07 00:08:07,529 Finished 12 from 16 processes 2026-07-07 00:08:12,533 Finished 12 from 16 processes 2026-07-07 00:08:17,537 Finished 12 from 16 processes 2026-07-07 00:08:22,541 Finished 12 from 16 processes 2026-07-07 00:08:27,545 Finished 12 from 16 processes 2026-07-07 00:08:32,549 Finished 12 from 16 processes 2026-07-07 00:08:37,551 Finished 12 from 16 processes 2026-07-07 00:08:42,553 Finished 12 from 16 processes 2026-07-07 00:08:47,557 Finished 12 from 16 processes 2026-07-07 00:08:52,561 Finished 12 from 16 processes 2026-07-07 00:08:57,565 Finished 12 from 16 processes 2026-07-07 00:09:02,569 Finished 12 from 16 processes 2026-07-07 00:09:07,573 Finished 12 from 16 processes 2026-07-07 00:09:12,577 Finished 12 from 16 processes 2026-07-07 00:09:17,580 Finished 12 from 16 processes 2026-07-07 00:09:22,581 Finished 12 from 16 processes 2026-07-07 00:09:27,586 Finished 12 from 16 processes 2026-07-07 00:09:32,589 Finished 12 from 16 processes 2026-07-07 00:09:37,593 Finished 12 from 16 processes 2026-07-07 00:09:42,597 Finished 12 from 16 processes 2026-07-07 00:09:47,602 Finished 12 from 16 processes 2026-07-07 00:09:52,605 Finished 12 from 16 processes 2026-07-07 00:09:57,609 Finished 12 from 16 processes 2026-07-07 00:10:02,613 Finished 12 from 16 processes 2026-07-07 00:10:07,617 Finished 12 from 16 processes 2026-07-07 00:10:12,621 Finished 12 from 16 processes 2026-07-07 00:10:17,625 Finished 12 from 16 processes 2026-07-07 00:10:22,629 Finished 12 from 16 processes 2026-07-07 00:10:27,633 Finished 12 from 16 processes 2026-07-07 00:10:32,637 Finished 12 from 16 processes 2026-07-07 00:10:37,640 Finished 12 from 16 processes 2026-07-07 00:10:42,641 Finished 12 from 16 processes 2026-07-07 00:10:47,645 Finished 12 from 16 processes 2026-07-07 00:10:52,646 Finished 12 from 16 processes 2026-07-07 00:10:57,651 Finished 12 from 16 processes 2026-07-07 00:11:02,654 Finished 12 from 16 processes 2026-07-07 00:11:07,657 Finished 12 from 16 processes 2026-07-07 00:11:12,661 Finished 12 from 16 processes 2026-07-07 00:11:17,666 Finished 12 from 16 processes 2026-07-07 00:11:22,669 Finished 12 from 16 processes 2026-07-07 00:11:27,673 Finished 12 from 16 processes 2026-07-07 00:11:32,677 Finished 12 from 16 processes 2026-07-07 00:11:37,681 Finished 12 from 16 processes 2026-07-07 00:11:42,685 Finished 12 from 16 processes 2026-07-07 00:11:47,689 Finished 12 from 16 processes 2026-07-07 00:11:52,693 Finished 12 from 16 processes 2026-07-07 00:11:57,697 Finished 12 from 16 processes 2026-07-07 00:12:02,701 Finished 12 from 16 processes 2026-07-07 00:12:07,705 Finished 12 from 16 processes 2026-07-07 00:12:12,709 Finished 12 from 16 processes 2026-07-07 00:12:17,713 Finished 12 from 16 processes 2026-07-07 00:12:22,718 Finished 12 from 16 processes 2026-07-07 00:12:27,720 Finished 12 from 16 processes 2026-07-07 00:12:32,726 Finished 12 from 16 processes 2026-07-07 00:12:37,729 Finished 12 from 16 processes 2026-07-07 00:12:42,733 Finished 12 from 16 processes 2026-07-07 00:12:47,737 Finished 12 from 16 processes 2026-07-07 00:12:52,741 Finished 12 from 16 processes 2026-07-07 00:12:57,745 Finished 12 from 16 processes 2026-07-07 00:13:02,749 Finished 12 from 16 processes 2026-07-07 00:13:07,753 Finished 12 from 16 processes 2026-07-07 00:13:12,756 Finished 12 from 16 processes 2026-07-07 00:13:17,761 Finished 12 from 16 processes 2026-07-07 00:13:22,765 Finished 12 from 16 processes 2026-07-07 00:13:27,770 Finished 12 from 16 processes 2026-07-07 00:13:32,773 Finished 12 from 16 processes 2026-07-07 00:13:37,777 Finished 12 from 16 processes 2026-07-07 00:13:42,780 Finished 12 from 16 processes 2026-07-07 00:13:47,785 Finished 12 from 16 processes 2026-07-07 00:13:52,789 Finished 12 from 16 processes 2026-07-07 00:13:57,793 Finished 12 from 16 processes 2026-07-07 00:14:02,797 Finished 12 from 16 processes 2026-07-07 00:14:07,802 Finished 13 from 16 processes 2026-07-07 00:14:12,805 Finished 13 from 16 processes 2026-07-07 00:14:17,809 Finished 13 from 16 processes 2026-07-07 00:14:22,814 Finished 13 from 16 processes 2026-07-07 00:14:27,817 Finished 13 from 16 processes 2026-07-07 00:14:32,820 Finished 13 from 16 processes 2026-07-07 00:14:37,824 Finished 13 from 16 processes 2026-07-07 00:14:42,829 Finished 13 from 16 processes 2026-07-07 00:14:47,830 Finished 13 from 16 processes 2026-07-07 00:14:52,832 Finished 13 from 16 processes 2026-07-07 00:14:57,837 Finished 13 from 16 processes 2026-07-07 00:15:02,841 Finished 13 from 16 processes 2026-07-07 00:15:07,845 Finished 13 from 16 processes 2026-07-07 00:15:12,848 Finished 13 from 16 processes 2026-07-07 00:15:17,852 Finished 13 from 16 processes 2026-07-07 00:15:22,855 Finished 13 from 16 processes 2026-07-07 00:15:27,860 Finished 13 from 16 processes 2026-07-07 00:15:32,863 Finished 13 from 16 processes 2026-07-07 00:15:37,867 Finished 13 from 16 processes 2026-07-07 00:15:42,869 Finished 13 from 16 processes 2026-07-07 00:15:47,873 Finished 13 from 16 processes 2026-07-07 00:15:52,877 Finished 13 from 16 processes 2026-07-07 00:15:57,883 Finished 13 from 16 processes 2026-07-07 00:16:02,883 Finished 13 from 16 processes 2026-07-07 00:16:07,885 Finished 13 from 16 processes 2026-07-07 00:16:12,891 Finished 13 from 16 processes 2026-07-07 00:16:17,893 Finished 13 from 16 processes 2026-07-07 00:16:22,897 Finished 13 from 16 processes 2026-07-07 00:16:27,903 Finished 14 from 16 processes 2026-07-07 00:16:32,908 Finished 14 from 16 processes 2026-07-07 00:16:37,913 Finished 14 from 16 processes 2026-07-07 00:16:42,917 Finished 14 from 16 processes 2026-07-07 00:16:47,921 Finished 14 from 16 processes 2026-07-07 00:16:52,926 Finished 14 from 16 processes 2026-07-07 00:16:57,932 Finished 14 from 16 processes 2026-07-07 00:17:02,933 Finished 14 from 16 processes 2026-07-07 00:17:07,938 Finished 14 from 16 processes 2026-07-07 00:17:12,941 Finished 14 