+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=America/Punta_Arenas
+ echo 'Chosen random timezone America/Punta_Arenas'
+ ln -snf /usr/share/zoneinfo/America/Punta_Arenas /etc/localtime
Chosen random timezone America/Punta_Arenas
+ echo America/Punta_Arenas
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48426 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10502.altinitytest) ...
Setting up clickhouse-common-static (24.8.14.10502.altinitytest) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48453 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10502.altinitytest) ...
Setting up clickhouse-common-static-dbg (24.8.14.10502.altinitytest) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48460 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10502.altinitytest) ...
Setting up clickhouse-odbc-bridge (24.8.14.10502.altinitytest) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48466 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10502.altinitytest) ...
Setting up clickhouse-library-bridge (24.8.14.10502.altinitytest) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48472 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10502.altinitytest) ...
Setting up clickhouse-server (24.8.14.10502.altinitytest) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10502.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48489 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10502.altinitytest_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10502.altinitytest) ...
Setting up clickhouse-client (24.8.14.10502.altinitytest) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10502.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=1
+ sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=65179648
+ sed --follow-symlinks -i 's|[[:digit:]]\+|65179648|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=8056832
+ sed --follow-symlinks -i 's|[[:digit:]]\+|8056832|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ ./minio server --address :11111 ./minio_data
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:46469 http://127.0.0.1:46469
Docs: https://min.io/docs/minio/linux/index.html
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./18916D9C36CDDFF37dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 293 root 8u IPv6 36700 0t0 TCP *:11111 (LISTEN)
minio 293 root 9u IPv4 36699 0t0 TCP localhost:11111 (LISTEN)
minio 293 root 10u IPv6 36701 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 90.81 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Feb 5 15:37 .
drwxr-xr-x 1 root root 4.0K Feb 5 15:37 ..
-rw-rw-r-- 1 1000 1000 119 Feb 5 15:33 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Feb 5 15:37 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Feb 5 15:37 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Feb 5 15:37 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Feb 5 15:37 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 5 15:33 broken_tests.json
drwxr-xr-x 14 root root 3.8K Feb 5 15:36 dev
-rwxr-xr-x 1 root root 0 Feb 5 15:36 .dockerenv
drwxr-xr-x 1 root root 4.0K Feb 5 15:37 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jan 31 2025 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jan 31 2025 minio
drwxr-xr-x 4 root root 4.0K Feb 5 15:37 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Feb 5 15:36 package_folder
dr-xr-xr-x 313 root root 0 Feb 5 15:36 proc
-rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
drwx------ 1 root root 4.0K Feb 5 15:37 root
drwxr-xr-x 1 root root 4.0K Feb 5 15:37 run
-rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 5 15:36 sys
drwxrwxr-x 2 1000 1000 4.0K Feb 5 15:36 test_output
drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 428 clickhouse 322u IPv4 23357 0t0 TCP localhost:12222 (LISTEN)
java 428 clickhouse 544u IPv4 37081 0t0 TCP localhost:35804->localhost:12222 (ESTABLISHED)
java 428 clickhouse 545u IPv4 33064 0t0 TCP localhost:12222->localhost:35804 (ESTABLISHED)
java 428 clickhouse 553u IPv4 34165 0t0 TCP localhost:35810->localhost:12222 (ESTABLISHED)
java 428 clickhouse 554u IPv4 33066 0t0 TCP localhost:12222->localhost:35810 (ESTABLISHED)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "PUT /devstoreaccount1/cont/twmzowemfzflnhbyinbkgyctkbtjdqev HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "GET /devstoreaccount1/cont/twmzowemfzflnhbyinbkgyctkbtjdqev HTTP/1.1" 206 4
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "GET /devstoreaccount1/cont/twmzowemfzflnhbyinbkgyctkbtjdqev HTTP/1.1" 206 2
127.0.0.1 - - [05/Feb/2026:18:37:44 +0000] "DELETE /devstoreaccount1/cont/twmzowemfzflnhbyinbkgyctkbtjdqev HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=0
+ [[ 0 = \1 ]]
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
info registers
p top' 1 KiB of the 'stack:
p/x *(uint64_t[128]*)$sp
maintenance info sections
thread apply all backtrace full
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 624
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
clickminio restart attempt 1:
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:40545 http://127.0.0.1:40545
Docs: https://min.io/docs/minio/linux/index.html
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
Output of restart status: success
success
Restarted clickminio successfully.
+ echo 'Restarted clickminio successfully.'
+ break
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1512
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ YES = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-coverage')
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --report-coverage --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2026-02-05 15:37:52 Using queries from '/usr/share/clickhouse-test/queries' directory
2026-02-05 15:37:52 Connecting to ClickHouse server... OK
2026-02-05 15:37:52 Connected to server 24.8.14.10502.altinitytest @ b3ee55ac13ee859c115e17f58c8c96a657aaafe2 HEAD
2026-02-05 15:37:53 Found 6509 parallel tests and 571 sequential tests
2026-02-05 15:37:53 Running about 813 stateless tests (Process-5).
2026-02-05 15:37:53 02994_cosineDistanceNullable: [ OK ] 0.17 sec.
2026-02-05 15:37:53 Running about 813 stateless tests (Process-4).
2026-02-05 15:37:53 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.17 sec.
2026-02-05 15:37:53 Running about 813 stateless tests (Process-8).
2026-02-05 15:37:53 02295_global_with_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:37:53 Running about 813 stateless tests (Process-6).
2026-02-05 15:37:53 02713_sequence_match_serialization_fix: [ OK ] 0.22 sec.
2026-02-05 15:37:53 Running about 813 stateless tests (Process-10).
2026-02-05 15:37:53 01506_buffer_table_alter_block_structure: [ OK ] 0.22 sec.
2026-02-05 15:37:53 Running about 813 stateless tests (Process-9).
2026-02-05 15:37:53 01440_big_int_arithm: [ OK ] 0.32 sec.
2026-02-05 15:37:53 02731_in_operator_with_one_size_tuple: [ OK ] 0.17 sec.
2026-02-05 15:37:53 02844_distributed_virtual_columns: [ OK ] 0.17 sec.
2026-02-05 15:37:53 03041_select_with_query_result: [ OK ] 0.17 sec.
2026-02-05 15:37:53 02473_map_element_nullable: [ OK ] 0.17 sec.
2026-02-05 15:37:53 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.12 sec.
2026-02-05 15:37:53 01375_GROUP_BY_injective_elimination_dictGet_BAD_ARGUMENTS: [ OK ] 0.12 sec.
2026-02-05 15:37:53 02699_polygons_sym_difference_rollup: [ OK ] 0.17 sec.
2026-02-05 15:37:53 00752_low_cardinality_mv_1: [ OK ] 0.22 sec.
2026-02-05 15:37:53 01881_create_as_tuple: [ OK ] 0.22 sec.
2026-02-05 15:37:54 03213_rand_dos: [ OK ] 0.17 sec.
2026-02-05 15:37:54 Running about 813 stateless tests (Process-7).
2026-02-05 15:37:54 01245_distributed_group_by_no_merge_with-extremes_and_totals: [ OK ] 0.87 sec.
2026-02-05 15:37:54 00562_in_subquery_merge_tree: [ OK ] 0.27 sec.
2026-02-05 15:37:54 02111_with_fill_no_rows: [ OK ] 0.18 sec.
2026-02-05 15:37:54 03221_mutate_profile_events: [ OK ] 0.42 sec.
2026-02-05 15:37:54 01666_blns_long: [ OK ] 0.73 sec.
2026-02-05 15:37:54 00140_parse_unix_timestamp_as_datetime: [ OK ] 0.27 sec.
2026-02-05 15:37:54 02377_modify_column_from_lc: [ OK ] 0.32 sec.
2026-02-05 15:37:54 02863_decode_html_component: [ OK ] 0.22 sec.
2026-02-05 15:37:54 03162_dynamic_type_nested: [ OK ] 0.17 sec.
2026-02-05 15:37:54 02905_show_setting_query: [ OK ] 0.17 sec.
2026-02-05 15:37:54 00812_prewhere_alias_array: [ OK ] 0.17 sec.
2026-02-05 15:37:54 01668_avg_weighted_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:37:54 01890_state_of_state: [ OK ] 0.27 sec.
2026-02-05 15:37:54 01840_tupleElement_formatting_fuzzer: [ OK ] 0.17 sec.
2026-02-05 15:37:54 01457_order_by_nulls_first: [ OK ] 0.32 sec.
2026-02-05 15:37:54 00661_array_has_silviucpp: [ OK ] 0.17 sec.
2026-02-05 15:37:54 03204_storage_join_optimize: [ OK ] 0.17 sec.
2026-02-05 15:37:55 00209_insert_select_extremes: [ OK ] 0.22 sec.
2026-02-05 15:37:55 01646_rewrite_sum_if_bug: [ OK ] 0.22 sec.
2026-02-05 15:37:55 02366_kql_func_string: [ OK ] 1.27 sec.
2026-02-05 15:37:55 01056_create_table_as: [ OK ] 0.27 sec.
2026-02-05 15:37:55 02882_formatQuery: [ OK ] 0.32 sec.
2026-02-05 15:37:55 01710_projection_external_aggregate: [ OK ] 0.27 sec.
2026-02-05 15:37:55 03168_query_log_privileges_not_empty: [ OK ] 2.08 sec.
2026-02-05 15:37:55 00716_allow_ddl: [ OK ] 0.17 sec.
2026-02-05 15:37:55 02706_arrow_different_dictionaries: [ OK ] 0.57 sec.
2026-02-05 15:37:55 02911_cte_invalid_query_analysis: [ OK ] 0.22 sec.
2026-02-05 15:37:55 00531_client_ignore_error: [ OK ] 0.83 sec.
2026-02-05 15:37:56 01097_one_more_range_reader_test: [ OK ] 0.17 sec.
2026-02-05 15:37:56 02935_external_table_enum_type: [ OK ] 1.52 sec.
2026-02-05 15:37:56 02010_lc_native: [ OK ] 1.07 sec.
2026-02-05 15:37:56 02242_make_date: [ OK ] 0.52 sec.
2026-02-05 15:37:56 02711_soundex_function: [ OK ] 0.27 sec.
2026-02-05 15:37:56 01562_agg_null_for_empty_ahead: [ OK ] 0.22 sec.
2026-02-05 15:37:56 02184_storage_add_support_ttl: [ OK ] 0.22 sec.
2026-02-05 15:37:56 00612_shard_count: [ OK ] 0.22 sec.
2026-02-05 15:37:56 02456_bloom_filter_assert: [ OK ] 0.32 sec.
2026-02-05 15:37:56 03110_unicode_alias: [ OK ] 0.17 sec.
2026-02-05 15:37:56 02004_invalid_partition_mutation_stuck: [ OK ] 0.27 sec.
2026-02-05 15:37:56 00926_adaptive_index_granularity_replacing_merge_tree: [ OK ] 1.07 sec.
2026-02-05 15:37:57 02149_issue_32487: [ OK ] 0.22 sec.
2026-02-05 15:37:57 00098_2_union_all: [ OK ] 0.17 sec.
2026-02-05 15:37:57 01632_select_all_syntax: [ OK ] 0.22 sec.
2026-02-05 15:37:57 02797_aggregator_huge_mem_usage_bug: [ OK ] 0.67 sec.
2026-02-05 15:37:57 00948_values_interpreter_template: [ OK ] 0.22 sec.
2026-02-05 15:37:57 02495_analyzer_storage_join: [ OK ] 0.47 sec.
2026-02-05 15:37:57 01114_clear_column_compact_parts: [ OK ] 0.17 sec.
2026-02-05 15:37:58 02688_long_aggregate_function_names: [ OK ] 0.17 sec.
2026-02-05 15:37:58 00563_complex_in_expression: [ OK ] 0.22 sec.
2026-02-05 15:37:58 01068_window_view_event_tumble_to_bounded_lateness: [ OK ] 1.27 sec.
2026-02-05 15:37:58 00802_system_parts_with_datetime_partition: [ OK ] 0.32 sec.
2026-02-05 15:37:58 02151_lc_prefetch: [ OK ] 2.49 sec.
2026-02-05 15:37:58 01505_log_distributed_deadlock: [ OK ] 0.17 sec.
2026-02-05 15:37:58 00322_disable_checksumming: [ OK ] 0.42 sec.
2026-02-05 15:37:58 02559_add_parts: [ OK ] 0.22 sec.
2026-02-05 15:37:59 01566_negate_formatting: [ OK ] 0.17 sec.
2026-02-05 15:37:59 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.17 sec.
2026-02-05 15:37:59 Running about 813 stateless tests (Process-3).
2026-02-05 15:37:59 02995_index_3: [ OK ] 5.89 sec.
2026-02-05 15:37:59 02021_h3_is_res_classIII: [ OK ] 0.22 sec.
2026-02-05 15:37:59 01196_max_parser_depth: [ OK ] 0.62 sec.
2026-02-05 15:37:59 01710_projection_aggregation_in_order: [ OK ] 0.32 sec.
2026-02-05 15:37:59 00574_empty_strings_deserialization: [ OK ] 1.27 sec.
2026-02-05 15:37:59 00709_virtual_column_partition_id: [ OK ] 0.22 sec.
2026-02-05 15:37:59 02833_window_func_range_offset: [ OK ] 0.17 sec.
2026-02-05 15:37:59 02001_shard_num_shard_count: [ OK ] 0.17 sec.
2026-02-05 15:37:59 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.22 sec.
2026-02-05 15:37:59 01551_context_uaf: [ OK ] 0.17 sec.
2026-02-05 15:37:59 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.17 sec.
2026-02-05 15:37:59 02310_generate_multi_columns_with_uuid: [ OK ] 0.17 sec.
2026-02-05 15:37:59 01913_quantile_deterministic: [ OK ] 3.68 sec.
2026-02-05 15:37:59 03166_skip_indexes_vertical_merge_2: [ OK ] 0.42 sec.
2026-02-05 15:37:59 03276_empty_variant_type: [ OK ] 0.12 sec.
2026-02-05 15:37:59 00642_cast: [ OK ] 0.22 sec.
2026-02-05 15:38:00 00531_aggregate_over_nullable: [ OK ] 0.22 sec.
2026-02-05 15:38:00 02843_context_has_expired: [ OK ] 0.27 sec.
2026-02-05 15:38:00 03035_recursive_cte_postgres_1: [ OK ] 0.27 sec.
2026-02-05 15:38:00 00035_function_array_return_type: [ OK ] 0.17 sec.
2026-02-05 15:38:00 02429_offset_pipeline_stuck_bug: [ OK ] 0.17 sec.
2026-02-05 15:38:00 00480_mac_addresses: [ OK ] 0.17 sec.
2026-02-05 15:38:00 03217_json_merge_patch_stack_overflow: [ OK ] 0.37 sec.
2026-02-05 15:38:00 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:38:00 02783_max_bytes_to_read_in_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:38:00 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 1.32 sec.
2026-02-05 15:38:00 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.42 sec.
2026-02-05 15:38:00 00356_analyze_aggregations_and_union_all: [ OK ] 0.17 sec.
2026-02-05 15:38:00 01323_add_scalars_in_time: [ OK ] 0.27 sec.
2026-02-05 15:38:00 00027_distinct_and_order_by: [ OK ] 0.17 sec.
2026-02-05 15:38:00 02661_read_from_archive_tarxz: [ OK ] 5.34 sec.