from 16 processes 2026-07-07 00:17:17,943 Finished 14 from 16 processes 2026-07-07 00:17:22,948 Finished 14 from 16 processes 2026-07-07 00:17:27,949 Finished 14 from 16 processes 2026-07-07 00:17:32,952 Finished 14 from 16 processes 2026-07-07 00:17:37,958 Finished 14 from 16 processes 2026-07-07 00:17:42,963 Finished 14 from 16 processes 2026-07-07 00:17:47,967 Finished 14 from 16 processes 2026-07-07 00:17:52,972 Finished 14 from 16 processes 2026-07-07 00:17:57,977 Finished 14 from 16 processes 2026-07-07 00:18:02,981 Finished 14 from 16 processes 2026-07-07 00:18:07,982 Finished 14 from 16 processes 2026-07-07 00:18:12,988 Finished 14 from 16 processes 2026-07-07 00:18:17,991 Finished 14 from 16 processes 2026-07-07 00:18:22,995 Finished 14 from 16 processes 2026-07-07 00:18:28,001 Finished 14 from 16 processes 2026-07-07 00:18:33,002 Finished 14 from 16 processes 2026-07-07 00:18:38,005 Finished 14 from 16 processes 2026-07-07 00:18:43,009 Finished 14 from 16 processes 2026-07-07 00:18:48,012 Finished 14 from 16 processes 2026-07-07 00:18:53,016 Finished 14 from 16 processes 2026-07-07 00:18:58,021 Finished 14 from 16 processes 2026-07-07 00:19:03,026 Finished 14 from 16 processes 2026-07-07 00:19:08,029 Finished 14 from 16 processes 2026-07-07 00:19:13,033 Finished 14 from 16 processes 2026-07-07 00:19:18,034 Finished 14 from 16 processes 2026-07-07 00:19:23,037 Finished 14 from 16 processes 2026-07-07 00:19:28,042 Finished 14 from 16 processes 2026-07-07 00:19:33,045 Finished 14 from 16 processes 2026-07-07 00:19:38,051 Finished 14 from 16 processes 2026-07-07 00:19:43,053 Finished 14 from 16 processes 2026-07-07 00:19:48,058 Finished 14 from 16 processes 2026-07-07 00:19:53,059 Finished 14 from 16 processes 2026-07-07 00:19:58,064 Finished 14 from 16 processes 2026-07-07 00:20:03,069 Finished 14 from 16 processes 2026-07-07 00:20:08,074 Finished 14 from 16 processes 2026-07-07 00:20:13,080 Finished 14 from 16 processes 2026-07-07 00:20:18,081 Finished 14 from 16 processes 2026-07-07 00:20:23,086 Finished 14 from 16 processes 2026-07-07 00:20:28,091 Finished 14 from 16 processes 2026-07-07 00:20:33,093 Finished 14 from 16 processes 2026-07-07 00:20:38,098 Finished 14 from 16 processes 2026-07-07 00:20:43,101 Finished 14 from 16 processes 2026-07-07 00:20:48,105 Finished 14 from 16 processes 2026-07-07 00:20:53,109 Finished 14 from 16 processes 2026-07-07 00:20:58,113 Finished 14 from 16 processes 2026-07-07 00:21:03,116 Finished 14 from 16 processes 2026-07-07 00:21:08,121 Finished 14 from 16 processes 2026-07-07 00:21:13,125 Finished 14 from 16 processes 2026-07-07 00:21:18,129 Finished 14 from 16 processes 2026-07-07 00:21:23,133 Finished 14 from 16 processes 2026-07-07 00:21:28,137 Finished 14 from 16 processes 2026-07-07 00:21:33,138 Finished 14 from 16 processes 2026-07-07 00:21:38,142 Finished 14 from 16 processes 2026-07-07 00:21:43,148 Finished 14 from 16 processes 2026-07-07 00:21:48,151 Finished 14 from 16 processes 2026-07-07 00:21:53,156 Finished 14 from 16 processes 2026-07-07 00:21:58,161 Finished 14 from 16 processes 2026-07-07 00:22:03,165 Finished 14 from 16 processes 2026-07-07 00:22:08,169 Finished 14 from 16 processes 2026-07-07 00:22:13,173 Finished 14 from 16 processes 2026-07-07 00:22:18,178 Finished 14 from 16 processes 2026-07-07 00:22:23,181 Finished 14 from 16 processes 2026-07-07 00:22:28,186 Finished 14 from 16 processes 2026-07-07 00:22:33,192 Finished 15 from 16 processes 2026-07-07 00:22:38,193 Finished 15 from 16 processes 2026-07-07 00:22:43,195 Finished 15 from 16 processes 2026-07-07 00:22:48,197 Finished 15 from 16 processes 2026-07-07 00:22:53,201 Finished 15 from 16 processes 2026-07-07 00:22:58,202 Finished 15 from 16 processes 2026-07-07 00:23:03,206 Finished 15 from 16 processes 2026-07-07 00:23:08,211 Finished 15 from 16 processes 2026-07-07 00:23:13,216 Finished 15 from 16 processes 2026-07-07 00:23:18,219 Finished 15 from 16 processes 2026-07-07 00:23:23,224 Finished 15 from 16 processes 2026-07-07 00:23:28,229 Finished 15 from 16 processes 2026-07-07 00:23:33,233 Finished 15 from 16 processes 2026-07-07 00:23:38,238 Finished 15 from 16 processes 2026-07-07 00:23:43,243 Finished 15 from 16 processes 2026-07-07 00:23:48,248 Finished 15 from 16 processes 2026-07-07 00:23:53,253 Finished 15 from 16 processes 2026-07-07 00:23:58,259 Finished 15 from 16 processes 2026-07-07 00:24:03,263 Finished 15 from 16 processes 2026-07-07 00:24:08,268 Finished 15 from 16 processes 2026-07-07 00:24:13,273 Finished 15 from 16 processes 2026-07-07 00:24:18,278 Finished 15 from 16 processes 2026-07-07 00:24:23,283 Finished 15 from 16 processes 2026-07-07 00:24:28,288 Finished 15 from 16 processes 2026-07-07 00:24:33,293 Finished 15 from 16 processes 2026-07-07 00:24:38,297 Finished 15 from 16 processes 2026-07-07 00:24:43,303 Finished 15 from 16 processes 2026-07-07 00:24:48,308 Finished 15 from 16 processes 2026-07-07 00:24:53,313 Finished 15 from 16 processes 2026-07-07 00:24:58,317 Finished 15 from 16 processes 2026-07-07 00:25:03,322 Finished 15 from 16 processes 2026-07-07 00:25:08,328 Finished 15 from 16 processes 2026-07-07 00:25:13,333 Finished 15 from 16 processes 2026-07-07 00:25:18,337 Finished 15 from 16 processes 2026-07-07 00:25:23,342 Finished 15 from 16 processes 2026-07-07 00:25:28,345 Finished 15 from 16 processes 2026-07-07 00:25:33,349 Finished 15 from 16 processes 2026-07-07 00:25:38,353 Finished 15 from 16 processes 2026-07-07 00:25:43,359 Finished 15 from 16 processes 2026-07-07 00:25:48,363 Finished 15 from 16 processes 2026-07-07 00:25:53,365 Finished 15 from 16 processes 2026-07-07 00:25:58,369 Finished 15 from 16 processes 2026-07-07 00:26:03,371 Finished 15 from 16 processes 2026-07-07 00:26:08,376 Finished 15 from 16 processes 2026-07-07 00:26:13,381 Finished 15 from 16 processes 2026-07-07 00:26:18,385 Finished 15 from 16 processes 2026-07-07 