2026-02-05 15:38:00 02884_parquet_new_encodings: [ OK ] 0.57 sec.
2026-02-05 15:38:01 00847_multiple_join_same_column: [ OK ] 0.27 sec.
2026-02-05 15:38:01 02122_parallel_formatting_CSVWithNames: [ OK ] 1.22 sec.
2026-02-05 15:38:01 01883_with_grouping_sets: [ OK ] 0.22 sec.
2026-02-05 15:38:01 02521_to_custom_day_of_week: [ OK ] 0.22 sec.
2026-02-05 15:38:01 01457_min_index_granularity_bytes_setting: [ OK ] 0.22 sec.
2026-02-05 15:38:01 01341_datetime64_wrong_supertype: [ OK ] 0.12 sec.
2026-02-05 15:38:01 01319_optimize_skip_unused_shards_nesting: [ OK ] 0.27 sec.
2026-02-05 15:38:01 00872_t64_bit_codec: [ OK ] 0.82 sec.
2026-02-05 15:38:01 02422_insert_different_granularity: [ OK ] 0.37 sec.
2026-02-05 15:38:01 03093_analyzer_column_alias: [ OK ] 0.22 sec.
2026-02-05 15:38:01 02963_msan_agg_addBatchLookupTable8: [ OK ] 0.17 sec.
2026-02-05 15:38:01 02316_cast_to_ip_address_default_column: [ OK ] 0.27 sec.
2026-02-05 15:38:01 00621_regression_for_in_operator: [ OK ] 0.32 sec.
2026-02-05 15:38:01 02946_format_values: [ OK ] 0.67 sec.
2026-02-05 15:38:01 02579_fill_empty_chunk: [ OK ] 0.17 sec.
2026-02-05 15:38:01 02884_interval_operator_support_plural_literal: [ OK ] 0.22 sec.
2026-02-05 15:38:02 02930_client_file_log_comment: [ OK ] 0.93 sec.
2026-02-05 15:38:02 01674_where_prewhere_array_crash: [ OK ] 0.17 sec.
2026-02-05 15:38:02 01319_manual_write_to_replicas_long: [ OK ] 0.32 sec.
2026-02-05 15:38:02 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.17 sec.
2026-02-05 15:38:02 00701_rollup: [ OK ] 0.27 sec.
2026-02-05 15:38:02 02771_multiple_query_arguments: [ OK ] 1.68 sec.
2026-02-05 15:38:02 03210_dynamic_squashing: [ OK ] 0.57 sec.
2026-02-05 15:38:02 00556_remove_columns_from_subquery: [ OK ] 0.17 sec.
2026-02-05 15:38:02 02354_read_in_order_prewhere: [ OK ] 0.57 sec.
2026-02-05 15:38:02 03008_deduplication_cases_from_docs: [ OK ] 0.52 sec.
2026-02-05 15:38:02 01263_type_conversion_nvartolomei: [ OK ] 0.27 sec.
2026-02-05 15:38:03 01457_compile_expressions_fuzzer: [ OK ] 0.17 sec.
2026-02-05 15:38:03 00725_join_on_bug_2: [ OK ] 0.27 sec.
2026-02-05 15:38:03 02766_prql: [ OK ] 0.77 sec.
2026-02-05 15:38:03 01386_negative_float_constant_key_condition: [ OK ] 0.22 sec.
2026-02-05 15:38:03 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.27 sec.
2026-02-05 15:38:03 03148_query_log_used_dictionaries: [ OK ] 0.42 sec.
2026-02-05 15:38:03 02932_apply_deleted_mask: [ OK ] 0.42 sec.
2026-02-05 15:38:03 02030_tuple_filter: [ OK ] 0.37 sec.
2026-02-05 15:38:03 03003_database_filesystem_format_detection: [ OK ] 0.62 sec.
2026-02-05 15:38:03 00679_uuid_in_key: [ OK ] 0.22 sec.
2026-02-05 15:38:04 02477_analyzer_ast_key_condition_crash: [ OK ] 0.22 sec.
2026-02-05 15:38:04 02488_zero_copy_detached_parts_drop_table: [ OK ] 2.08 sec.
2026-02-05 15:38:04 02296_nullable_arguments_in_array_filter: [ OK ] 0.17 sec.
2026-02-05 15:38:04 01053_drop_database_mat_view: [ OK ] 0.27 sec.
2026-02-05 15:38:04 02717_pretty_json: [ OK ] 0.22 sec.
2026-02-05 15:38:04 00757_enum_defaults: [ OK ] 0.27 sec.
2026-02-05 15:38:04 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:38:04 03081_analyzer_agg_func_CTE: [ OK ] 0.27 sec.
2026-02-05 15:38:04 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.22 sec.
2026-02-05 15:38:04 02885_async_insert_access_check_for_defaults: [ OK ] 2.28 sec.
2026-02-05 15:38:04 02165_h3_edge_length_km: [ OK ] 0.28 sec.
2026-02-05 15:38:05 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.47 sec.
2026-02-05 15:38:05 02233_with_total_empty_chunk: [ OK ] 0.17 sec.
2026-02-05 15:38:05 02584_range_ipv4: [ OK ] 0.22 sec.
2026-02-05 15:38:05 02210_processors_profile_log: [ OK ] 1.33 sec.
2026-02-05 15:38:05 01359_codeql: [ OK ] 0.17 sec.
2026-02-05 15:38:06 01470_columns_transformers: [ OK ] 0.37 sec.
2026-02-05 15:38:06 02124_uncompressed_cache: [ OK ] 0.22 sec.
2026-02-05 15:38:06 00726_length_aliases: [ OK ] 0.17 sec.
2026-02-05 15:38:06 01078_merge_tree_read_one_thread: [ OK ] 1.32 sec.
2026-02-05 15:38:06 02920_fix_json_merge_patch: [ OK ] 0.22 sec.
2026-02-05 15:38:07 03013_repeat_with_nonnative_integers: [ OK ] 0.17 sec.
2026-02-05 15:38:07 00368_format_option_collision: [ OK ] 0.62 sec.
2026-02-05 15:38:07 02513_analyzer_sort_msan: [ OK ] 0.23 sec.
2026-02-05 15:38:08 02901_predicate_pushdown_cte_stateful: [ OK ] 0.17 sec.
2026-02-05 15:38:08 03249_dynamic_alter_consistency: [ OK ] 0.72 sec.
2026-02-05 15:38:09 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.23 sec.
2026-02-05 15:38:09 02420_final_setting_analyzer: [ OK ] 0.47 sec.
2026-02-05 15:38:10 01684_geohash_ubsan: [ OK ] 0.52 sec.
2026-02-05 15:38:10 01911_logical_error_minus: [ OK ] 0.32 sec.
2026-02-05 15:38:10 02204_fractional_progress_bar_long: [ OK ] 6.30 sec.
2026-02-05 15:38:11 01373_summing_merge_tree_exclude_partition_key: [ OK ] 0.62 sec.
2026-02-05 15:38:11 03216_arrayWithConstant_limits: [ OK ] 6.95 sec.
2026-02-05 15:38:11 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.17 sec.
2026-02-05 15:38:11 01686_rocksdb: [ OK ] 0.37 sec.
2026-02-05 15:38:11 01119_optimize_trivial_insert_select: [ OK ] 0.28 sec.
2026-02-05 15:38:11 02969_archive_seek: [ OK ] 0.62 sec.
2026-02-05 15:38:11 03213_denseRank_percentRank_alias: [ OK ] 0.22 sec.
2026-02-05 15:38:11 01753_optimize_aggregation_in_order: [ OK ] 0.62 sec.
2026-02-05 15:38:12 01571_window_functions: [ OK ] 0.27 sec.
2026-02-05 15:38:12 00906_low_cardinality_rollup: [ OK ] 0.27 sec.
2026-02-05 15:38:12 00671_max_intersections: [ OK ] 0.22 sec.
2026-02-05 15:38:12 02701_non_parametric_function: [ OK ] 0.12 sec.
2026-02-05 15:38:12 01825_type_json_missed_values: [ OK ] 0.32 sec.
2026-02-05 15:38:12 00719_parallel_ddl_db: [ OK ] 11.36 sec.
2026-02-05 15:38:12 01020_function_array_compact: [ OK ] 0.17 sec.
2026-02-05 15:38:13 02942_variant_cast: [ OK ] 0.32 sec.
2026-02-05 15:38:13 01260_ubsan_decimal_parse: [ OK ] 0.17 sec.
2026-02-05 15:38:13 00987_distributed_stack_overflow: [ OK ] 0.17 sec.
2026-02-05 15:38:13 02905_csv_unquoted_string_with_cr: [ OK ] 1.22 sec.
2026-02-05 15:38:13 00041_aggregation_remap: [ OK ] 0.34 sec.
2026-02-05 15:38:13 03142_alter_comment_parameterized_view: [ OK ] 0.22 sec.
2026-02-05 15:38:14 02516_join_with_totals_and_subquery_bug: [ OK ] 0.22 sec.
2026-02-05 15:38:14 02592_avro_records_with_same_names: [ OK ] 0.58 sec.
2026-02-05 15:38:14 02377_fix_file_virtual_column: [ OK ] 0.22 sec.
2026-02-05 15:38:14 00010_big_array_join: [ OK ] 0.17 sec.
2026-02-05 15:38:14 00199_ternary_operator_type_check: [ OK ] 0.37 sec.
2026-02-05 15:38:15 03164_adapting_parquet_reader_output_size: [ OK ] 0.92 sec.
2026-02-05 15:38:15 00756_power_alias: [ OK ] 0.17 sec.
2026-02-05 15:38:15 01276_system_licenses: [ OK ] 0.17 sec.
2026-02-05 15:38:15 02381_arrow_dict_of_nullable_string_to_lc: [ OK ] 0.52 sec.
2026-02-05 15:38:16 03268_empty_tuple_update: [ OK ] 0.22 sec.
2026-02-05 15:38:16 02764_csv_trim_whitespaces: [ OK ] 13.02 sec.
2026-02-05 15:38:16 03008_groupSortedArray_field: [ OK ] 0.17 sec.
2026-02-05 15:38:16 02719_aggregate_with_empty_string_key: [ OK ] 0.22 sec.
2026-02-05 15:38:16 02797_range_nullable: [ OK ] 0.27 sec.
2026-02-05 15:38:16 02293_optimize_aggregation_in_order_Array_functions: [ OK ] 0.17 sec.
2026-02-05 15:38:17 00273_quantiles: [ OK ] 0.32 sec.
2026-02-05 15:38:17 02450_kill_distributed_query_deadlock: [ OK ] 12.27 sec.
2026-02-05 15:38:17 02481_array_join_with_map: [ OK ] 0.17 sec.
2026-02-05 15:38:17 01595_countMatches: [ OK ] 0.27 sec.
2026-02-05 15:38:17 00718_format_datetime_1: [ OK ] 0.17 sec.
2026-02-05 15:38:18 02874_array_random_sample: [ OK ] 5.09 sec.
2026-02-05 15:38:18 01169_alter_partition_isolation_stress: [ OK ] 11.67 sec.
2026-02-05 15:38:18 02096_join_unusual_identifier_begin: [ OK ] 0.17 sec.
2026-02-05 15:38:18 02015_async_inserts_7: [ OK ] 0.92 sec.
2026-02-05 15:38:18 01673_test_toMinute_mysql_dialect: [ OK ] 0.17 sec.
2026-02-05 15:38:19 02875_show_functions: [ OK ] 0.82 sec.
2026-02-05 15:38:19 01881_join_on_conditions_merge: [ OK ] 0.77 sec.
2026-02-05 15:38:19 01710_aggregate_projection_with_hashing: [ OK ] 0.17 sec.
2026-02-05 15:38:19 02834_timestamp_function: [ OK ] 0.27 sec.
2026-02-05 15:38:19 01648_normalize_query_keep_names: [ OK ] 0.18 sec.
2026-02-05 15:38:19 01936_quantiles_cannot_return_null: [ OK ] 0.24 sec.
2026-02-05 15:38:19 02165_insert_from_infile: [ OK ] 0.22 sec.
2026-02-05 15:38:19 02417_opentelemetry_insert_on_distributed_table: [ OK ] 3.70 sec.
2026-02-05 15:38:20 02874_json_merge_patch_function_test: [ OK ] 0.28 sec.
2026-02-05 15:38:20 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.22 sec.
2026-02-05 15:38:20 03055_analyzer_subquery_group_array: [ OK ] 0.17 sec.
2026-02-05 15:38:20 02158_interval_length_sum: [ OK ] 0.18 sec.
2026-02-05 15:38:20 01851_hedged_connections_external_tables: [ OK ] 0.22 sec.
2026-02-05 15:38:20 02337_check_translate_qualified_names_matcher: [ OK ] 0.23 sec.
2026-02-05 15:38:20 01795_TinyLog_rwlock_ub: [ OK ] 0.17 sec.
2026-02-05 15:38:20 01611_string_to_low_cardinality_key_alter: [ OK ] 0.37 sec.
2026-02-05 15:38:20 01949_heredoc_unfinished: [ OK ] 0.58 sec.
2026-02-05 15:38:21 02128_wait_end_of_query_fix: [ OK ] 0.58 sec.
2026-02-05 15:38:21 02998_operator_respect_nulls: [ OK ] 0.17 sec.
2026-02-05 15:38:21 02320_alter_columns_with_dots: [ OK ] 0.32 sec.
2026-02-05 15:38:22 01291_aggregation_in_order: [ OK ] 0.42 sec.
2026-02-05 15:38:22 01721_constraints_constant_expressions: [ OK ] 0.29 sec.
2026-02-05 15:38:22 01061_alter_codec_with_type: [ OK ] 0.23 sec.
2026-02-05 15:38:23 01769_extended_range_2: [ OK ] 0.33 sec.
2026-02-05 15:38:23 03167_base64_url_functions_sh: [ OK ] 27.39 sec.
2026-02-05 15:38:23 03164_linestring_geometry: [ OK ] 0.23 sec.
2026-02-05 15:38:23 02705_settings_check_changed_flag: [ OK ] 0.43 sec.
2026-02-05 15:38:24 01716_drop_rename_sign_column: [ OK ] 0.29 sec.
2026-02-05 15:38:24 01605_dictinct_two_level: [ OK ] 0.28 sec.
2026-02-05 15:38:24 02185_orc_corrupted_file: [ OK ] 0.67 sec.
2026-02-05 15:38:24 00873_t64_codec_date: [ OK ] 0.27 sec.
2026-02-05 15:38:25 02703_explain_query_tree_is_forbidden_with_old_analyzer: [ OK ] 0.18 sec.
2026-02-05 15:38:25 03021_output_format_tty: [ OK ] 0.73 sec.
2026-02-05 15:38:26 00961_checksums_in_system_parts_columns_table: [ OK ] 0.27 sec.
2026-02-05 15:38:26 01361_buffer_table_flush_with_materialized_view: [ OK ] 0.32 sec.
2026-02-05 15:38:26 02305_schema_inference_with_globs: [ OK ] 2.11 sec.
2026-02-05 15:38:26 02834_add_sub_date_functions: [ OK ] 0.38 sec.
2026-02-05 15:38:27 02456_progress_tty: [ OK ] 9.09 sec.
2026-02-05 15:38:27 02515_distinct_zero_size_key_bug_44831: [ OK ] 0.17 sec.
2026-02-05 15:38:27 02236_explain_pipeline_join: [ OK ] 0.23 sec.
2026-02-05 15:38:27 00309_formats: [ OK ] 0.23 sec.
2026-02-05 15:38:27 03013_test_part_level_is_reset_attach_from_disk_mt: [ OK ] 0.37 sec.
2026-02-05 15:38:27 01509_format_raw_blob: [ OK ] 1.35 sec.
2026-02-05 15:38:28 01866_view_persist_settings: [ OK ] 0.72 sec.
2026-02-05 15:38:28 00968_roundAge: [ OK ] 0.23 sec.
2026-02-05 15:38:28 01183_custom_separated_format_http: [ OK ] 7.96 sec.
2026-02-05 15:38:28 01076_predicate_optimizer_with_view: [ OK ] 0.29 sec.
2026-02-05 15:38:29 00580_cast_nullable_to_non_nullable: [ OK ] 0.17 sec.
2026-02-05 15:38:29 02129_add_column_add_ttl: [ OK ] 0.38 sec.
2026-02-05 15:38:29 02832_integer_type_inference: [ OK ] 0.23 sec.
2026-02-05 15:38:29 00552_or_nullable: [ OK ] 0.24 sec.
2026-02-05 15:38:29 03030_system_flush_distributed_settings: [ OK ] 1.50 sec.
2026-02-05 15:38:29 02124_buffer_with_type_map_long: [ OK ] 10.90 sec.
2026-02-05 15:38:29 01909_mbtolou: [ OK ] 0.24 sec.
2026-02-05 15:38:29 03165_order_by_duplicate: [ OK ] 0.18 sec.
2026-02-05 15:38:29 02313_dump_column_structure_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:38:29 00688_low_cardinality_syntax: [ OK ] 0.37 sec.
2026-02-05 15:38:30 01810_max_part_removal_threads_long: [ OK ] 2.61 sec.
2026-02-05 15:38:30 02900_date_time_check_overflow: [ OK ] 0.52 sec.
2026-02-05 15:38:30 00717_low_cardinaliry_distributed_group_by: [ OK ] 0.87 sec.
2026-02-05 15:38:30 01121_remote_scalar_subquery: [ OK ] 0.24 sec.
2026-02-05 15:38:30 01139_asof_join_types: [ OK ] 0.27 sec.
2026-02-05 15:38:31 02457_key_condition_with_types_that_cannot_be_nullable: [ OK ] 0.22 sec.
2026-02-05 15:38:31 00500_point_in_polygon_non_const_poly: [ OK ] 0.82 sec.
2026-02-05 15:38:31 02131_mv_many_chunks_bug: [ OK ] 0.27 sec.
2026-02-05 15:38:31 01924_argmax_bitmap_state: [ OK ] 0.17 sec.
2026-02-05 15:38:32 02366_kql_distinct: [ OK ] 0.22 sec.
2026-02-05 15:38:32 02444_async_broken_outdated_part_loading: [ OK ] 2.88 sec.
2026-02-05 15:38:32 00509_extended_storage_definition_syntax_zookeeper: [ OK ] 1.53 sec.
2026-02-05 15:38:32 03206_projection_merge_special_mergetree: [ OK ] 0.42 sec.
2026-02-05 15:38:32 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 20.69 sec.
2026-02-05 15:38:33 00405_output_format_pretty_color: [ OK ] 0.32 sec.
2026-02-05 15:38:33 03274_dynamic_column_sizes_vertical_merge: [ OK ] 0.87 sec.
2026-02-05 15:38:33 00059_shard_global_in_mergetree: [ OK ] 0.27 sec.
2026-02-05 15:38:33 03093_special_column_errors: [ OK ] 0.32 sec.
2026-02-05 15:38:33 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 3.59 sec.
2026-02-05 15:38:33 02469_interval_msan: [ OK ] 0.27 sec.
2026-02-05 15:38:33 00666_uniq_complex_types: [ OK ] 0.32 sec.
2026-02-05 15:38:33 02346_fulltext_index_match_predicate: [ OK ] 0.27 sec.
2026-02-05 15:38:33 02751_multiif_to_if_crash: [ OK ] 0.22 sec.
2026-02-05 15:38:33 01744_tuple_cast_to_map_bugfix: [ OK ] 0.17 sec.
2026-02-05 15:38:33 02050_clickhouse_local_parsing_exception: [ OK ] 0.52 sec.
2026-02-05 15:38:33 01107_join_right_table_totals: [ OK ] 0.37 sec.
2026-02-05 15:38:34 00215_primary_key_order_zookeeper_long: [ OK ] 0.27 sec.
2026-02-05 15:38:34 01475_fix_bigint_shift: [ OK ] 0.18 sec.
2026-02-05 15:38:34 02999_variant_suspicious_types: [ OK ] 0.17 sec.
2026-02-05 15:38:34 00857_global_joinsavel_table_alias: [ OK ] 0.32 sec.
2026-02-05 15:38:34 01514_empty_buffer_different_types: [ OK ] 0.22 sec.
2026-02-05 15:38:34 01013_repeat_function: [ OK ] 0.22 sec.
2026-02-05 15:38:34 02814_currentDatabase_for_table_functions: [ OK ] 1.22 sec.
2026-02-05 15:38:34 02560_regexp_denial_of_service: [ OK ] 0.52 sec.
2026-02-05 15:38:34 03105_table_aliases_in_mv: [ OK ] 0.22 sec.
2026-02-05 15:38:35 00504_insert_miss_columns: [ OK ] 1.28 sec.
2026-02-05 15:38:35 01318_alter_add_column_exists: [ OK ] 0.17 sec.
2026-02-05 15:38:35 03164_analyzer_rewrite_aggregate_function_with_if: [ OK ] 0.12 sec.
2026-02-05 15:38:35 02542_case_no_else: [ OK ] 0.17 sec.
2026-02-05 15:38:35 00003_reinterpret_as_string: [ OK ] 0.17 sec.
2026-02-05 15:38:35 01035_avg_weighted_long: [ OK ] 2.18 sec.
2026-02-05 15:38:35 02226_async_insert_table_function: [ OK ] 0.22 sec.
2026-02-05 15:38:35 00900_entropy_shard: [ OK ] 0.17 sec.
2026-02-05 15:38:35 00612_count: [ OK ] 0.32 sec.
2026-02-05 15:38:35 01262_low_cardinality_remove: [ OK ] 0.27 sec.
2026-02-05 15:38:35 02590_bson_duplicate_column: [ OK ] 0.19 sec.
2026-02-05 15:38:35 02021_exponential_sum_shard: [ OK ] 0.52 sec.
2026-02-05 15:38:36 00945_ml_test: [ OK ] 0.17 sec.
2026-02-05 15:38:36 02989_variant_comparison: [ OK ] 0.33 sec.
2026-02-05 15:38:36 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.23 sec.
2026-02-05 15:38:36 00800_versatile_storage_join: [ OK ] 0.27 sec.
2026-02-05 15:38:36 02525_analyzer_function_in_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:38:36 00411_long_accurate_number_comparison_int2: [ OK ] 6.05 sec.
2026-02-05 15:38:36 03042_not_found_column_c1: [ OK ] 0.17 sec.
2026-02-05 15:38:36 01637_nullable_fuzz3: [ OK ] 0.22 sec.
2026-02-05 15:38:36 01654_bar_nan: [ OK ] 0.17 sec.
2026-02-05 15:38:36 03221_mutation_analyzer_skip_part: [ OK ] 0.47 sec.
2026-02-05 15:38:36 00131_set_hashed: [ OK ] 0.17 sec.
2026-02-05 15:38:36 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.22 sec.
2026-02-05 15:38:36 01418_index_analysis_bug: [ OK ] 0.22 sec.
2026-02-05 15:38:36 01070_alter_with_ttl: [ OK ] 0.22 sec.
2026-02-05 15:38:37 02751_match_constant_needle: [ OK ] 0.18 sec.
2026-02-05 15:38:37 01596_full_join_chertus: [ OK ] 0.17 sec.
2026-02-05 15:38:37 00149_function_url_hash: [ OK ] 0.22 sec.
2026-02-05 15:38:37 03171_function_to_subcolumns_fuzzer: [ OK ] 0.22 sec.
2026-02-05 15:38:37 02435_rollback_cancelled_queries: [ OK ] 22.26 sec.
2026-02-05 15:38:37 02315_pmj_union_ubsan_35857: [ OK ] 0.22 sec.
2026-02-05 15:38:37 01542_collate_in_array: [ OK ] 0.27 sec.
2026-02-05 15:38:37 00779_all_right_join_max_block_size: [ OK ] 0.18 sec.
2026-02-05 15:38:37 02715_bit_operations_float: [ OK ] 0.32 sec.
2026-02-05 15:38:37 01258_wrong_cast_filimonov: [ OK ] 0.17 sec.
2026-02-05 15:38:38 03001_block_offset_column: [ OK ] 0.43 sec.
2026-02-05 15:38:38 02156_async_insert_query_log: [ OK ] 1.47 sec.
2026-02-05 15:38:38 02731_parallel_replicas_join_subquery: [ OK ] 0.62 sec.
2026-02-05 15:38:38 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.32 sec.
2026-02-05 15:38:38 03130_generateSnowflakeId: [ OK ] 0.32 sec.
2026-02-05 15:38:38 00988_parallel_parts_removal: [ OK ] 2.03 sec.
2026-02-05 15:38:38 03036_dynamic_read_shared_subcolumns_small: [ OK ] 1.03 sec.
2026-02-05 15:38:38 02480_parse_date_time_best_effort_math_overflow: [ OK ] 0.17 sec.
2026-02-05 15:38:38 00859_distinct_with_join: [ OK ] 0.23 sec.
2026-02-05 15:38:39 02499_analyzer_set_index: [ OK ] 0.23 sec.
2026-02-05 15:38:39 02955_sparkBar_alias_sparkbar: [ OK ] 0.23 sec.
2026-02-05 15:38:39 01710_projections: [ OK ] 0.37 sec.
2026-02-05 15:38:39 01032_duplicate_column_insert_query: [ OK ] 0.17 sec.
2026-02-05 15:38:39 02027_ngrams: [ OK ] 0.27 sec.
2026-02-05 15:38:39 03002_modify_query_cte: [ OK ] 0.17 sec.
2026-02-05 15:38:39 00495_reading_const_zero_column: [ OK ] 0.17 sec.
2026-02-05 15:38:39 00371_union_all: [ OK ] 0.22 sec.
2026-02-05 15:38:39 00533_uniq_array: [ OK ] 0.17 sec.
2026-02-05 15:38:40 03217_fliter_pushdown_no_keys: [ OK ] 0.17 sec.
2026-02-05 15:38:40 01590_countSubstrings: [ OK ] 0.47 sec.
2026-02-05 15:38:47 02724_mutliple_storage_join: [ OK ] 0.17 sec.
2026-02-05 15:38:47 03014_async_with_dedup_part_log_rmt: [ OK ] 10.56 sec.
2026-02-05 15:38:47 00999_test_skip_indices_with_alter_and_merge: [ OK ] 6.89 sec.
2026-02-05 15:38:47 02319_sql_standard_create_drop_index: [ OK ] 7.69 sec.
2026-02-05 15:38:47 00700_decimal_formats: [ OK ] 0.22 sec.
2026-02-05 15:38:47 00996_neighbor: [ OK ] 0.22 sec.
2026-02-05 15:38:47 01825_type_json_5: [ OK ] 0.22 sec.
2026-02-05 15:38:47 03031_filter_float64_logical_error: [ OK ] 0.17 sec.
2026-02-05 15:38:47 01825_new_type_json_order_by: [ OK ] 0.17 sec.
2026-02-05 15:38:47 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.17 sec.
2026-02-05 15:38:47 02368_analyzer_table_functions: [ OK ] 0.17 sec.
2026-02-05 15:38:47 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.17 sec.
2026-02-05 15:38:48 02725_any_join_single_row: [ OK ] 0.32 sec.
2026-02-05 15:38:48 00705_drop_create_merge_tree: [ OK ] 10.30 sec.
2026-02-05 15:38:48 03008_deduplication_insert_into_partitioned_table: [ OK ] 0.67 sec.
2026-02-05 15:38:48 00715_bounding_ratio: [ OK ] 0.22 sec.
2026-02-05 15:38:48 02245_join_with_nullable_lowcardinality_crash: [ OK ] 0.17 sec.
2026-02-05 15:38:48 01282_system_parts_ttl_info: [ OK ] 0.18 sec.
2026-02-05 15:38:48 00137_in_constants: [ OK ] 0.27 sec.
2026-02-05 15:38:48 02232_functions_to_subcolumns_alias: [ OK ] 0.22 sec.
2026-02-05 15:38:49 00213_multiple_global_in: [ OK ] 0.22 sec.
2026-02-05 15:38:49 01476_right_full_join_switch: [ OK ] 0.27 sec.
2026-02-05 15:38:49 01529_bad_memory_tracking: [ OK ] 1.57 sec.
2026-02-05 15:38:50 01681_arg_min_max_if_fix: [ OK ] 0.12 sec.
2026-02-05 15:38:50 02361_fsync_profile_events: [ OK ] 1.08 sec.
2026-02-05 15:38:50 01231_operator_null_in: [ OK ] 1.49 sec.
2026-02-05 15:38:50 03161_create_table_as_mv: [ OK ] 0.18 sec.
2026-02-05 15:38:50 03013_ignore_drop_queries_probability: [ OK ] 0.22 sec.
2026-02-05 15:38:50 00472_create_view_if_not_exists: [ OK ] 0.17 sec.
2026-02-05 15:38:50 01518_filtering_aliased_materialized_column: [ OK ] 0.22 sec.
2026-02-05 15:38:51 02352_lightweight_delete_and_object_column: [ OK ] 0.22 sec.
2026-02-05 15:38:51 02995_new_settings_history: [ OK ] 0.62 sec.
2026-02-05 15:38:51 02244_url_engine_headers_test: [ OK ] 0.27 sec.
2026-02-05 15:38:51 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.32 sec.
2026-02-05 15:38:51 01866_bit_positions_to_array: [ OK ] 0.27 sec.
2026-02-05 15:38:52 01482_move_to_prewhere_and_cast: [ OK ] 0.22 sec.
2026-02-05 15:38:52 03037_dynamic_merges_1_vertical_compact_merge_tree: [ OK ] 2.14 sec.
2026-02-05 15:38:52 02804_clusterAllReplicas_insert: [ OK ] 0.17 sec.
2026-02-05 15:38:52 01561_aggregate_functions_of_key_with_join: [ OK ] 0.12 sec.
2026-02-05 15:38:52 02678_explain_pipeline_graph_with_projection: [ OK ] 0.22 sec.
2026-02-05 15:38:52 02102_row_binary_with_names_and_types: [ OK ] 5.59 sec.
2026-02-05 15:38:53 03321_functions_to_subcolumns_skip_index: [ OK ] 0.22 sec.
2026-02-05 15:38:53 02834_apache_arrow_abort: [ OK ] 14.68 sec.
2026-02-05 15:38:53 02477_analyzer_function_hints: [ OK ] 1.73 sec.
2026-02-05 15:38:53 02974_analyzer_array_join_subcolumn: [ OK ] 0.17 sec.
2026-02-05 15:38:54 02918_gorilla_invalid_file: [ OK ] 0.42 sec.
2026-02-05 15:38:54 01825_type_json_6: [ OK ] 1.13 sec.