00:26:23,389 Finished 15 from 16 processes 2026-07-07 00:26:28,392 Finished 15 from 16 processes 2026-07-07 00:26:33,397 Finished 15 from 16 processes 2026-07-07 00:26:38,398 Finished 15 from 16 processes 2026-07-07 00:26:43,402 Finished 15 from 16 processes 2026-07-07 00:26:48,405 Finished 15 from 16 processes 2026-07-07 00:26:53,409 Finished 15 from 16 processes 2026-07-07 00:26:58,414 Finished 15 from 16 processes 2026-07-07 00:27:03,420 Finished 15 from 16 processes 2026-07-07 00:27:08,424 Finished 15 from 16 processes 2026-07-07 00:27:13,429 Finished 15 from 16 processes 2026-07-07 00:27:18,432 All processes finished 2026-07-07 00:27:18,432 Compressing stress logs 2026-07-07 00:27:18,457 Logs compressed 2026-07-07 00:27:18,457 Will terminate gdb (if any) 2026-07-07 00:27:18,457 Running command: kill -TERM $(pidof gdb) 2026-07-07 00:27:18,465 Running command: timeout 50s tail --pid=$(pidof gdb) -f /dev/null || kill -9 $(pidof gdb) ||: 2026-07-07 00:27:19,483 Running command: kill -CONT $(cat /var/run/clickhouse-server/clickhouse-server.pid) && clickhouse client -q 'SELECT 1 FORMAT Null' 2026-07-07 00:27:19,799 Running command: clickhouse client -q "SYSTEM STOP THREAD FUZZER" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,115 Running command: clickhouse client -q "SYSTEM START MERGES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,280 Running command: clickhouse client -q "SYSTEM START DISTRIBUTED SENDS" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,445 Running command: clickhouse client -q "SYSTEM START TTL MERGES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,610 Running command: clickhouse client -q "SYSTEM START MOVES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,776 Running command: clickhouse client -q "SYSTEM START FETCHES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:20,941 Running command: clickhouse client -q "SYSTEM START REPLICATED SENDS" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,106 Running command: clickhouse client -q "SYSTEM START REPLICATION QUEUES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,271 Running command: clickhouse client -q "SYSTEM DROP MARK CACHE" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,437 Running command: clickhouse client -q "KILL QUERY WHERE upper(query) LIKE 'WATCH %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,602 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'insert into tableB select %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,768 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'SELECT URL, uniq(SearchPhrase) AS u FROM test.hits GROUP BY URL ORDER BY u %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:21,883 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'SELECT (SELECT number FROM system.numbers WHERE number = 1000000000000)%'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-07-07 00:27:23,577 Checking if some queries hung Using queries from '/usr/share/clickhouse-test/queries' directory Connecting to ClickHouse server... OK Connected to server 24.8.14.10546.altinitytest @ 6a78805ec9737295beb4a8d213873fb4093d11eb HEAD Running 1 stateless tests (MainProcess). 00001_select_1: [ OK ] 1 tests passed. 0 tests skipped. 0.48 s elapsed (MainProcess). Won't run stateful tests because test data wasn't loaded. Checking the hung queries: done No queries hung. All tests have finished. Top patterns of log messages: count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 1. 12815 0.106 1.30 MiB 0.069 1 76 ['Trace'] 0.19 Checking existence of path: {} 2. 4081 0.034 119.60 KiB 0.006 1 82 ['Trace'] 0.001 Query to stage {}{} 3. 4037 0.033 214.48 KiB 0.011 1 82 ['Trace'] 0.001 Query from stage {} to stage {}{} 4. 3963 0.033 607.61 KiB 0.032 1925 83 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 5. 3944 0.033 740.10 KiB 0.038 1 83 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 6. 3517 0.029 99.26 KiB 0.005 1 83 ['Debug'] 0.001 Processed in {} sec. 7. 3322 0.027 386.08 KiB 0.02 1 27 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 8. 3247 0.027 228.38 KiB 0.012 1 525 ['Trace'] 0.913 Reserved {} on local disk {}, having unreserved {}. 9. 3212 0.027 222.78 KiB 0.012 69 520 ['Trace'] 0.917 Trying to reserve {} using storage policy from min volume index {} 10. 3182 0.026 298.70 KiB 0.016 1 34 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 11. 3160 0.026 375.37 KiB 0.02 68 137 ['Trace'] 0.718 Renaming temporary part {} to {} with tid {}. 12. 2968 0.025 142.27 KiB 0.007 1 127 ['Trace'] 0.692 filled checksums {} 13. 2062 0.017 118.42 KiB 0.006 15 38 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 14. 2052 0.017 72.88 KiB 0.004 15 38 ['Trace'] 1 Flushed system log up to offset {} 15. 1945 0.016 218.43 KiB 0.011 1945 84 ['Debug'] 0.999 {} Authenticated with global context as user {} 16. 1945 0.016 90.76 KiB 0.005 1945 84 ['Debug'] 0.999 Authenticating user '{}' from {} 17. 1944 0.016 142.38 KiB 0.007 1944 83 ['Debug'] 1 Creating session context with user_id: {} 18. 1924 0.016 169.10 KiB 0.009 1924 78 ['Debug'] 0.999 {} Logout, user_id: {} 19. 1804 0.015 76.67 KiB 0.004 1 39 ['Trace'] 1 is disk {} eligible for search: {} 20. 1707 0.014 137.14 KiB 0.007 1 72 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 21. 1665 0.014 90.21 KiB 0.005 1 100 ['Debug'] 0.396 Peak memory usage{}: {}. 22. 1584 0.013 162.03 KiB 0.008 1 7 ['Trace'] 0.5 Adding file: {}, size: {} 23. 1559 0.013 69.55 KiB 0.004 1 3 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 24. 1553 0.013 53.02 KiB 0.003 1 83 ['Trace'] 1 TCP Request. Address: {} 25. 1553 0.013 137.29 KiB 0.007 1 83 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 26. 1490 0.012 114.95 KiB 0.006 1 1 ['Debug'] 1 Restarting waiting for CQEs due to: {} 27. 1486 0.012 39.18 KiB 0.002 1 77 ['Debug'] 1 Done processing connection. 28. 1407 0.012 125.93 KiB 0.007 1 87 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 29. 