2026-02-05 15:38:54 02421_json_decimals_as_strings: [ OK ] 0.17 sec.
2026-02-05 15:38:54 02950_dictionary_ssd_cache_short_circuit: [ OK ] 0.57 sec.
2026-02-05 15:38:55 02457_s3_cluster_schema_inference: [ OK ] 0.87 sec.
2026-02-05 15:38:55 00443_preferred_block_size_bytes: [ OK ] 3.89 sec.
2026-02-05 15:38:56 02052_last_granula_adjust_logical_error: [ OK ] 0.37 sec.
2026-02-05 15:38:56 02662_sparse_columns_mutations_3: [ OK ] 0.37 sec.
2026-02-05 15:38:56 02494_query_cache_empty_tuple: [ OK ] 0.17 sec.
2026-02-05 15:38:57 02205_HTTP_user_agent: [ OK ] 0.52 sec.
2026-02-05 15:38:58 02725_memory-for-merges: [ OK ] 4.13 sec.
2026-02-05 15:38:59 00746_compile_non_deterministic_function: [ OK ] 6.19 sec.
2026-02-05 15:38:59 02383_arrow_dict_special_cases: [ OK ] 1.93 sec.
2026-02-05 15:38:59 00453_cast_enum: [ OK ] 0.22 sec.
2026-02-05 15:38:59 03006_analyzer_executable_table_function: [ OK ] 0.18 sec.
2026-02-05 15:38:59 01458_named_tuple_millin: [ OK ] 0.17 sec.
2026-02-05 15:38:59 01430_moving_sum_empty_state: [ OK ] 0.17 sec.
2026-02-05 15:38:59 03003_sql_json_nonsense: [ OK ] 0.12 sec.
2026-02-05 15:38:59 00982_array_enumerate_uniq_ranked: [ OK ] 0.17 sec.
2026-02-05 15:38:59 01065_if_not_finite: [ OK ] 0.22 sec.
2026-02-05 15:39:00 02886_missed_json_subcolumns: [ OK ] 0.32 sec.
2026-02-05 15:39:00 02370_analyzer_in_function: [ OK ] 0.27 sec.
2026-02-05 15:39:00 03208_groupArrayIntersect_serialization: [ OK ] 0.32 sec.
2026-02-05 15:39:00 00720_with_cube: [ OK ] 0.22 sec.
2026-02-05 15:39:00 02510_group_by_prewhere_null: [ OK ] 0.22 sec.
2026-02-05 15:39:00 01581_to_int_inf_nan: [ OK ] 0.32 sec.
2026-02-05 15:39:00 00604_show_create_database: [ OK ] 0.12 sec.
2026-02-05 15:39:01 01674_filter_by_uint8: [ OK ] 0.22 sec.
2026-02-05 15:39:01 02662_sparse_columns_mutations_2: [ OK ] 0.34 sec.
2026-02-05 15:39:01 02184_default_table_engine: [ OK ] 0.83 sec.
2026-02-05 15:39:01 02833_concurrent_sessions: [ OK ] 6.59 sec.
2026-02-05 15:39:02 01670_neighbor_lc_bug: [ OK ] 0.23 sec.
2026-02-05 15:39:02 03251_parquet_page_v2_native_reader: [ OK ] 0.87 sec.
2026-02-05 15:39:02 03220_replace_formatting: [ OK ] 0.52 sec.
2026-02-05 15:39:02 02434_cancel_insert_when_client_dies: [ OK ] 41.90 sec.
2026-02-05 15:39:02 01801_s3_cluster: [ OK ] 1.03 sec.
2026-02-05 15:39:02 01849_geoToS2: [ OK ] 0.37 sec.
2026-02-05 15:39:02 02811_invalid_embedded_rocksdb_create: [ OK ] 0.17 sec.
2026-02-05 15:39:02 00556_array_intersect: [ OK ] 0.22 sec.
2026-02-05 15:39:02 02230_create_table_as_ignore_ttl: [ OK ] 0.22 sec.
2026-02-05 15:39:03 01292_optimize_data_skip_idx_order_by_expr: [ OK ] 0.17 sec.
2026-02-05 15:39:03 01421_array_nullable_element_nullable_index: [ OK ] 0.22 sec.
2026-02-05 15:39:03 01194_http_query_id: [ OK ] 0.82 sec.
2026-02-05 15:39:03 01000_unneeded_substitutions_client: [ OK ] 0.57 sec.
2026-02-05 15:39:03 02001_append_output_file: [ OK ] 0.72 sec.
2026-02-05 15:39:04 02181_dictionary_attach_detach: [ OK ] 0.27 sec.
2026-02-05 15:39:04 01236_graphite_mt: [ OK ] 0.22 sec.
2026-02-05 15:39:04 01356_initialize_aggregation: [ OK ] 0.22 sec.
2026-02-05 15:39:04 01034_order_by_pk_prefix: [ OK ] 0.37 sec.
2026-02-05 15:39:04 00900_null_array_orc_load: [ OK ] 1.08 sec.
2026-02-05 15:39:05 03037_recursive_cte_postgres_3: [ OK ] 0.37 sec.
2026-02-05 15:39:05 02421_truncate_isolation_with_mutations: [ OK ] 10.91 sec.
2026-02-05 15:39:05 02911_analyzer_order_by_read_in_order_query_plan: [ OK ] 1.13 sec.
2026-02-05 15:39:05 02354_parse_timedelta: [ OK ] 0.52 sec.
2026-02-05 15:39:05 03215_varian_as_common_type_tuple_map: [ OK ] 0.22 sec.
2026-02-05 15:39:05 01104_distributed_one_test: [ OK ] 0.22 sec.
2026-02-05 15:39:05 01300_wkt: [ OK ] 0.22 sec.
2026-02-05 15:39:05 01455_opentelemetry_distributed: [ OK ] 2.78 sec.
2026-02-05 15:39:05 00626_replace_partition_from_table: [ OK ] 0.49 sec.
2026-02-05 15:39:05 01534_lambda_array_join: [ OK ] 0.17 sec.
2026-02-05 15:39:05 03274_grace_hash_max_joined_block_size_rows_bug: [ OK ] 0.17 sec.
2026-02-05 15:39:05 02888_obsolete_settings: [ OK ] 0.17 sec.
2026-02-05 15:39:05 02505_forbid_paths_in_datetime_timezone: [ OK ] 0.17 sec.
2026-02-05 15:39:06 02982_minmax_nan_null_order: [ OK ] 0.27 sec.
2026-02-05 15:39:06 01414_low_cardinality_nullable: [ OK ] 0.62 sec.
2026-02-05 15:39:06 01940_totimezone_operator_monotonicity: [ OK ] 0.17 sec.
2026-02-05 15:39:06 00718_format_datetime: [ OK ] 0.67 sec.
2026-02-05 15:39:06 00900_long_parquet_load: [ OK ] 31.39 sec.
2026-02-05 15:39:06 02360_small_notation_h_for_hour_interval: [ OK ] 0.12 sec.
2026-02-05 15:39:06 02882_replicated_fetch_checksums_doesnt_match: [ OK ] 1.42 sec.
2026-02-05 15:39:07 01140_select_from_storage_join_fix: [ OK ] 0.22 sec.
2026-02-05 15:39:07 03142_window_function_limit_by: [ OK ] 0.22 sec.
2026-02-05 15:39:07 02580_like_substring_search_bug: [ OK ] 0.12 sec.
2026-02-05 15:39:07 02811_csv_input_field_type_mismatch: [ OK ] 0.92 sec.
2026-02-05 15:39:07 03006_join_on_inequal_expression_fast: [ OK ] 1.62 sec.
2026-02-05 15:39:08 01071_force_optimize_skip_unused_shards: [ OK ] 1.38 sec.
2026-02-05 15:39:08 02870_per_column_settings: [ OK ] 1.25 sec.
2026-02-05 15:39:08 02002_parse_map_int_key: [ OK ] 0.17 sec.
2026-02-05 15:39:08 02786_parquet_big_integer_compatibility: [ OK ] 1.57 sec.
2026-02-05 15:39:08 02554_invalid_create_view_syntax: [ OK ] 0.12 sec.
2026-02-05 15:39:08 02346_aggregation_in_order_fixed_prefix: [ OK ] 2.62 sec.
2026-02-05 15:39:08 02264_format_insert_infile: [ OK ] 0.17 sec.
2026-02-05 15:39:08 01495_subqueries_in_with_statement_4: [ OK ] 0.17 sec.
2026-02-05 15:39:08 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.17 sec.
2026-02-05 15:39:09 01062_alter_on_mutataion_zookeeper_long: [ OK ] 1.53 sec.
2026-02-05 15:39:09 01657_test_toHour_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:39:09 01284_view_and_extremes_bug: [ OK ] 0.17 sec.
2026-02-05 15:39:09 02370_lost_part_intersecting_merges: [ OK ] 10.78 sec.
2026-02-05 15:39:09 01303_polygons_equals: [ OK ] 0.17 sec.
2026-02-05 15:39:09 00422_hash_function_constexpr: [ OK ] 0.17 sec.
2026-02-05 15:39:09 01622_byte_size: [ OK ] 0.67 sec.
2026-02-05 15:39:09 00647_multiply_aggregation_state: [ OK ] 0.22 sec.
2026-02-05 15:39:09 02243_in_ip_address: [ OK ] 0.17 sec.
2026-02-05 15:39:09 01063_window_view_event_tumble_to_bounded: [ OK ] 1.12 sec.
2026-02-05 15:39:10 01600_select_in_different_types: [ OK ] 0.27 sec.
2026-02-05 15:39:10 01585_use_index_for_global_in: [ OK ] 0.22 sec.
2026-02-05 15:39:10 00305_http_and_readonly: [ OK ] 0.57 sec.
2026-02-05 15:39:10 00730_unicode_terminal_format: [ OK ] 0.22 sec.
2026-02-05 15:39:10 03169_time_virtual_column: [ OK ] 1.47 sec.
2026-02-05 15:39:10 03008_optimize_equal_ranges: [ OK ] 0.47 sec.
2026-02-05 15:39:10 01402_cast_nullable_string_to_enum: [ OK ] 0.27 sec.
2026-02-05 15:39:10 02320_mapped_array_witn_const_nullable: [ OK ] 0.17 sec.
2026-02-05 15:39:10 03022_highlight_digit_groups: [ OK ] 0.17 sec.
2026-02-05 15:39:10 02891_empty_tuple: [ OK ] 0.22 sec.
2026-02-05 15:39:10 02706_array_map_tuples: [ OK ] 0.17 sec.
2026-02-05 15:39:10 00647_select_numbers_with_offset: [ OK ] 0.17 sec.
2026-02-05 15:39:10 02681_undrop_query: [ OK ] 1.02 sec.
2026-02-05 15:39:11 01035_prewhere_with_alias: [ OK ] 0.17 sec.
2026-02-05 15:39:11 02294_system_certificates: [ OK ] 0.17 sec.
2026-02-05 15:39:11 00915_simple_aggregate_function: [ OK ] 0.27 sec.
2026-02-05 15:39:11 01138_join_on_distributed_and_tmp: [ OK ] 0.22 sec.
2026-02-05 15:39:11 02811_parallel_replicas_prewhere_count: [ OK ] 0.17 sec.
2026-02-05 15:39:11 02316_const_string_intersact: [ OK ] 0.17 sec.
2026-02-05 15:39:11 00980_alter_settings_race: [ OK ] 4.99 sec.
2026-02-05 15:39:11 01532_tuple_with_name_type: [ OK ] 0.17 sec.
2026-02-05 15:39:11 03096_order_by_system_tables: [ OK ] 0.27 sec.
2026-02-05 15:39:11 02915_fpc_overflow: [ OK ] 0.42 sec.
2026-02-05 15:39:11 01854_s2_cap_contains: [ OK ] 0.22 sec.
2026-02-05 15:39:11 02019_multiple_weird_with_fill: [ OK ] 0.17 sec.
2026-02-05 15:39:11 02919_storage_fuzzjson: [ OK ] 0.23 sec.
2026-02-05 15:39:12 02900_matview_create_to_errors: [ OK ] 0.52 sec.
2026-02-05 15:39:12 02513_prewhere_combine_step_filters: [ OK ] 0.22 sec.
2026-02-05 15:39:12 02179_sparse_columns_detach: [ OK ] 0.27 sec.
2026-02-05 15:39:12 03202_dynamic_null_map_subcolumn: [ OK ] 0.57 sec.
2026-02-05 15:39:12 02907_system_backups_profile_events: [ OK ] 0.77 sec.
2026-02-05 15:39:12 01504_compression_multiple_streams: [ OK ] 0.37 sec.
2026-02-05 15:39:12 02816_has_token_empty: [ OK ] 0.22 sec.
2026-02-05 15:39:12 01055_compact_parts: [ OK ] 0.37 sec.
2026-02-05 15:39:13 02451_order_by_monotonic: [ OK ] 2.22 sec.
2026-02-05 15:39:13 01825_type_json_empty_string: [ OK ] 0.17 sec.
2026-02-05 15:39:13 00436_convert_charset: [ OK ] 0.22 sec.
2026-02-05 15:39:13 02031_format_query_option: [ OK ] 0.42 sec.
2026-02-05 15:39:13 02476_analyzer_join_with_unused_columns: [ OK ] 0.22 sec.
2026-02-05 15:39:13 03096_variant_in_primary_key: [ OK ] 0.17 sec.
2026-02-05 15:39:13 02518_merge_engine_nullable_43324: [ OK ] 0.22 sec.
2026-02-05 15:39:13 02892_SummingMergeTree_Nested: [ OK ] 0.17 sec.
2026-02-05 15:39:13 03023_group_by_use_nulls_analyzer_crashes: [ OK ] 0.32 sec.
2026-02-05 15:39:13 00555_right_join_excessive_rows: [ OK ] 0.17 sec.
2026-02-05 15:39:13 02842_suggest_http_page_in_error_message: [ OK ] 0.42 sec.
2026-02-05 15:39:14 02366_kql_func_scalar: [ OK ] 0.22 sec.
2026-02-05 15:39:14 02439_merge_selecting_partitions: [ OK ] 3.73 sec.
2026-02-05 15:39:14 02151_clickhouse_client_hints: [ OK ] 0.52 sec.
2026-02-05 15:39:14 01087_index_set_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:39:14 03017_analyzer_groupby_fuzz_61600: [ OK ] 0.17 sec.
2026-02-05 15:39:14 00978_sum_map_bugfix: [ OK ] 0.22 sec.
2026-02-05 15:39:14 00090_union_race_conditions_1: [ OK ] 5.63 sec.
2026-02-05 15:39:14 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.57 sec.
2026-02-05 15:39:14 00409_shard_limit_by: [ OK ] 0.27 sec.
2026-02-05 15:39:14 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.22 sec.
2026-02-05 15:39:14 02919_alter_temporary_table_with_nondefault_engine: [ OK ] 0.22 sec.
2026-02-05 15:39:14 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.17 sec.
2026-02-05 15:39:14 00958_format_of_tuple_array_element: [ OK ] 0.42 sec.
2026-02-05 15:39:14 02366_kql_create_table: [ OK ] 0.17 sec.
2026-02-05 15:39:15 01037_zookeeper_check_table_empty_pk: [ OK ] 0.22 sec.
2026-02-05 15:39:15 00700_decimal_null: [ OK ] 0.27 sec.
2026-02-05 15:39:15 00542_materialized_view_and_time_zone_tag: [ OK ] 0.27 sec.
2026-02-05 15:39:15 02152_bool_type: [ OK ] 0.27 sec.
2026-02-05 15:39:15 01717_int_div_float_too_large_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:39:16 00173_compare_date_time_with_constant_string: [ OK ] 0.37 sec.
2026-02-05 15:39:16 02770_async_buffer_ignore: [ OK ] 1.12 sec.
2026-02-05 15:39:16 02291_join_const_literal_36279: [ OK ] 0.27 sec.
2026-02-05 15:39:16 00396_uuid_v7: [ OK ] 0.37 sec.
2026-02-05 15:39:16 03036_parquet_arrow_nullable: [ OK ] 4.53 sec.
2026-02-05 15:39:16 01638_div_mod_ambiguities: [ OK ] 0.22 sec.
2026-02-05 15:39:16 02691_multiple_joins_backtick_identifiers: [ OK ] 0.22 sec.
2026-02-05 15:39:16 01942_dateTimeToSnowflake: [ OK ] 0.32 sec.
2026-02-05 15:39:17 01825_new_type_json_ghdata: [ OK ] 2.78 sec.
2026-02-05 15:39:17 02294_anova_cmp: [ OK ] 2.13 sec.
2026-02-05 15:39:17 01558_ttest: [ OK ] 0.32 sec.
2026-02-05 15:39:17 01731_async_task_queue_wait: [ OK ] 2.63 sec.
2026-02-05 15:39:17 02125_query_views_log_window_function: [ OK ] 0.33 sec.
2026-02-05 15:39:17 02292_nested_not_flattened_detach: [ OK ] 0.22 sec.
2026-02-05 15:39:17 00525_aggregate_functions_of_nullable_that_return_non_nullable: [ OK ] 0.17 sec.
2026-02-05 15:39:17 03093_analyzer_miel_test: [ OK ] 0.22 sec.
2026-02-05 15:39:17 03037_dynamic_merges_small: [ OK ] 1.12 sec.
2026-02-05 15:39:17 00910_decimal_group_array_crash_3783: [ OK ] 0.32 sec.
2026-02-05 15:39:17 01550_query_identifier_parameters: [ OK ] 0.97 sec.
2026-02-05 15:39:17 01312_comparison_with_constant_string_in_index_analysis: [ OK ] 0.27 sec.
2026-02-05 15:39:17 01700_mod_negative_type_promotion: [ OK ] 0.17 sec.
2026-02-05 15:39:18 01593_functions_in_order_by: [ OK ] 0.17 sec.
2026-02-05 15:39:18 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.32 sec.
2026-02-05 15:39:18 00318_pk_tuple_order: [ OK ] 0.37 sec.
2026-02-05 15:39:18 02874_toDaysSinceYearZero: [ OK ] 0.27 sec.
2026-02-05 15:39:18 00288_empty_stripelog: [ OK ] 0.17 sec.
2026-02-05 15:39:18 01274_generate_random_nested: [ OK ] 0.42 sec.
2026-02-05 15:39:18 01083_cross_to_inner_with_like: [ OK ] 0.17 sec.
2026-02-05 15:39:18 02438_sync_replica_lightweight: [ OK ] 0.32 sec.
2026-02-05 15:39:18 02891_functions_over_sparse_columns: [ OK ] 0.17 sec.
2026-02-05 15:39:18 03261_optimize_rewrite_array_exists_to_has_crash: [ OK ] 0.17 sec.
2026-02-05 15:39:19 01085_window_view_attach: [ OK ] 0.27 sec.
2026-02-05 15:39:19 01591_window_functions: [ OK ] 0.97 sec.
2026-02-05 15:39:19 01338_uuid_without_separator: [ OK ] 0.17 sec.
2026-02-05 15:39:19 00609_prewhere_and_default: [ OK ] 0.47 sec.
2026-02-05 15:39:19 01045_array_zip: [ OK ] 0.22 sec.
2026-02-05 15:39:20 01546_log_queries_min_query_duration_ms: [ OK ] 0.93 sec.
2026-02-05 15:39:20 01451_dist_logs: [ OK ] 0.97 sec.
2026-02-05 15:39:20 02169_map_functions: [ OK ] 0.88 sec.
2026-02-05 15:39:21 02714_read_bytes_aggregateFunction: [ OK ] 0.42 sec.
2026-02-05 15:39:21 00820_multiple_joins: [ OK ] 0.27 sec.
2026-02-05 15:39:21 01669_join_or_duplicates: [ OK ] 0.22 sec.
2026-02-05 15:39:21 00639_startsWith: [ OK ] 0.22 sec.
2026-02-05 15:39:22 01526_alter_add_and_modify_order_zookeeper: [ OK ] 0.37 sec.
2026-02-05 15:39:22 01169_old_alter_partition_isolation_stress: [ OK ] 5.24 sec.
2026-02-05 15:39:22 00534_exp10: [ OK ] 0.22 sec.
2026-02-05 15:39:22 01430_fix_any_rewrite_aliases: [ OK ] 0.17 sec.
2026-02-05 15:39:23 02421_exponential_join_rewrite_21557: [ OK ] 2.73 sec.
2026-02-05 15:39:23 00943_materialize_index: [ OK ] 3.13 sec.
2026-02-05 15:39:23 01615_two_args_function_index_fix: [ OK ] 0.22 sec.
2026-02-05 15:39:23 01761_cast_to_enum_nullable: [ OK ] 0.22 sec.
2026-02-05 15:39:23 02122_parallel_formatting_TSV: [ OK ] 1.38 sec.
2026-02-05 15:39:23 01825_type_json_14: [ OK ] 0.23 sec.
2026-02-05 15:39:23 01682_gather_utils_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:39:23 01064_pm_all_join_const_and_nullable: [ OK ] 0.37 sec.
2026-02-05 15:39:23 01655_window_functions_null: [ OK ] 0.17 sec.
2026-02-05 15:39:24 02009_decimal_no_trailing_zeros: [ OK ] 0.32 sec.
2026-02-05 15:39:24 03250_json_group_by_sub_object_subcolumn: [ OK ] 0.22 sec.
2026-02-05 15:39:24 02900_add_subtract_interval_with_string_date: [ OK ] 0.72 sec.
2026-02-05 15:39:24 01280_opencl_bitonic_order_by: [ OK ] 0.22 sec.
2026-02-05 15:39:24 00372_cors_header: [ OK ] 0.52 sec.
2026-02-05 15:39:24 02705_protobuf_debug_abort: [ OK ] 0.68 sec.
2026-02-05 15:39:24 02895_cast_operator_bug: [ OK ] 0.17 sec.
2026-02-05 15:39:25 01413_rows_events: [ OK ] 0.52 sec.
2026-02-05 15:39:25 03156_analyzer_array_join_distributed: [ OK ] 0.32 sec.
2026-02-05 15:39:25 01009_insert_select_nicelulu: [ OK ] 2.48 sec.
2026-02-05 15:39:25 02266_auto_add_nullable: [ OK ] 0.17 sec.
2026-02-05 15:39:25 02941_any_RESPECT_NULL_sparse_column: [ OK ] 0.22 sec.
2026-02-05 15:39:25 01481_join_with_materialized: [ OK ] 0.17 sec.
2026-02-05 15:39:25 01543_parse_datetime_besteffort_or_null_empty_string: [ OK ] 0.17 sec.
2026-02-05 15:39:25 02588_avro_date32_and_decimals: [ OK ] 1.12 sec.
2026-02-05 15:39:25 00260_like_and_curly_braces: [ OK ] 0.27 sec.
2026-02-05 15:39:25 01425_decimal_parse_big_negative_exponent: [ OK ] 0.22 sec.
2026-02-05 15:39:25 02477_analyzer_array_join_with_join: [ OK ] 0.38 sec.
2026-02-05 15:39:25 02024_create_dictionary_with_comment: [ OK ] 0.17 sec.
2026-02-05 15:39:26 01353_neighbor_overflow: [ OK ] 0.17 sec.
2026-02-05 15:39:26 03287_dynamic_and_json_squashing_fix: [ OK ] 0.27 sec.
2026-02-05 15:39:26 02554_log_faminy_support_storage_policy: [ OK ] 0.27 sec.
2026-02-05 15:39:26 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.22 sec.
2026-02-05 15:39:26 02981_variant_type_function: [ OK ] 0.22 sec.
2026-02-05 15:39:26 02962_join_using_bug_57894: [ OK ] 0.22 sec.
2026-02-05 15:39:26 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:39:26 02015_async_inserts_2: [ OK ] 0.82 sec.
2026-02-05 15:39:26 00881_unknown_identifier_in_in: [ OK ] 0.22 sec.
2026-02-05 15:39:26 02036_jit_short_circuit: [ OK ] 0.17 sec.
2026-02-05 15:39:27 02185_split_by_char: [ OK ] 0.17 sec.
2026-02-05 15:39:27 02843_date_predicate_optimizations_bugs: [ OK ] 0.17 sec.
2026-02-05 15:39:27 02947_dropped_tables_parts: [ OK ] 0.22 sec.
2026-02-05 15:39:27 01710_projection_with_alter_conversions: [ OK ] 0.17 sec.
2026-02-05 15:39:27 01174_select_insert_isolation: [ OK ] 9.15 sec.
2026-02-05 15:39:27 02861_uuid_format_serialization: [ OK ] 0.22 sec.
2026-02-05 15:39:27 03212_optimize_with_constraints_logical_error: [ OK ] 0.17 sec.
2026-02-05 15:39:28 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.23 sec.
2026-02-05 15:39:28 02730_dictionary_hashed_load_factor_element_count: [ OK ] 0.54 sec.
2026-02-05 15:39:28 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.22 sec.
2026-02-05 15:39:28 00906_low_cardinality_cache: [ OK ] 1.63 sec.
2026-02-05 15:39:28 02122_parallel_formatting_CSV: [ OK ] 1.39 sec.
2026-02-05 15:39:29 00351_select_distinct_arrays_tuples: [ OK ] 0.17 sec.
2026-02-05 15:39:29 02722_line_as_string_consistency: [ OK ] 1.03 sec.
2026-02-05 15:39:30 01450_set_null_const: [ OK ] 0.17 sec.
2026-02-05 15:39:30 02160_monthname: [ OK ] 0.22 sec.
2026-02-05 15:39:30 02923_join_use_nulls_modulo: [ OK ] 0.17 sec.
2026-02-05 15:39:30 01923_different_expression_name_alias: [ OK ] 0.22 sec.
2026-02-05 15:39:30 02676_trailing_commas: [ OK ] 0.17 sec.
2026-02-05 15:39:31 02021_h3_get_faces: [ OK ] 0.22 sec.
2026-02-05 15:39:32 02247_read_bools_as_numbers_json: [ OK ] 3.18 sec.
2026-02-05 15:39:32 02888_single_state_nullable_type: [ OK ] 0.17 sec.
2026-02-05 15:39:32 03032_save_bad_json_escape_sequences: [ OK ] 0.17 sec.
2026-02-05 15:39:32 02504_explain_ast_insert: [ OK ] 0.17 sec.
2026-02-05 15:39:33 02543_alter_rename_modify_stuck: [ OK ] 4.23 sec.
2026-02-05 15:39:33 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.23 sec.
2026-02-05 15:39:33 02403_enable_extended_results_for_datetime_functions: [ OK ] 0.47 sec.
2026-02-05 15:39:34 00098_b_union_all: [ OK ] 0.23 sec.
2026-02-05 15:39:34 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.22 sec.
2026-02-05 15:39:36 02718_cli_dashed_options_parsing: [ OK ] 1.89 sec.
2026-02-05 15:39:36 02691_drop_column_with_projections_replicated: [ OK ] 0.37 sec.
2026-02-05 15:39:36 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 10.58 sec.
2026-02-05 15:39:37 01951_distributed_push_down_limit: [ OK ] 0.22 sec.
2026-02-05 15:39:37 02845_domain_rfc_support_ipv6: [ OK ] 0.42 sec.
2026-02-05 15:39:37 01083_match_zero_byte: [ OK ] 0.27 sec.
2026-02-05 15:39:38 01167_isolation_hermitage: [ OK ] 25.13 sec.
2026-02-05 15:39:38 01105_string_like: [ OK ] 0.42 sec.
2026-02-05 15:39:38 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ OK ] 51.87 sec.
2026-02-05 15:39:39 00588_shard_distributed_prewhere: [ OK ] 0.33 sec.
2026-02-05 15:39:39 01068_parens: [ OK ] 0.17 sec.
2026-02-05 15:39:39 03164_analyzer_validate_tree_size: [ OK ] 0.37 sec.
2026-02-05 15:39:39 02449_check_dependencies_and_table_shutdown: [ OK ] 0.42 sec.
2026-02-05 15:39:39 02370_extractAll_regress: [ OK ] 0.22 sec.
2026-02-05 15:39:40 03039_unknown_identifier_window_function: [ OK ] 0.24 sec.
2026-02-05 15:39:40 00942_dataparts_500: [ OK ] 0.63 sec.
2026-02-05 15:39:40 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.23 sec.
2026-02-05 15:39:40 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 2.88 sec.
2026-02-05 15:39:41 00712_prewhere_with_alias: [ OK ] 0.44 sec.
2026-02-05 15:39:41 01649_with_alias_key_condition: [ OK ] 0.49 sec.
2026-02-05 15:39:41 01736_null_as_default: [ OK ] 0.43 sec.
2026-02-05 15:39:42 02998_to_milliseconds: [ OK ] 0.33 sec.
2026-02-05 15:39:42 02998_analyzer_prewhere_report: [ OK ] 0.60 sec.
2026-02-05 15:39:43 00154_shard_distributed_with_distinct: [ OK ] 0.28 sec.
2026-02-05 15:39:43 02303_query_kind: [ OK ] 1.95 sec.
2026-02-05 15:39:43 00819_full_join_wrong_columns_in_block: [ OK ] 0.34 sec.
2026-02-05 15:39:43 02292_hash_array_tuples: [ OK ] 0.33 sec.
2026-02-05 15:39:43 01019_alter_materialized_view_consistent: [ OK ] 3.77 sec.
2026-02-05 15:39:44 02990_format_select_from_explain: [ OK ] 0.58 sec.
2026-02-05 15:39:44 01801_approx_total_rows_mergetree_reverse: [ OK ] 0.42 sec.
2026-02-05 15:39:45 02975_intdiv_with_decimal: [ OK ] 0.52 sec.
2026-02-05 15:39:45 00815_left_join_on_stepanel: [ OK ] 0.28 sec.
2026-02-05 15:39:46 01586_storage_join_low_cardinality_key: [ OK ] 0.33 sec.
2026-02-05 15:39:46 02426_pod_array_overflow_2: [ OK ] 0.18 sec.
2026-02-05 15:39:46 00501_http_head: [ OK ] 0.67 sec.
2026-02-05 15:39:47 01561_mann_whitney_scipy: [ OK ] 3.68 sec.
2026-02-05 15:39:47 01667_aes_args_check: [ OK ] 0.17 sec.
2026-02-05 15:39:47 03246_skipping_index_70108: [ OK ] 1.02 sec.
2026-02-05 15:39:48 01891_echo: [ OK ] 0.27 sec.
2026-02-05 15:39:48 02513_broken_datetime64_init_on_mac: [ OK ] 0.34 sec.