1225 0.01 154.88 KiB 0.008 1 6 ['Trace'] 1 MemoryTracking: was {}, peak {}, free memory in arenas {}, will set to {} (RSS), difference: {} 30. 1214 0.01 3.13 MiB 0.166 1 474 ['Error'] 1 Table is in readonly mode (replica path: {}) 31. 1169 0.01 62.64 KiB 0.003 2 10 ['Trace'] 0.995 Loading config file '{}'. 32. 1140 0.009 34.28 KiB 0.002 1 86 ['Trace'] 0 Aggregation method: {} 33. 1038 0.009 61.83 KiB 0.003 113 83 ['Debug'] 0.334 There are {} detached tables. Start searching non used tables. 34. 1038 0.009 43.59 KiB 0.002 113 83 ['Debug'] 0.334 Found {} non used tables in detached tables. 35. 1013 0.008 85.07 KiB 0.004 39 21 ['Trace'] 0 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 36. 948 0.008 75.27 KiB 0.004 1 79 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 37. 942 0.008 21.16 KiB 0.001 1 87 ['Trace'] 0 Merging aggregated data 38. 938 0.008 10.08 KiB 0.001 1 77 ['Trace'] 0 Aggregating 39. 854 0.007 86.30 KiB 0.004 1 2 ['Trace'] 1 Creating part at path {} 40. 686 0.006 36.64 KiB 0.002 23 407 ['Debug'] 0.997 Selected {} parts from {} to {} 41. 681 0.006 139.99 KiB 0.007 2 31 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 42. 677 0.006 263.19 KiB 0.014 2 31 ['Trace'] 1 Request URI: {} 43. 672 0.006 22.91 KiB 0.001 1 35 ['Debug'] 0 Selected MergeAlgorithm: {} 44. 672 0.006 56.06 KiB 0.003 1 35 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 45. 627 0.005 41.12 KiB 0.002 24 34 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 46. 627 0.005 81.82 KiB 0.004 1 33 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 47. 587 0.005 64.09 KiB 0.003 39 35 ['Debug'] 0.997 Removing {} parts from filesystem (serially): Parts: [{}] 48. 582 0.005 102.48 KiB 0.005 1 24 ['Trace'] 0 No query result found for query {} 49. 571 0.005 53.29 KiB 0.003 24 23 ['Debug'] 0.996 Removing {} parts from memory: Parts: [{}] 50. 571 0.005 52.73 KiB 0.003 24 23 ['Trace'] 0.996 Found {} old parts to remove. Parts: [{}] 51. 552 0.005 11.32 KiB 0.001 2 31 ['Debug'] 0.399 Done processing query 52. 507 0.004 20.30 KiB 0.001 11 76 ['Trace'] 0.004 Sending external_roles with query: [{}] ({}) 53. 412 0.003 31.79 KiB 0.002 1 58 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 54. 382 0.003 32.75 KiB 0.002 15 269 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 55. 368 0.003 32.27 KiB 0.002 12 172 ['Trace'] 1 Insert entry {} to queue with type {} 56. 365 0.003 50.73 KiB 0.003 11 261 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 57. 358 0.003 20.99 KiB 0.001 16 73 ['Trace'] 0.994 Finished loading {} part {} on disk {} 58. 358 0.003 18.54 KiB 0.001 16 73 ['Trace'] 0.994 Loading {} part {} from disk {} 59. 350 0.003 54.75 KiB 0.003 1 23 ['Trace'] 0 Stored query result of query {} 60. 347 0.003 56.28 KiB 0.003 11 70 ['Debug'] 0 Sent data for {} scalars, total {} rows in {} sec., {} rows/sec., {} ({}/sec.), compressed {} times to {} ({}/sec.) 61. 330 0.003 33.04 KiB 0.002 10 23 ['Debug'] 1 Fetching part {} from {}:{} 62. 329 0.003 7.15 KiB 0 45 255 ['Trace'] 1 Execution took {} ms. 63. 322 0.003 25.31 KiB 0.001 9 17 ['Trace'] 1 Part {} is not stored on zero-copy replicated disk, blobs can be removed 64. 310 0.003 8.80 KiB 0 1 108 ['Debug'] 1 Stop worker in {} 65. 310 0.003 12.14 KiB 0.001 1 84 ['Debug'] 0.639 Spawn loader worker #{} in {} 66. 309 0.003 20.75 KiB 0.001 1 93 ['Debug'] 1 Finish load job '{}' with status {} 67. 309 0.003 21.98 KiB 0.001 1 93 ['Debug'] 1 Execute load job '{}' in {} 68. 309 0.003 22.89 KiB 0.001 1 26 ['Debug'] 0.269 Schedule load job '{}' into {} 69. 306 0.003 1.48 MiB 0.079 8 57 ['Error'] 0.157 Cannot schedule a task: {} (threads={}, jobs={}) 70. 298 0.002 27.05 KiB 0.001 1 27 ['Debug'] 0.188 Prioritize load job '{}': {} -> {} 71. 296 0.002 12.72 KiB 0.001 1 3 ['Information'] 1 {} for session {} took {} ms 72. 287 0.002 10.37 KiB 0.001 10 22 ['Trace'] 1 Checking disk {} with type {} 73. 287 0.002 24.66 KiB 0.001 10 22 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 74. 276 0.002 10.65 KiB 0.001 11 31 ['Debug'] 0.79 Committing part {} to zookeeper 75. 268 0.002 10.08 KiB 0.001 11 31 ['Debug'] 0.813 Part {} committed to zookeeper 76. 268 0.002 8.33 KiB 0 20 9 ['Debug'] 0.026 Requested flush up to offset {} 77. 264 0.002 21.32 KiB 0.001 1 3 ['Debug'] 1 Merging configuration file '{}'. 78. 245 0.002 8.12 KiB 0 1 82 ['Debug'] 0.547 Change current priority: {} -> {} 79. 237 0.002 12.45 KiB 0.001 11 51 ['Trace'] 0.008 Connecting. Database: {}. User: {}{}{} 80. 235 0.002 10.79 KiB 0.001 11 53 ['Trace'] 0.009 Connected to {} server version {}.{}.{}. 81. 232 0.002 2.04 KiB 0 2 26 ['Trace'] 0.034 No tables 82. 220 0.002 10.00 KiB 0.001 10 22 ['Debug'] 1 Downloading part {} onto disk {}. 83. 220 0.002 18.69 KiB 0.001 10 22 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 84. 220 0.002 5.06 KiB 0 10 9 ['Trace'] 1 Sending part {} 85. 220 0.002 4.09 KiB 0 10 22 ['Debug'] 1 Downloading files {} 86. 218 0.002 21.62 KiB 0.001 10 22 ['Debug'] 1 Fetched part {} from {}:{}{} 87. 218 0.002 11.82 KiB 0.001 10 22 ['Debug'] 1 Download of part {} onto disk {} finished. 88. 205 0.002 6.10 KiB 0 6 39 ['Trace'] 0 Found (RIGHT) boundary mark: {} 89. 205 0.002 5.89 KiB 0 6 39 ['Trace'] 0 Found (LEFT) boundary mark: {} 90. 205 0.002 13.89 KiB 0.001 6 39 ['Trace'] 0 Running binary search on index range for part {} ({} marks) 91. 205 0.002 6.71 KiB 0 6 39 ['Trace'] 0 Found {} range {}in {} steps 92. 194 0.002 25.62 KiB 0.001 3 24 ['Debug'] 0 {}, {} blocks, {} rows, {} bytes in {} sec., {} rows/sec., {}/sec. 93. 193 0.002 15.40 KiB 0.001 1 50 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 94. 193 0.002 4.90 KiB 0 12 172 ['Debug'] 1 Pulled {} entries to queue. 95. 193 0.002 11.12 KiB 0.001 12 172 ['Debug'] 1 Pulling {} entries to queue: {} - {} 96. 186 0.002 37.49 KiB 0.002 11 17 ['Information'] 1 {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 97. 