2026-02-05 15:39:48 02876_yyyymmddtodate: [ OK ] 0.88 sec.
2026-02-05 15:39:49 02325_dates_schema_inference: [ OK ] 0.53 sec.
2026-02-05 15:39:49 00995_optimize_read_in_order_with_aggregation: [ OK ] 0.17 sec.
2026-02-05 15:39:49 02456_alter-nullable-column-bag: [ OK ] 0.37 sec.
2026-02-05 15:39:49 02495_sum_if_to_count_if_bug: [ OK ] 0.23 sec.
2026-02-05 15:39:53 00816_long_concurrent_alter_column: [ OK ] 21.10 sec.
2026-02-05 15:39:54 02803_remote_cannot_clone_block: [ OK ] 0.23 sec.
2026-02-05 15:39:54 00858_issue_4756: [ OK ] 0.43 sec.
2026-02-05 15:39:55 01345_array_join_LittleMaverick: [ OK ] 0.32 sec.
2026-02-05 15:39:55 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.33 sec.
2026-02-05 15:39:55 02354_vector_search_detach_attach: [ OK ] 0.28 sec.
2026-02-05 15:39:56 02514_null_dictionary_source: [ OK ] 0.34 sec.
2026-02-05 15:39:58 02922_deduplication_with_zero_copy: [ OK ] 41.14 sec.
2026-02-05 15:39:58 01014_format_custom_separated: [ OK ] 2.54 sec.
2026-02-05 15:39:59 00688_low_cardinality_defaults: [ OK ] 0.27 sec.
2026-02-05 15:39:59 01917_prewhere_column_type: [ OK ] 0.40 sec.
2026-02-05 15:39:59 02275_full_sort_join_long: [ OK ] 32.52 sec.
2026-02-05 15:39:59 02523_range_const_start: [ OK ] 0.23 sec.
2026-02-05 15:39:59 01622_constraints_where_optimization: [ OK ] 0.22 sec.
2026-02-05 15:39:59 02021_map_bloom_filter_index: [ OK ] 0.47 sec.
2026-02-05 15:39:59 01304_polygons_sym_difference: [ OK ] 0.29 sec.
2026-02-05 15:40:00 01954_clickhouse_benchmark_multiple_long: [ OK ] 16.63 sec.
2026-02-05 15:40:00 01710_projection_with_column_transformers: [ OK ] 0.22 sec.
2026-02-05 15:40:00 01266_default_prewhere_reqq: [ OK ] 0.23 sec.
2026-02-05 15:40:00 01825_type_json_insert_select: [ OK ] 0.53 sec.
2026-02-05 15:40:01 03152_analyzer_columns_list: [ OK ] 0.22 sec.
2026-02-05 15:40:01 02319_lightweight_delete_on_merge_tree_compact_parts: [ OK ] 0.92 sec.
2026-02-05 15:40:01 02725_async_insert_table_setting: [ OK ] 1.17 sec.
2026-02-05 15:40:01 02232_partition_pruner_mixed_constant_type: [ OK ] 0.18 sec.
2026-02-05 15:40:01 03214_json_typed_dynamic_path: [ OK ] 0.27 sec.
2026-02-05 15:40:01 01508_partition_pruning_long_1: [ OK ] 11.91 sec.
2026-02-05 15:40:01 01717_global_with_subquery_fix: [ OK ] 0.17 sec.
2026-02-05 15:40:01 03209_parameterized_view_with_non_literal_params: [ OK ] 0.62 sec.
2026-02-05 15:40:01 02534_s3_cluster_insert_select_schema_inference: [ OK ] 0.22 sec.
2026-02-05 15:40:02 01080_check_for_error_incorrect_size_of_nested_column: [ OK ] 0.27 sec.
2026-02-05 15:40:02 03213_array_element_msan: [ OK ] 0.23 sec.
2026-02-05 15:40:02 00712_prewhere_with_alias_bug_2: [ OK ] 0.23 sec.
2026-02-05 15:40:02 02790_sql_standard_fetch: [ OK ] 0.22 sec.
2026-02-05 15:40:02 01550_mutation_subquery: [ OK ] 0.27 sec.
2026-02-05 15:40:02 01277_unixTimestamp64_compatibility: [ OK ] 0.32 sec.
2026-02-05 15:40:02 03090_analyzer_multiple_using_statements: [ OK ] 0.17 sec.
2026-02-05 15:40:02 02029_quantile_sanitizer: [ OK ] 0.18 sec.
2026-02-05 15:40:02 03124_analyzer_nested_CTE_dist_in: [ OK ] 0.25 sec.
2026-02-05 15:40:02 02536_date_from_number_inference_fix: [ OK ] 0.17 sec.
2026-02-05 15:40:03 01584_distributed_buffer_cannot_find_column: [ OK ] 0.28 sec.
2026-02-05 15:40:03 01622_constraints_simple_optimization: [ OK ] 0.63 sec.
2026-02-05 15:40:03 00700_decimal_arithm: [ OK ] 0.82 sec.
2026-02-05 15:40:03 00029_test_zookeeper_optimize_exception: [ OK ] 2.59 sec.
2026-02-05 15:40:04 02008_tuple_to_name_value_pairs: [ OK ] 0.32 sec.
2026-02-05 15:40:04 00379_system_processes_port: [ OK ] 0.57 sec.
2026-02-05 15:40:04 00829_bitmap_function: [ OK ] 1.02 sec.
2026-02-05 15:40:04 01141_join_get_negative: [ OK ] 0.22 sec.
2026-02-05 15:40:04 02836_file_diagnostics_while_reading_header: [ OK ] 0.67 sec.
2026-02-05 15:40:04 01278_format_multiple_queries: [ OK ] 0.53 sec.
2026-02-05 15:40:05 01495_subqueries_in_with_statement_3: [ OK ] 0.37 sec.
2026-02-05 15:40:05 03143_cte_scope: [ OK ] 0.23 sec.
2026-02-05 15:40:05 00330_view_subqueries: [ OK ] 0.17 sec.
2026-02-05 15:40:05 02480_tets_show_full: [ OK ] 0.83 sec.
2026-02-05 15:40:05 00568_empty_function_with_fixed_string: [ OK ] 0.22 sec.
2026-02-05 15:40:05 02409_url_format_detection: [ OK ] 0.17 sec.
2026-02-05 15:40:05 02246_is_secure_query_log: [ OK ] 2.43 sec.
2026-02-05 15:40:05 00151_tuple_with_array: [ OK ] 0.18 sec.
2026-02-05 15:40:05 01868_order_by_fill_with_datetime64: [ OK ] 0.17 sec.
2026-02-05 15:40:05 01913_fix_column_transformer_replace_format: [ OK ] 0.17 sec.
2026-02-05 15:40:05 01018_Distributed__shard_num: [ OK ] 0.37 sec.
2026-02-05 15:40:05 02735_array_map_array_of_tuples: [ OK ] 0.17 sec.
2026-02-05 15:40:06 00943_mv_rename_without_inner_table: [ OK ] 0.27 sec.
2026-02-05 15:40:06 02412_nlp: [ OK ] 0.27 sec.
2026-02-05 15:40:06 00098_8_union_all: [ OK ] 0.17 sec.
2026-02-05 15:40:06 01031_new_any_join: [ OK ] 0.37 sec.
2026-02-05 15:40:06 01825_new_type_json_7: [ OK ] 1.28 sec.
2026-02-05 15:40:06 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.17 sec.
2026-02-05 15:40:06 00927_asof_join_correct_bt: [ OK ] 0.32 sec.
2026-02-05 15:40:06 02110_clickhouse_local_custom_tld: [ OK ] 0.58 sec.
2026-02-05 15:40:07 00979_toFloat_monotonicity: [ OK ] 0.37 sec.
2026-02-05 15:40:07 00826_cross_to_inner_join: [ OK ] 0.43 sec.
2026-02-05 15:40:07 00957_neighbor: [ OK ] 0.32 sec.
2026-02-05 15:40:07 02518_rewrite_aggregate_function_with_if: [ OK ] 0.22 sec.
2026-02-05 15:40:07 00412_logical_expressions_optimizer: [ OK ] 0.22 sec.
2026-02-05 15:40:07 02724_function_in_left_table_clause_asof_join: [ OK ] 0.17 sec.
2026-02-05 15:40:07 02479_mysql_connect_to_self: [ OK ] 0.47 sec.
2026-02-05 15:40:07 03156_nullable_number_tips: [ OK ] 0.22 sec.
2026-02-05 15:40:07 01652_ignore_and_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:40:07 01691_DateTime64_clamp: [ OK ] 0.17 sec.
2026-02-05 15:40:07 02725_object_column_alter: [ OK ] 0.17 sec.
2026-02-05 15:40:08 03066_analyzer_global_with_statement: [ OK ] 0.17 sec.
2026-02-05 15:40:08 02662_sparse_columns_mutations_5: [ OK ] 0.17 sec.
2026-02-05 15:40:08 00479_date_and_datetime_to_number: [ OK ] 0.17 sec.
2026-02-05 15:40:08 00645_date_time_input_format: [ OK ] 0.17 sec.
2026-02-05 15:40:08 00564_enum_order: [ OK ] 0.52 sec.
2026-02-05 15:40:08 01246_finalize_aggregation_race: [ OK ] 0.17 sec.
2026-02-05 15:40:08 01656_test_hex_mysql_dialect: [ OK ] 0.18 sec.
2026-02-05 15:40:08 02491_part_log_has_table_uuid: [ OK ] 0.52 sec.
2026-02-05 15:40:09 03165_parseReadableSize: [ OK ] 0.63 sec.
2026-02-05 15:40:09 02943_variant_element: [ OK ] 0.22 sec.
2026-02-05 15:40:09 01913_if_int_decimal: [ OK ] 0.17 sec.
2026-02-05 15:40:09 01620_fix_simple_state_arg_type: [ OK ] 0.22 sec.
2026-02-05 15:40:10 00837_minmax_index_replicated_zookeeper_long: [ OK ] 0.57 sec.
2026-02-05 15:40:10 02286_convert_decimal_type: [ OK ] 0.17 sec.
2026-02-05 15:40:10 01947_multiple_pipe_read: [ OK ] 1.27 sec.
2026-02-05 15:40:10 01351_geohash_assert: [ OK ] 0.17 sec.
2026-02-05 15:40:10 00917_multiple_joins_denny_crane: [ OK ] 0.18 sec.
2026-02-05 15:40:12 02841_valid_json_and_xml_on_http_exception: [ OK ] 13.69 sec.
2026-02-05 15:40:13 00066_group_by_in: [ OK ] 0.17 sec.
2026-02-05 15:40:13 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.38 sec.
2026-02-05 15:40:13 02253_empty_part_checksums: [ OK ] 2.73 sec.
2026-02-05 15:40:13 00712_prewhere_with_final: [ OK ] 0.17 sec.
2026-02-05 15:40:15 02806_system_parts_columns_modification_time: [ OK ] 6.25 sec.
2026-02-05 15:40:15 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 5.14 sec.
2026-02-05 15:40:15 01660_join_or_all: [ OK ] 0.47 sec.
2026-02-05 15:40:15 01773_case_sensitive_revision: [ OK ] 0.12 sec.
2026-02-05 15:40:15 00294_shard_enums: [ OK ] 0.37 sec.
2026-02-05 15:40:15 02122_parallel_formatting_JSONStrings: [ OK ] 2.12 sec.
2026-02-05 15:40:16 00290_shard_aggregation_memory_efficient: [ OK ] 0.42 sec.
2026-02-05 15:40:16 01375_storage_file_write_prefix_csv_with_names: [ OK ] 0.17 sec.
2026-02-05 15:40:16 02771_resolve_compound_identifier: [ OK ] 0.22 sec.
2026-02-05 15:40:16 00633_func_or_in: [ OK ] 0.17 sec.
2026-02-05 15:40:16 02418_do_not_return_empty_blocks_from_ConvertingAggregatedToChunksTransform: [ OK ] 0.42 sec.
2026-02-05 15:40:16 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.17 sec.
2026-02-05 15:40:16 00808_array_enumerate_segfault: [ OK ] 0.17 sec.
2026-02-05 15:40:16 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 3.18 sec.
2026-02-05 15:40:16 00381_first_significant_subdomain: [ OK ] 0.17 sec.
2026-02-05 15:40:17 00804_test_custom_compression_codes_log_storages: [ OK ] 0.47 sec.
2026-02-05 15:40:17 01310_enum_comparison: [ OK ] 0.17 sec.
2026-02-05 15:40:17 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 1.78 sec.
2026-02-05 15:40:17 01000_bad_size_of_marks_skip_idx: [ OK ] 0.27 sec.
2026-02-05 15:40:18 01213_alter_rename_column: [ OK ] 0.32 sec.
2026-02-05 15:40:18 03094_transform_return_first: [ OK ] 0.17 sec.
2026-02-05 15:40:18 03156_tuple_map_low_cardinality: [ OK ] 1.57 sec.
2026-02-05 15:40:18 01555_system_distribution_queue_mask: [ OK ] 0.27 sec.
2026-02-05 15:40:18 01679_incorrect_data_on_insert_collapsing: [ OK ] 0.87 sec.
2026-02-05 15:40:18 01056_negative_with_bloom_filter: [ OK ] 0.22 sec.
2026-02-05 15:40:18 00715_bounding_ratio_merge_empty: [ OK ] 0.23 sec.
2026-02-05 15:40:18 02343_group_by_use_nulls: [ OK ] 0.22 sec.
2026-02-05 15:40:19 00953_moving_functions: [ OK ] 0.22 sec.
2026-02-05 15:40:19 01710_projection_mutation: [ OK ] 0.17 sec.
2026-02-05 15:40:19 02763_row_policy_storage_merge: [ OK ] 0.77 sec.
2026-02-05 15:40:20 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 0.47 sec.
2026-02-05 15:40:20 03032_redundant_equals: [ OK ] 0.32 sec.
2026-02-05 15:40:20 03229_json_null_as_default_for_tuple: [ OK ] 0.17 sec.
2026-02-05 15:40:21 02801_backup_native_copy: [ OK ] 2.48 sec.
2026-02-05 15:40:21 01786_nullable_string_tsv_at_eof: [ OK ] 1.02 sec.
2026-02-05 15:40:22 01603_insert_select_too_many_parts: [ OK ] 4.23 sec.
2026-02-05 15:40:22 02040_clickhouse_benchmark_query_id_pass_through: [ OK ] 0.87 sec.
2026-02-05 15:40:22 01944_range_max_elements: [ OK ] 0.17 sec.
2026-02-05 15:40:22 01704_transform_with_float_key: [ OK ] 0.17 sec.
2026-02-05 15:40:22 02841_parallel_replicas_summary: [ OK ] 0.97 sec.
2026-02-05 15:40:23 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.37 sec.
2026-02-05 15:40:23 03278_revoke_implicit_grants: [ OK ] 0.87 sec.
2026-02-05 15:40:23 00560_float_leading_plus_in_exponent: [ OK ] 0.17 sec.
2026-02-05 15:40:23 02932_group_by_null_fuzzer: [ OK ] 0.17 sec.
2026-02-05 15:40:23 00752_low_cardinality_mv_2: [ OK ] 0.22 sec.
2026-02-05 15:40:23 01813_quantileBfloat16_nans: [ OK ] 0.17 sec.
2026-02-05 15:40:23 01273_arrow_decimal: [ OK ] 1.07 sec.
2026-02-05 15:40:24 01522_validate_alter_default: [ OK ] 0.22 sec.
2026-02-05 15:40:24 01451_detach_drop_part: [ OK ] 0.27 sec.
2026-02-05 15:40:24 02477_is_null_parser: [ OK ] 0.17 sec.
2026-02-05 15:40:24 01932_global_in_function: [ OK ] 0.17 sec.
2026-02-05 15:40:24 01672_actions_dag_merge_crash: [ OK ] 0.17 sec.
2026-02-05 15:40:24 02493_numeric_literals_with_underscores: [ OK ] 0.52 sec.
2026-02-05 15:40:25 00810_in_operators_segfault: [ OK ] 0.17 sec.
2026-02-05 15:40:25 00663_tiny_log_empty_insert: [ OK ] 0.17 sec.
2026-02-05 15:40:25 01220_scalar_optimization_in_alter: [ OK ] 0.18 sec.
2026-02-05 15:40:25 01916_multiple_join_view_optimize_predicate_chertus: [ OK ] 0.17 sec.
2026-02-05 15:40:25 00780_unaligned_array_join: [ OK ] 0.17 sec.
2026-02-05 15:40:25 01760_modulo_negative: [ OK ] 0.12 sec.
2026-02-05 15:40:26 03207_json_read_subcolumns_2_memory: [ OK ] 37.07 sec.
2026-02-05 15:40:26 02542_transform_old: [ OK ] 0.27 sec.
2026-02-05 15:40:26 01514_parallel_formatting: [ OK ] 1.72 sec.
2026-02-05 15:40:26 00988_constraints_replication_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:40:26 00835_if_generic_case: [ OK ] 0.22 sec.
2026-02-05 15:40:27 01033_dictionaries_lifetime: [ OK ] 0.17 sec.
2026-02-05 15:40:27 02250_ON_CLUSTER_grant: [ OK ] 1.07 sec.
2026-02-05 15:40:27 02725_agg_projection_resprect_PK: [ OK ] 0.27 sec.
2026-02-05 15:40:27 02112_delayed_clickhouse_local: [ OK ] 0.47 sec.
2026-02-05 15:40:27 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.47 sec.
2026-02-05 15:40:27 01457_order_by_limit: [ OK ] 0.22 sec.
2026-02-05 15:40:28 02787_transform_null: [ OK ] 0.17 sec.
2026-02-05 15:40:28 01655_agg_if_nullable: [ OK ] 0.22 sec.
2026-02-05 15:40:28 02982_perf_introspection_for_inserts: [ OK ] 2.02 sec.
2026-02-05 15:40:28 00702_where_with_quailified_names: [ OK ] 0.17 sec.
2026-02-05 15:40:28 00900_long_parquet: [ OK ] 11.61 sec.
2026-02-05 15:40:28 00172_constexprs_in_set: [ OK ] 0.17 sec.
2026-02-05 15:40:28 02876_sort_union_of_sorted: [ OK ] 0.22 sec.
2026-02-05 15:40:29 01107_tuples_arrays_parsing_exceptions: [ OK ] 0.52 sec.
2026-02-05 15:40:29 02009_from_infile: [ OK ] 0.98 sec.
2026-02-05 15:40:29 00735_or_expr_optimize_bug: [ OK ] 0.17 sec.
2026-02-05 15:40:29 00753_comment_columns_zookeeper: [ OK ] 0.22 sec.
2026-02-05 15:40:29 02700_regexp_operator: [ OK ] 0.22 sec.
2026-02-05 15:40:29 01517_select_final_distributed: [ OK ] 0.22 sec.
2026-02-05 15:40:29 01825_type_json_8: [ OK ] 1.32 sec.
2026-02-05 15:40:29 03002_map_array_functions_with_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:40:29 02401_merge_tree_old_tmp_dirs_cleanup: [ OK ] 1.17 sec.
2026-02-05 15:40:29 00554_nested_and_table_engines: [ OK ] 0.32 sec.
2026-02-05 15:40:30 01716_array_difference_overflow: [ OK ] 0.17 sec.
2026-02-05 15:40:30 01096_zeros: [ OK ] 0.22 sec.
2026-02-05 15:40:30 01666_date_lut_buffer_overflow: [ OK ] 0.12 sec.
2026-02-05 15:40:30 00935_to_iso_week_first_year: [ OK ] 0.17 sec.
2026-02-05 15:40:30 00848_join_use_nulls_segfault: [ OK ] 0.32 sec.
2026-02-05 15:40:30 02111_json_column_name_encoding: [ OK ] 0.12 sec.
2026-02-05 15:40:30 01307_polygon_perimeter: [ OK ] 0.17 sec.
2026-02-05 15:40:30 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:40:30 01748_partition_id_pruning: [ OK ] 0.22 sec.
2026-02-05 15:40:31 02352_interactive_queries_from_file: [ OK ] 0.52 sec.
2026-02-05 15:40:31 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 1.68 sec.
2026-02-05 15:40:31 01273_arrow: [ OK ] 7.74 sec.
2026-02-05 15:40:31 02241_short_circuit_short_column: [ OK ] 0.17 sec.
2026-02-05 15:40:31 00081_int_div_or_zero: [ OK ] 0.17 sec.
2026-02-05 15:40:32 02131_remove_columns_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:40:32 03246_json_simd_rapid_parsers: [ OK ] 0.77 sec.
2026-02-05 15:40:32 02688_aggregate_states: [ OK ] 0.27 sec.
2026-02-05 15:40:32 03039_recursive_cte_postgres_5: [ OK ] 0.27 sec.
2026-02-05 15:40:32 00232_format_readable_size: [ OK ] 0.17 sec.
2026-02-05 15:40:32 01221_system_settings: [ OK ] 0.22 sec.
2026-02-05 15:40:32 01942_untuple_transformers_msan: [ OK ] 0.17 sec.
2026-02-05 15:40:32 01088_array_slice_of_aggregate_functions: [ OK ] 0.17 sec.
2026-02-05 15:40:32 00423_storage_log_single_thread: [ OK ] 0.17 sec.
2026-02-05 15:40:33 02293_selected_rows_and_merges: [ OK ] 1.82 sec.
2026-02-05 15:40:33 02571_local_desc_abort_on_twitter_json: [ OK ] 0.57 sec.
2026-02-05 15:40:33 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.12 sec.
2026-02-05 15:40:33 01822_union_and_constans_error: [ OK ] 0.17 sec.
2026-02-05 15:40:33 02017_create_distributed_table_coredump: [ OK ] 0.17 sec.
2026-02-05 15:40:34 02378_analyzer_projection_names: [ OK ] 0.87 sec.
2026-02-05 15:40:34 01015_insert_values_parametrized: [ OK ] 1.27 sec.
2026-02-05 15:40:34 02210_append_to_dev_dull: [ OK ] 0.17 sec.
2026-02-05 15:40:34 01545_url_file_format_settings: [ OK ] 0.17 sec.
2026-02-05 15:40:34 01315_count_distinct_return_not_nullable: [ OK ] 0.22 sec.
2026-02-05 15:40:34 02426_low_cardinality_fixed_string_insert_field: [ OK ] 0.57 sec.
2026-02-05 15:40:34 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.17 sec.
2026-02-05 15:40:35 01274_alter_rename_column_distributed: [ OK ] 0.22 sec.
2026-02-05 15:40:35 01882_check_max_parts_to_merge_at_once: [ OK ] 0.42 sec.
2026-02-05 15:40:35 01136_multiple_sets: [ OK ] 0.17 sec.
2026-02-05 15:40:35 02841_parallel_final_wrong_columns_order: [ OK ] 0.87 sec.
2026-02-05 15:40:35 01921_not_chain: [ OK ] 0.17 sec.
2026-02-05 15:40:36 02209_short_circuit_node_without_parents: [ OK ] 0.22 sec.
2026-02-05 15:40:36 02306_rowbinary_has_no_bom: [ OK ] 0.47 sec.
2026-02-05 15:40:36 01552_dict_fixedstring: [ OK ] 0.17 sec.
2026-02-05 15:40:36 03128_merge_tree_index_lazy_load: [ OK ] 0.17 sec.
2026-02-05 15:40:36 02496_remove_redundant_sorting: [ OK ] 5.54 sec.
2026-02-05 15:40:36 02494_parser_string_binary_literal: [ OK ] 0.17 sec.
2026-02-05 15:40:36 00928_multi_match_constant_constant: [ OK ] 0.17 sec.
2026-02-05 15:40:39 02114_hdfs_bad_url: [ OK ] 2.68 sec.
2026-02-05 15:40:39 00540_bad_data_types: [ OK ] 2.38 sec.
2026-02-05 15:40:39 03013_parser_regexp_recompilation: [ OK ] 0.52 sec.
2026-02-05 15:40:40 02593_bson_more_types: [ OK ] 0.77 sec.
2026-02-05 15:40:40 02991_count_rewrite_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:40:40 03034_json_extract_variant: [ OK ] 0.17 sec.
2026-02-05 15:40:41 02117_custom_separated_with_names_and_types: [ OK ] 7.39 sec.
2026-02-05 15:40:41 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.12 sec.
2026-02-05 15:40:41 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.17 sec.
2026-02-05 15:40:42 00502_sum_map: [ OK ] 0.32 sec.
2026-02-05 15:40:42 02353_compression_level: [ OK ] 3.23 sec.
2026-02-05 15:40:42 00385_storage_file_and_clickhouse-local_app_long: [ OK ] 6.44 sec.
2026-02-05 15:40:42 01448_json_compact_strings_each_row: [ OK ] 0.42 sec.
2026-02-05 15:40:42 02668_column_block_number_vertical_merge: [ OK ] 0.22 sec.
2026-02-05 15:40:42 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.17 sec.
2026-02-05 15:40:42 00910_crash_when_distributed_modify_order_by: [ OK ] 0.17 sec.
2026-02-05 15:40:42 00945_bloom_filter_index: [ OK ] 2.03 sec.
2026-02-05 15:40:42 00491_shard_distributed_and_aliases_in_where_having: [ OK ] 0.17 sec.
2026-02-05 15:40:42 03228_dynamic_subcolumns_from_subquery: [ OK ] 0.17 sec.
2026-02-05 15:40:43 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.22 sec.
2026-02-05 15:40:43 01882_scalar_subquery_exception: [ OK ] 0.22 sec.
2026-02-05 15:40:43 02538_alter_rename_sequence: [ OK ] 0.42 sec.
2026-02-05 15:40:43 02233_interpolate_1: [ OK ] 0.32 sec.
2026-02-05 15:40:43 01811_filter_by_null: [ OK ] 0.22 sec.
2026-02-05 15:40:43 01339_client_unrecognized_option: [ OK ] 0.62 sec.
2026-02-05 15:40:43 02429_combinators_in_array_reduce: [ OK ] 0.17 sec.
2026-02-05 15:40:43 01532_collate_in_low_cardinality: [ OK ] 0.22 sec.
2026-02-05 15:40:43 03041_analyzer_gigachad_join: [ OK ] 0.22 sec.
2026-02-05 15:40:44 02535_json_bson_each_row_curl: [ OK ] 1.07 sec.
2026-02-05 15:40:44 02415_all_new_functions_must_be_documented: [ OK ] 0.17 sec.
2026-02-05 15:40:44 00605_intersections_aggregate_functions: [ OK ] 0.17 sec.
2026-02-05 15:40:44 02374_analyzer_array_join: [ OK ] 0.27 sec.
2026-02-05 15:40:44 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.17 sec.
2026-02-05 15:40:44 02292_create_function_validate: [ OK ] 0.12 sec.
2026-02-05 15:40:44 02341_analyzer_aliases_basics: [ OK ] 0.37 sec.
2026-02-05 15:40:44 02335_column_ttl_expired_column_optimization: [ OK ] 0.62 sec.
2026-02-05 15:40:44 00875_join_right_nulls_ors: [ OK ] 0.27 sec.
2026-02-05 15:40:44 00736_disjunction_optimisation: [ OK ] 0.27 sec.
2026-02-05 15:40:44 01762_datetime64_extended_parsing: [ OK ] 0.17 sec.
2026-02-05 15:40:45 02902_topKGeneric_deserialization_memory: [ OK ] 0.22 sec.
2026-02-05 15:40:45 01431_utf8_ubsan: [ OK ] 0.12 sec.
2026-02-05 15:40:45 02981_translate_fixedstring: [ OK ] 0.17 sec.
2026-02-05 15:40:45 02176_optimize_aggregation_in_order_empty: [ OK ] 0.22 sec.
2026-02-05 15:40:46 02003_compress_bz2: [ OK ] 0.67 sec.
2026-02-05 15:40:46 00088_distinct_of_arrays_of_strings: [ OK ] 0.12 sec.
2026-02-05 15:40:47 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.47 sec.
2026-02-05 15:40:47 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.44 sec.
2026-02-05 15:40:47 01470_explain: [ OK ] 0.27 sec.
2026-02-05 15:40:47 01420_format_row: [ OK ] 0.47 sec.
2026-02-05 15:40:47 02029_output_csv_null_representation: [ OK ] 0.22 sec.
2026-02-05 15:40:47 00098_d_union_all: [ OK ] 0.17 sec.
2026-02-05 15:40:48 00670_truncate_temporary_table: [ OK ] 0.17 sec.
2026-02-05 15:40:48 00370_duplicate_columns_in_subqueries: [ OK ] 0.22 sec.
2026-02-05 15:40:48 00473_output_format_json_quote_denormals: [ OK ] 1.12 sec.
2026-02-05 15:40:49 00950_test_gorilla_codec: [ OK ] 0.22 sec.
2026-02-05 15:40:49 01307_bloom_filter_index_string_multi_granulas: [ OK ] 0.22 sec.
2026-02-05 15:40:49 02033_join_engine_deadlock_long: [ OK ] 1.67 sec.
2026-02-05 15:40:50 01732_explain_syntax_union_query: [ OK ] 0.17 sec.
2026-02-05 15:40:50 01825_new_type_json_nbagames: [ OK ] 5.24 sec.
2026-02-05 15:40:50 00098_j_union_all: [ OK ] 0.17 sec.
2026-02-05 15:40:50 03128_argMin_combinator_projection: [ OK ] 0.27 sec.
2026-02-05 15:40:50 02029_test_implemented_methods: [ OK ] 0.47 sec.
2026-02-05 15:40:50 03142_untuple_crash: [ OK ] 0.17 sec.
2026-02-05 15:40:51 03082_analyzer_left_join_correct_column: [ OK ] 0.17 sec.
2026-02-05 15:40:52 02048_clickhouse_local_stage: [ OK ] 0.92 sec.
2026-02-05 15:40:52 01786_explain_merge_tree: [ OK ] 3.08 sec.
2026-02-05 15:40:52 00975_recursive_materialized_view: [ OK ] 0.22 sec.
2026-02-05 15:40:52 02302_join_auto_lc_nullable_bug: [ OK ] 0.17 sec.
2026-02-05 15:40:52 02428_parameterized_view_param_in_select_section: [ OK ] 0.22 sec.
2026-02-05 15:40:52 03273_select_from_explain_ast_non_select: [ OK ] 0.17 sec.
2026-02-05 15:40:52 02815_fix_not_found_constants_col_in_block: [ OK ] 0.17 sec.
2026-02-05 15:40:53 00430_https_server: [ OK ] 0.42 sec.