180 0.001 23.71 KiB 0.001 1 3 ['Information','Debug'] 1 {} ({}:{}) 98. 180 0.001 5.74 KiB 0 45 26 ['Debug'] 0 Key condition: {} 99. 179 0.001 7.87 KiB 0 44 25 ['Trace'] 0 Filtering marks by primary and secondary keys 100. 175 0.001 5.64 KiB 0 1 3 ['Trace'] 1 Received heartbeat for session #{} count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string Top messages without format string (fmt::runtime): count pattern runtime_message line 1. 34 CodeDBExceptionReceivedfromDBExc Code: 439. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Cannot schedule a task: fault injected (threads=748, jobs=735). Stack trace: 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) ('/executeQuery.cpp',221) 2. 3 Forkedachildprocesstowatch Forked a child process to watch ('',0) 3. 3 invalidelectiontimeoutlowerbound invalid election timeout lower bound detected, adjusted to 0 ('/LoggerWrapper.h',43) 4. 3 newconfiglogidxprevlogidxcurconf new config log idx 37, prev log idx 12, cur config log idx 12, prev log idx 1 ('/LoggerWrapper.h',43) 5. 3 startingup starting up ('',0) 6. 3 configatindexiscommittedprevconf config at index 37 is committed, prev config log idx 12 ('/LoggerWrapper.h',43) 7. 3 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43) 8. 3 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43) 9. 3 parameterselectiontimeoutrangehe parameters: election timeout range 0 - 0, heartbeat 0, leadership expiry 0, max batch 100, backoff 50, snapshot distance 10000, enable randomized snapshot creation NO, log sync stop gap 99999, reserved logs 2147483647, client timeout 10000, auto forwarding ('/LoggerWrapper.h',43) 10. 3 statemachinecommitindexprecommit state machine commit index 36, precommit index 36, last log index 36 ('/LoggerWrapper.h',43) 11. 3 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43) 12. 3 INITRAFTSERVERcommitindextermele === INIT RAFT SERVER === commit index 36 term 2 election timer allowed log store start 1, end 36 config log idx 12, prev log idx 1 -- ASYNC REPLICATION -- ('/LoggerWrapper.h',43) 13. 3 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43) 14. 3 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10546.altinitytest (revision: 4294967295, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb, build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26), PID 3054 ('',0) 15. 3 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43) 16. 3 VOTEINITmyidmyrolecandidateterml [VOTE INIT] my id 1, my role candidate, term 3, log idx 36, log term 2, priority (target 1 / mine 1) ('/LoggerWrapper.h',43) 17. 3 newconfigurationlogidxprevlogidx new configuration: log idx 37, prev log idx 12 peer 1, DC ID 0, localhost:9234, voting member, 1 my id: 1, leader: 1, term: 3 ('/LoggerWrapper.h',43) 18. 3 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 37 ('/LoggerWrapper.h',43) 19. 3 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43) 20. 3 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43) 21. 3 numberofpendingcommitelements number of pending commit elements: 0 ('/LoggerWrapper.h',43) 22. 3 peerDCIDlocalhostvotingmembermyi peer 1: DC ID 0, localhost:9234, voting member, 1 my id: 1, voting_member num peers: 0 ('/LoggerWrapper.h',43) 23. 3 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43) 24. 3 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 2, state term 2, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43) 25. 2 prevotetermisdifferentresetitto pre-vote term (0) is different, reset it to 2 ('/LoggerWrapper.h',43) 26. 2 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('BAD'): BAD SQL. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SELECT subque ('/executeQuery.cpp',221) 27. 2 CodeDBExceptionPathisrelativewhi Code: 395. DB::Exception: Path is relative: : while executing 'FUNCTION throwIf(_CAST(1_UInt8, 'UInt8'_String) :: 1, 'Path is relative: '_String :: 2) -> throwIf(_CAST(1_UInt8, 'UInt8'_String), 'Path is relative: '_String) UInt8 : 3'. (FUNCTION_THROW_IF_VA ('/executeQuery.cpp',221) Top messages not matching their format strings: message_format_string count() any_message 1. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 103 /var/lib/clickhouse/store/6e7/6e702c4d-b8f8-4d55-9a07-de285e136960/tmp_insert_201403_8_8_0/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 14 similar messages) 2. 71 Forked a child process to watch Top short messages: c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 1. 17 {} Server was built in debug mode. It will work slowly. 26 2. 6 Cannot TRUNCATE dictionary Code: 62. DB::Exception: Cannot TRUNCATE dictionary. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build) 27 3. 5 Found {} on {} Found snapshot_11.bin.zstd on LocalSnapshotDisk 18 Top messages by level: (0.010047256867142822,'Table is in readonly mode (replica path: {})') Error (0.0003475986725041174,'Client has gone away.') Warning (0.002449743025267113,'{} for session {} took {} ms') Information (0.03264117057991045,'(from {}{}{}){}{} {} (stage: {})') Debug (0.10605897590810154,'Checking existence of path: {}') Trace 2026-07-07 00:27:26,454 Stress test finished + echo -e 'Test script exit code\tOK\t\N\t' + rg -Fa 'No queries hung' /test_output/test_results.tsv + grep -Fa OK No queries hung OK \N + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=3054 + clickhouse stop --max-tries 90 --do-not-kill /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Sent terminate signal to process with pid 3054. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 3054. The process with pid = 3054 does not exist. Server stopped + return + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.stress.log + unset THREAD_FUZZER_CPU_TIME_PERIOD_US THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY THREAD_FUZZER_SLEEP_PROBABILITY THREAD_FUZZER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX THREAD_POOL_FAULT_INJECTION + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [06/Jul/2026:22:27:34 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - 127.0.0.1 - - [06/Jul/2026:22:27:34 +0000] "PUT /devstoreaccount1/cont/vxcbqrcqucexyzgbzjlxxwkfvubtimrd HTTP/1.1" 201 - + counter=2 + clickhouse-client --query 'SELECT 1' 127.0.0.1 - - [06/Jul/2026:22:27:34 +0000] "GET /devstoreaccount1/cont/vxcbqrcqucexyzgbzjlxxwkfvubtimrd HTTP/1.1" 206 4 127.0.0.1 - - [06/Jul/2026:22:27:34 +0000] "GET /devstoreaccount1/cont/vxcbqrcqucexyzgbzjlxxwkfvubtimrd HTTP/1.1" 206 2 127.0.0.1 - - [06/Jul/2026:22:27:34 +0000] "DELETE /devstoreaccount1/cont/vxcbqrcqucexyzgbzjlxxwkfvubtimrd HTTP/1.1" 202 - Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: fault injected (threads=7, jobs=7). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=1 ++ sleep 5 ++ '[' 1 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 21079 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + check_server_start + clickhouse-client --query 'SELECT '\''Server successfully started'\'', '\''OK'\'', NULL, '\'''\''' + '[' -s /test_output/application_errors.txt ']' + rm /test_output/application_errors.txt rm: cannot remove '/test_output/application_errors.txt': No such file or directory + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=21079 + clickhouse stop --max-tries 90 --do-not-kill /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Sent terminate signal to process with pid 21079. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Process (pid = 21079) is still running. Will not try to kill it. + '[' true == true ']' + echo -e 'Warning: server did not stop yet\tOK\t\N\t' ++ pidof gdb + kill -TERM 21921 + sleep 5 + kill -s 0 21079 + echo -e 'Possible deadlock on shutdown (see gdb.log)\tFAIL\t\N\t' + echo 'thread apply all backtrace (on stop)' + timeout 30m gdb -batch -ex 'thread apply all backtrace' -p 21079 + ts '%Y-%m-%d %H:%M:%S' warning: process 21079 is a zombie - the process has already terminated ptrace: Operation not permitted. + clickhouse stop --force /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Sent kill signal to process with pid 21079. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 21079. The process with pid = 21079 does not exist. Server stopped + '[' -f /var/log/clickhouse-server/clickhouse-server.log ']' + '[' -f /var/log/clickhouse-server/stderr.log ']' + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.final.log + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + grep -v a.myext + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No lost s3 keys\tOK\t\N\t' + grep SharedMergeTreePartCheckThread + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'Killed by signal (in clickhouse-server.log)\tFAIL\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log ++ trim_server_logs fatal_messages.txt ++ head -n 100 /test_output/fatal_messages.txt ++ grep -Eo ' \[ [0-9]+ \] \{.*' ++ escaped ++ clickhouse local -S 's String' --input-format=LineAsString -q 'select substr(s, 1, 300) from table format CustomSeparated settings format_custom_row_after_delimiter='\''\\\\n'\''' + echo -e 'Fatal message in clickhouse-server.log (see fatal_messages.txt)\tFAIL\t\N\t [ 21080 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) Terminate called for uncaught exception:\\n [ 21080 ] {} BaseDaemon: Code: 999. Coordination::Exception: Session expired. (KEEPER_EXCEPTION), Stack trace (when copying this message, always include the lines below):\\n [ 21080 ] {} BaseDaemon: \\n [ 21080 ] {} BaseDaemon: 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164a1a32\\n [ 21080 ] {} BaseDaemon: 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c653179\\n [ 21080 ] {} BaseDaemon: 2. /build/contrib/llvm-project/libcxx/include/string:1499: _ZN12Coordination9ExceptionC2IRA16_KcQsr3stdE16is_convertible_vIT_NSt3__112basic_stringIcNS6_11char_traitsIcEENS6_9allocatorIcEEEEEEEOS5_NS_5ErrorE @ 0x00000000134a55fb\\n [ 21080 ] {} BaseDaemon: 3. /build/src/Common/ZooKeeper/IKeeper.h:0: Coordination::ZooKeeper::pushRequest(Coordination::ZooKeeper::RequestInfo&&) @ 0x00000000134ccdc2\\n [ 21080 ] {} BaseDaemon: 4. /build/src/Common/ZooKeeper/ZooKeeperImpl.cpp:1365: Coordination::ZooKeeper::exists(String const&, std::function, std::shared_ptr>) @ 0x00000000134cf245\\n [ 21080 ] {} BaseDaemon: 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347e7b8\\n [ 21080 ] {} BaseDaemon: 6. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347e3b9\\n [ 21080 ] {} BaseDaemon: 7. /build/src/Common/ZooKeeper/ZooKeeper.cpp:598: zkutil::ZooKeeper::existsWatch(String const&, Coordination::Stat*, std::function) @ 0x000000001347e973\\n [ 21080 ] {} BaseDaemon: 8. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347c488\\n [ 21080 ] {} BaseDaemon: 9. /build/src/Storages/StorageReplicatedMergeTree.cpp:0: DB::StorageReplicatedMergeTree::forcefullyRemoveBrokenOutdatedPartFromZooKeeperBeforeDetaching(String const&) @ 0x000000001241f508\\n [ 21080 ] {} BaseDaemon: 10. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_stor\\n [ 21080 ] {} BaseDaemon: 11. /build/contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001041557a\\n [ 21080 ] {} BaseDaemon: 12. /build/contrib/llvm-project/libcxx/include/future:2069: std::packaged_task::operator()() @ 0x000000000cbaa497\\n [ 21080 ] {} BaseDaemon: 13. /build/src/Common/ThreadPool.cpp:781: ThreadPoolImpl>::ThreadFromThreadPool::worker() @ 0x000000000c709f9f\\n [ 21080 ] {} BaseDaemon: 14. /build/contrib/llvm-project/libcxx/include/__functional/invoke.h:0: ? @ 0x000000000c70f122\\n [ 21080 ] {} BaseDaemon: 15. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c707d2e\\n [ 21080 ] {} BaseDaemon: 16. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)()\\n [ 21080 ] {} BaseDaemon: 17. ? @ 0x00007f89f86b2ac3\\n [ 21080 ] {} BaseDaemon: 18. ? @ 0x00007f89f87448d0\\n [ 21080 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build))\\n [ 21961 ] {} BaseDaemon: ########## Short fault info ############\\n [ 21961 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) Received signal 6\\n [ 21961 ] {} BaseDaemon: Signal description: Aborted\\n [ 21961 ] {} BaseDaemon: \\n [ 21961 ] {} BaseDaemon: Stack trace: 0x000000000c681388 0x000000000c8d475e 0x00007f89f8660520 0x00007f89f86b49fd 0x00007f89f8660476 0x00007f89f86467f3 0x000000000c8d4d2e 0x000000001855f883 0x000000001855f818 0x00000000127abe0a 0x000000001097a034 0x000000001097cc94 0x000000001097d267 0x0000\\n [ 21961 ] {} BaseDaemon: ########################################\\n [ 21961 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) (no query) Received signal Aborted (6)\\n [ 21961 ] {} BaseDaemon: \\n [ 21961 ] {} BaseDaemon: Stack trace: 0x000000000c681388 0x000000000c8d475e 0x00007f89f8660520 0x00007f89f86b49fd 0x00007f89f8660476 0x00007f89f86467f3 0x000000000c8d4d2e 0x000000001855f883 0x000000001855f818 0x00000000127abe0a 0x000000001097a034 0x000000001097cc94 0x000000001097d267 0x0000\\n [ 21961 ] {} BaseDaemon: 0.0. inlined from /build/src/Common/StackTrace.cpp:349: StackTrace::tryCapture()\\n [ 21961 ] {} BaseDaemon: 0. /build/src/Common/StackTrace.cpp:318: StackTrace::StackTrace(ucontext_t const&) @ 0x000000000c681388\\n [ 21961 ] {} BaseDaemon: 1. /build/src/Common/SignalHandlers.cpp:0: signalHandler(int, siginfo_t*, void*) @ 0x000000000c8d475e\\n [ 21961 ] {} BaseDaemon: 2. ? @ 0x00007f89f8660520\\n [ 21961 ] {} BaseDaemon: 3. ? @ 0x00007f89f86b49fd\\n [ 21961 ] {} BaseDaemon: 4. ? @ 0x00007f89f8660476\\n [ 21961 ] {} BaseDaemon: 5. ? @ 0x00007f89f86467f3\\n [ 21961 ] {} BaseDaemon: 6. /build/src/Common/SignalHandlers.cpp:140: terminate_handler() @ 0x000000000c8d4d2e\\n [ 21961 ] {} BaseDaemon: 7. /build/contrib/llvm-project/libcxxabi/src/cxa_handlers.cpp:61: std::__terminate(void (*)()) @ 0x000000001855f883\\n [ 21961 ] {} BaseDaemon: 8. /build/contrib/llvm-project/libcxxabi/src/cxa_handlers.cpp:79: std::terminate() @ 0x000000001855f818\\n [ 21961 ] {} BaseDaemon: 9. /build/src/Storages/MergeTree/MergeTreeData.cpp:0: DB::MergeTreeData::loadOutdatedDataParts(bool) @ 0x00000000127abe0a\\n [ 21961 ] {} BaseDaemon: 10.0. inlined from /build/src/Common/Stopwatch.h:86: Stopwatch::nanoseconds() const\\n [ 21961 ] {} BaseDaemon: 10.1. inlined from /build/src/Common/Stopwatch.h:72: Stopwatch::elapsedNanoseconds() const\\n [ 21961 ] {} BaseDaemon: 10.2. inlined from /build/src/Common/Stopwatch.h:74: Stopwatch::elapsedMilliseconds() const\\n [ 21961 ] {} BaseDaemon: 10. /build/src/Core/BackgroundSchedulePool.cpp:113: DB::BackgroundSchedulePoolTaskInfo::execute() @ 0x000000001097a034\\n [ 21961 ] {} BaseDaemon: 11.0. inlined from /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: ~shared_ptr\\n [ 21961 ] {} BaseDaemon: 11. /build/src/Core/BackgroundSchedulePool.cpp:305: DB::BackgroundSchedulePool::threadFunction() @ 0x000000001097cc94\\n [ 21961 ] {} BaseDaemon: 12.0. inlined from /build/src/Core/BackgroundSchedulePool.cpp:0: operator()\\n [ 21961 ] {} BaseDaemon: 12.1. inlined from /build/contrib/llvm-project/libcxx/include/__functional/invoke.h:394: ?\\n [ 21961 ] {} BaseDaemon: 12.2. inlined from /build/contrib/llvm-project/libcxx/include/__functional/invoke.h:479: ?\\n [ 21961 ] {} BaseDaemon: 12.3. inlined from /build/contrib/llvm-project/libcxx/include/__functional/function.h:235: ?\\n [ 21961 ] {} BaseDaemon: 12. /build/contrib/llvm-project/libcxx/include/__functional/function.h:716: ? @ 0x000000001097d267\\n [ 21961 ] {} BaseDaemon: 13.0. inlined from /build/base/base/../base/wide_integer_impl.h:817: bool wide::integer<128ul, unsigned int>::_impl::operator_eq>(wide::integer<128ul, unsigned int> const&, wide::integer<128ul, unsigned int> const&)\\n [ 21961 ] {} BaseDaemon: 13.1. inlined from /build/base/base/../base/wide_integer_impl.h:1491: bool wide::operator==<128ul, unsigned int, 128ul, unsigned int>(wide::integer<128ul, unsigned int> const&, wide::integer<128ul, unsigned int> const&)\\n [ 21961 ] {} BaseDaemon: 13.2. inlined from /build/base/base/../base/strong_typedef.h:42: StrongTypedef, DB::UUIDTag>::operator==(StrongTypedef, DB::UUIDTag> const&) const\\n [ 21961 ] {} BaseDaemon: 13.3. inlined from /build/src/Common/OpenTelemetryTraceContext.h:65: DB::OpenTelemetry::Span::isTraceEnabled() const\\n [ 21961 ] {} BaseDaemon: 13. /build/src/Common/ThreadPool.cpp:789: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c707d2e\\n [ 21961 ] {} BaseDaemon: 14.0. inlined from /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: std::unique_ptr>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), Threa\\n [ 21961 ] {} BaseDaemon: 14.1. inlined from /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:259: ~unique_ptr\\n [ 21961 ] {} BaseDaemon: 14. /build/contrib/llvm-project/libcxx/include/thread:297: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImp\\n [ 21961 ] {} BaseDaemon: 15. ? @ 0x00007f89f86b2ac3\\n [ 21961 ] {} BaseDaemon: 16. ? @ 0x00007f89f87448d0\\n [ 21961 ] {} BaseDaemon: Integrity check of the executable successfully passed (checksum: 9E649BC96D94D019317B489C2F38D15D)\\n [ 21961 ] {} BaseDaemon: ClickHouse version 24.8.14.10546.altinitytest is old and should be upgraded to the latest version.\\n [ 21074 ] {} Application: Child process was terminated by signal 6.\\n [ 21080 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) Terminate called for uncaught exception:\\n [ 21080 ] {} BaseDaemon: Code: 999. Coordination::Exception: Session expired. (KEEPER_EXCEPTION), Stack trace (when copying this message, always include the lines below):\\n [ 21080 ] {} BaseDaemon: \\n [ 21080 ] {} BaseDaemon: 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164a1a32\\n [ 21080 ] {} BaseDaemon: 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c653179\\n [ 21080 ] {} BaseDaemon: 2. /build/contrib/llvm-project/libcxx/include/string:1499: _ZN12Coordination9ExceptionC2IRA16_KcQsr3stdE16is_convertible_vIT_NSt3__112basic_stringIcNS6_11char_traitsIcEENS6_9allocatorIcEEEEEEEOS5_NS_5ErrorE @ 0x00000000134a55fb\\n [ 21080 ] {} BaseDaemon: 3. /build/src/Common/ZooKeeper/IKeeper.h:0: Coordination::ZooKeeper::pushRequest(Coordination::ZooKeeper::RequestInfo&&) @ 0x00000000134ccdc2\\n [ 21080 ] {} BaseDaemon: 4. /build/src/Common/ZooKeeper/ZooKeeperImpl.cpp:1365: Coordination::ZooKeeper::exists(String const&, std::function, std::shared_ptr>) @ 0x00000000134cf245\\n [ 21080 ] {} BaseDaemon: 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347e7b8\\n [ 21080 ] {} BaseDaemon: 6. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347e3b9\\n [ 21080 ] {} BaseDaemon: 7. /build/src/Common/ZooKeeper/ZooKeeper.cpp:598: zkutil::ZooKeeper::existsWatch(String const&, Coordination::Stat*, std::function) @ 0x000000001347e973\\n [ 21080 ] {} BaseDaemon: 8. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x000000001347c488\\n [ 21080 ] {} BaseDaemon: 9. /build/src/Storages/StorageReplicatedMergeTree.cpp:0: DB::StorageReplicatedMergeTree::forcefullyRemoveBrokenOutdatedPartFromZooKeeperBeforeDetaching(String const&) @ 0x000000001241f508\\n [ 21080 ] {} BaseDaemon: 10. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: void std::__function::__policy_invoker::__call_impl>(std::__function::__policy_stor\\n [ 21080 ] {} BaseDaemon: 11. /build/contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001041557a\\n [ 21080 ] {} BaseDaemon: 12. /build/contrib/llvm-project/libcxx/include/future:2069: std::packaged_task::operator()() @ 0x000000000cbaa497\\n [ 21080 ] {} BaseDaemon: 13. /build/src/Common/ThreadPool.cpp:781: ThreadPoolImpl>::ThreadFromThreadPool::worker() @ 0x000000000c709f9f\\n [ 21080 ] {} BaseDaemon: 14. /build/contrib/llvm-project/libcxx/include/__functional/invoke.h:0: ? @ 0x000000000c70f122\\n [ 21080 ] {} BaseDaemon: 15. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c707d2e\\n [ 21080 ] {} BaseDaemon: 16. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)()\\n [ 21080 ] {} BaseDaemon: 17. ? @ 0x00007f89f86b2ac3\\n [ 21080 ] {} BaseDaemon: 18. ? @ 0x00007f89f87448d0\\n [ 21080 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build))\\n [ 21961 ] {} BaseDaemon: ########## Short fault info ############\\n [ 21961 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) Received signal 6\\n [ 21961 ] {} BaseDaemon: Signal description: Aborted\\n [ 21961 ] {} BaseDaemon: \\n [ 21961 ] {} BaseDaemon: Stack trace: 0x000000000c681388 0x000000000c8d475e 0x00007f89f8660520 0x00007f89f86b49fd 0x00007f89f8660476 0x00007f89f86467f3 0x000000000c8d4d2e 0x000000001855f883 0x000000001855f818 0x00000000127abe0a 0x000000001097a034 0x000000001097cc94 0x000000001097d267 0x0000\\n [ 21961 ] {} BaseDaemon: ########################################\\n [ 21961 ] {} BaseDaemon: (version 24.8.14.10546.altinitytest (altinity build), build id: B60A50EC378B255BCB1BCE3E8293DB3AF7C1EF26, git hash: 6a78805ec9737295beb4a8d213873fb4093d11eb) (from thread 21591) (no query) Received signal Aborted (6)\\n [ 21961 ] {} BaseDaemon: \\n [ 21961 ] {} BaseDaemon: Stack trace: 0x000000000c681388 0x000000000c8d475e 0x00007f89f8660520 0x00007f89f86b49fd 0x00007f89f8660476 0x00007f89f86467f3 0x000000000c8d4d2e 0x000000001855f883 0x000000001855f818 0x00000000127abe0a 0x000000001097a034 0x000000001097cc94 0x000000001097d267 0x0000\\n [ 21961 ] {} BaseDaemon: 0.0. inlined from /build/src/Common/StackTrace.cpp:349: StackTrace::tryCapture()\\n' + '[' -s /test_output/fatal_messages.txt ']' + rg -Faz '########################################' /test_output/fatal_messages.txt /test_output/gdb.log /test_output/stress_run_logs.tar.zst /test_output/test_results.tsv + echo -e 'Killed by signal (output files)\tFAIL\t\N\t' + rg -Fa ' received signal ' /test_output/gdb.log ++ get_gdb_log_context ++ rg -A50 -Fa ' received signal ' /test_output/gdb.log ++ head_escaped ++ head -n 100 '' ++ escaped ++ clickhouse local -S 's String' --input-format=LineAsString -q 'select substr(s, 1, 300) from table format CustomSeparated settings format_custom_row_after_delimiter='\''\\\\n'\''' head: cannot open '' for reading: No such file or directory + echo -e 'Found signal in gdb.log\tFAIL\t\N\t' + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + collect_query_and_trace_logs + for table in query_log trace_log metric_log + zstd --threads=0 + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.query_log format TSVWithNamesAndTypes' Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [06/Jul/2026:22:29:33 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + for table in query_log trace_log metric_log + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.trace_log format TSVWithNamesAndTypes' + zstd --threads=0 Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [06/Jul/2026:22:29:36 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + for table in query_log trace_log metric_log + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.metric_log format TSVWithNamesAndTypes' + zstd --threads=0 Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [06/Jul/2026:22:29:38 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + mv /var/log/clickhouse-server/stderr.log /test_output/ + clickhouse-local --structure 'test String, res String, time Nullable(Float32), desc String' -q 'SELECT '\''failure'\'', test FROM table WHERE res != '\''OK'\'' order by (test like '\''%Sanitizer%'\'') DESC, (test like '\''%Killed by signal%'\'') DESC, (test like '\''%gdb.log%'\'') DESC, (test ilike '\''%possible deadlock%'\'') DESC, (test like '\''%start%'\'') DESC, (test like '\''%dmesg%'\'') DESC, (test like '\''%OOM%'\'') DESC, (test like '\''%Signal 9%'\'') DESC, (test like '\''%Fatal message%'\'') DESC, rowNumberInAllBlocks() LIMIT 1' + '[' -s /test_output/check_status.tsv ']' + rg 'OOM in dmesg|Signal 9' /test_output/check_status.tsv + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core