2026-02-05 15:40:53 02007_join_use_nulls: [ OK ] 0.27 sec.
2026-02-05 15:40:53 03209_json_type_merges_small: [ OK ] 3.38 sec.
2026-02-05 15:40:54 02177_issue_31009: [ OK ] 9.70 sec.
2026-02-05 15:40:54 03272_client_highlighting_bug: [ OK ] 0.72 sec.
2026-02-05 15:40:55 00524_time_intervals_months_underflow: [ OK ] 0.32 sec.
2026-02-05 15:40:55 01137_order_by_func: [ OK ] 1.22 sec.
2026-02-05 15:40:56 02907_clickhouse_dictionary_bug: [ OK ] 0.57 sec.
2026-02-05 15:40:56 00407_parsing_nulls: [ OK ] 2.83 sec.
2026-02-05 15:40:56 00712_prewhere_with_sampling_and_alias: [ OK ] 0.17 sec.
2026-02-05 15:40:57 02150_index_hypothesis_race_long: [ OK ] 5.09 sec.
2026-02-05 15:40:58 02306_part_types_profile_events: [ OK ] 0.37 sec.
2026-02-05 15:40:58 03036_dynamic_read_subcolumns_small: [ OK ] 0.78 sec.
2026-02-05 15:40:59 02427_msan_group_array_resample: [ OK ] 0.17 sec.
2026-02-05 15:40:59 01070_exception_code_in_query_log_table: [ OK ] 0.22 sec.
2026-02-05 15:40:59 02151_hash_table_sizes_stats_joins: [ OK ] 2.94 sec.
2026-02-05 15:40:59 00878_join_unexpected_results: [ OK ] 0.27 sec.
2026-02-05 15:40:59 02354_tuple_element_with_default: [ OK ] 0.17 sec.
2026-02-05 15:40:59 02343_create_empty_as_select: [ OK ] 0.22 sec.
2026-02-05 15:40:59 02296_ttl_non_deterministic: [ OK ] 0.32 sec.
2026-02-05 15:41:00 02286_vertical_merges_missed_column: [ OK ] 0.22 sec.
2026-02-05 15:41:00 00754_alter_modify_order_by_replicated_zookeeper_long: [ OK ] 30.47 sec.
2026-02-05 15:41:00 02668_logical_optimizer_removing_redundant_checks: [ OK ] 0.17 sec.
2026-02-05 15:41:00 00938_dataset_test: [ OK ] 0.17 sec.
2026-02-05 15:41:00 01072_json_each_row_data_in_square_brackets: [ OK ] 0.17 sec.
2026-02-05 15:41:00 01050_clickhouse_dict_source_with_subquery: [ OK ] 0.22 sec.
2026-02-05 15:41:00 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.17 sec.
2026-02-05 15:41:00 03199_join_with_materialized_column: [ OK ] 0.22 sec.
2026-02-05 15:41:00 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.22 sec.
2026-02-05 15:41:00 03215_varian_as_common_type_integers: [ OK ] 0.17 sec.
2026-02-05 15:41:00 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.12 sec.
2026-02-05 15:41:00 01648_mutations_and_escaping: [ OK ] 5.79 sec.
2026-02-05 15:41:01 01056_prepared_statements_null_and_escaping: [ OK ] 0.52 sec.
2026-02-05 15:41:01 00164_not_chain: [ OK ] 0.12 sec.
2026-02-05 15:41:01 00918_has_unsufficient_type_check: [ OK ] 0.17 sec.
2026-02-05 15:41:01 03155_test_move_to_prewhere: [ OK ] 0.82 sec.
2026-02-05 15:41:01 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.22 sec.
2026-02-05 15:41:01 01171_mv_select_insert_isolation_long: [ OK ] 90.69 sec.
2026-02-05 15:41:01 01710_force_use_projection: [ OK ] 0.17 sec.
2026-02-05 15:41:01 03096_largest_triangle_3b_crash: [ OK ] 0.12 sec.
2026-02-05 15:41:02 03254_uniq_exact_two_level_negative_zero: [ OK ] 0.32 sec.
2026-02-05 15:41:02 02177_sum_if_not_found: [ OK ] 0.27 sec.
2026-02-05 15:41:02 01285_data_skip_index_over_aggregation: [ OK ] 0.27 sec.
2026-02-05 15:41:02 02538_ngram_bf_index_with_null: [ OK ] 0.17 sec.
2026-02-05 15:41:02 02456_BLAKE3_hash_function_test: [ OK ] 0.17 sec.
2026-02-05 15:41:02 02918_optimize_count_for_merge_tables: [ OK ] 0.22 sec.
2026-02-05 15:41:02 00912_string_comparison: [ OK ] 0.22 sec.
2026-02-05 15:41:02 01597_columns_list_ignored: [ OK ] 0.62 sec.
2026-02-05 15:41:03 02910_rocksdb_optimize: [ OK ] 0.22 sec.
2026-02-05 15:41:03 01088_window_view_default_column: [ OK ] 1.17 sec.
2026-02-05 15:41:03 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 2.98 sec.
2026-02-05 15:41:03 01051_same_name_alias_with_joins: [ OK ] 0.22 sec.
2026-02-05 15:41:04 02285_executable_user_defined_function_group_by: [ OK ] 0.42 sec.
2026-02-05 15:41:04 00306_insert_values_and_expressions: [ OK ] 0.32 sec.
2026-02-05 15:41:04 03049_analyzer_group_by_alias: [ OK ] 0.17 sec.
2026-02-05 15:41:04 00098_9_union_all: [ OK ] 0.12 sec.
2026-02-05 15:41:04 00952_input_function: [ OK ] 4.03 sec.
2026-02-05 15:41:04 01318_parallel_final_stuck: [ OK ] 0.17 sec.
2026-02-05 15:41:04 00098_k_union_all: [ OK ] 0.17 sec.
2026-02-05 15:41:04 00752_low_cardinality_left_array_join: [ OK ] 0.22 sec.
2026-02-05 15:41:04 01388_multi_if_optimization: [ OK ] 0.17 sec.
2026-02-05 15:41:04 02588_parquet_bug: [ OK ] 0.77 sec.
2026-02-05 15:41:05 03130_analyzer_array_join_prefer_column: [ OK ] 0.17 sec.
2026-02-05 15:41:05 01135_default_and_alter_zookeeper: [ OK ] 0.27 sec.
2026-02-05 15:41:05 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.22 sec.
2026-02-05 15:41:05 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:41:05 01666_merge_tree_max_query_limit: [ OK ] 2.83 sec.
2026-02-05 15:41:06 00346_if_tuple: [ OK ] 0.18 sec.
2026-02-05 15:41:06 01639_distributed_sync_insert_zero_rows: [ OK ] 0.22 sec.
2026-02-05 15:41:06 02100_multiple_hosts_command_line_set: [ OK ] 60.37 sec.
2026-02-05 15:41:06 02907_backup_mv_with_no_inner_table: [ OK ] 1.17 sec.
2026-02-05 15:41:06 01060_defaults_all_columns: [ OK ] 0.22 sec.
2026-02-05 15:41:06 02475_precise_decimal_arithmetics: [ OK ] 0.37 sec.
2026-02-05 15:41:06 02716_drop_if_empty: [ OK ] 0.22 sec.
2026-02-05 15:41:06 02357_file_default_value: [ OK ] 0.17 sec.
2026-02-05 15:41:06 00972_desc_table_virtual_columns: [ OK ] 0.17 sec.
2026-02-05 15:41:07 02903_bug_43644: [ OK ] 0.22 sec.
2026-02-05 15:41:07 03101_analyzer_identifiers_1: [ OK ] 0.22 sec.
2026-02-05 15:41:07 01417_update_permutation_crash: [ OK ] 0.17 sec.
2026-02-05 15:41:07 02864_replace_partition_with_duplicated_parts_zookeeper: [ OK ] 2.48 sec.
2026-02-05 15:41:07 00725_comment_columns_long: [ OK ] 0.22 sec.
2026-02-05 15:41:07 02502_analyzer_insert_select_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:41:07 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 0.67 sec.
2026-02-05 15:41:07 00937_test_use_header_csv: [ OK ] 2.48 sec.
2026-02-05 15:41:08 02477_s3_request_throttler: [ OK ] 1.78 sec.
2026-02-05 15:41:08 03148_async_queries_in_query_log_errors: [ OK ] 1.12 sec.
2026-02-05 15:41:08 02534_s3_heap_use_after_free: [ OK ] 0.17 sec.
2026-02-05 15:41:08 01281_parseDateTime64BestEffort: [ OK ] 0.47 sec.
2026-02-05 15:41:08 01318_encrypt: [ OK ] 0.72 sec.
2026-02-05 15:41:08 02684_bson: [ OK ] 0.12 sec.
2026-02-05 15:41:08 01044_h3_edge_angle: [ OK ] 0.17 sec.
2026-02-05 15:41:08 01011_test_create_as_skip_indices: [ OK ] 0.17 sec.
2026-02-05 15:41:09 01710_aggregate_projection_with_grouping_set: [ OK ] 0.17 sec.
2026-02-05 15:41:09 00753_alter_destination_for_storage_buffer: [ OK ] 0.27 sec.
2026-02-05 15:41:09 03167_parametrized_view_with_cte: [ OK ] 0.17 sec.
2026-02-05 15:41:09 01553_settings_early_apply: [ OK ] 0.22 sec.
2026-02-05 15:41:09 02122_parallel_formatting_XML: [ OK ] 1.62 sec.
2026-02-05 15:41:09 00753_quantile_format: [ OK ] 0.32 sec.
2026-02-05 15:41:09 02375_double_escaping_json: [ OK ] 0.12 sec.
2026-02-05 15:41:09 00112_shard_totals_after_having: [ OK ] 0.17 sec.
2026-02-05 15:41:09 02112_delayed_clickhouse_local_with_queries_file: [ OK ] 0.52 sec.
2026-02-05 15:41:09 00692_if_exception_code: [ OK ] 0.17 sec.
2026-02-05 15:41:09 00182_functions_higher_order_and_consts: [ OK ] 0.97 sec.
2026-02-05 15:41:10 02496_from_unixtime_in_joda_syntax: [ OK ] 0.27 sec.
2026-02-05 15:41:10 02968_analyzer_join_column_not_found: [ OK ] 0.17 sec.
2026-02-05 15:41:10 02287_ephemeral_format_crash: [ OK ] 0.22 sec.
2026-02-05 15:41:10 03035_morton_encode_no_rows: [ OK ] 0.27 sec.
2026-02-05 15:41:10 03095_merge_and_buffer_tables: [ OK ] 0.32 sec.
2026-02-05 15:41:11 02382_analyzer_matcher_join_using: [ OK ] 0.65 sec.
2026-02-05 15:41:11 02844_tsv_carriage_return_parallel_parsing: [ OK ] 0.84 sec.
2026-02-05 15:41:11 01922_sum_null_for_remote: [ OK ] 0.27 sec.
2026-02-05 15:41:11 01373_is_zero_or_null: [ OK ] 0.35 sec.
2026-02-05 15:41:12 02681_undrop_query_uuid: [ OK ] 2.04 sec.
2026-02-05 15:41:12 02730_with_fill_by_sorting_prefix: [ OK ] 0.63 sec.
2026-02-05 15:41:13 02919_ddsketch_quantile: [ OK ] 0.48 sec.
2026-02-05 15:41:13 02481_async_insert_dedup_token: [ OK ] 96.38 sec.
2026-02-05 15:41:13 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.74 sec.
2026-02-05 15:41:13 02993_lazy_index_loading: [ OK ] 2.19 sec.
2026-02-05 15:41:13 01632_tinylog_read_write: [ OK ] 10.41 sec.
2026-02-05 15:41:13 03002_analyzer_prewhere: [ OK ] 0.27 sec.
2026-02-05 15:41:13 02952_conjunction_optimization: [ OK ] 0.22 sec.
2026-02-05 15:41:13 00490_with_select: [ OK ] 0.18 sec.
2026-02-05 15:41:13 02695_storage_join_insert_select_deadlock: [ OK ] 0.28 sec.
2026-02-05 15:41:14 01556_accurate_cast_or_null: [ OK ] 0.63 sec.
2026-02-05 15:41:14 02905_structure_to_schema_bad_names: [ OK ] 0.77 sec.
2026-02-05 15:41:14 00939_limit_by_offset: [ OK ] 0.22 sec.
2026-02-05 15:41:14 00903_array_with_constant_function: [ OK ] 0.23 sec.
2026-02-05 15:41:14 01607_arrays_as_nested_csv: [ OK ] 1.13 sec.
2026-02-05 15:41:14 02174_cte_scalar_cache: [ OK ] 1.44 sec.
2026-02-05 15:41:15 02391_hashed_dictionary_shards: [ OK ] 0.73 sec.
2026-02-05 15:41:15 02425_categorical_information_value_properties: [ OK ] 0.38 sec.
2026-02-05 15:41:15 02244_casewithexpression_return_type: [ OK ] 0.18 sec.
2026-02-05 15:41:15 01412_mod_float: [ OK ] 0.24 sec.
2026-02-05 15:41:15 02514_bad_index_granularity: [ OK ] 0.17 sec.
2026-02-05 15:41:15 02499_read_json_objects_as_strings: [ OK ] 0.18 sec.
2026-02-05 15:41:15 01582_move_to_prewhere_compact_parts: [ OK ] 0.23 sec.
2026-02-05 15:41:15 02980_s3_plain_DROP_TABLE_MergeTree: [ OK ] 1.64 sec.
2026-02-05 15:41:15 02223_insert_select_schema_inference: [ OK ] 0.18 sec.
2026-02-05 15:41:15 03127_argMin_combinator_state: [ OK ] 0.22 sec.
2026-02-05 15:41:16 01926_bin_unbin: [ OK ] 0.49 sec.
2026-02-05 15:41:16 02346_into_outfile_and_stdout: [ OK ] 1.38 sec.
2026-02-05 15:41:16 02413_replace_partition_zero_copy: [ OK ] 0.92 sec.
2026-02-05 15:41:16 00834_limit_with_constant_expressions: [ OK ] 0.34 sec.
2026-02-05 15:41:17 01905_to_json_string: [ OK ] 0.17 sec.
2026-02-05 15:41:17 02860_distributed_flush_on_detach: [ OK ] 0.33 sec.
2026-02-05 15:41:17 00528_const_of_nullable: [ OK ] 0.23 sec.
2026-02-05 15:41:17 01762_deltasumtimestamp: [ OK ] 0.22 sec.
2026-02-05 15:41:17 02966_topk_counts_approx_count_sum: [ OK ] 0.28 sec.
2026-02-05 15:41:18 01055_minmax_index_compact_parts: [ OK ] 1.53 sec.
2026-02-05 15:41:19 01415_sticking_mutations: [ OK ] 11.26 sec.
2026-02-05 15:41:19 01256_misspell_layout_name_podshumok: [ OK ] 0.29 sec.
2026-02-05 15:41:20 03032_rmt_create_columns_from_replica: [ OK ] 0.41 sec.
2026-02-05 15:41:20 00417_kill_query: [ OK ] 2.84 sec.
2026-02-05 15:41:20 02357_query_cancellation_race: [ OK ] 6.39 sec.
2026-02-05 15:41:20 02899_restore_parts_replicated_merge_tree: [ OK ] 4.69 sec.
2026-02-05 15:41:20 03204_distributed_with_scalar_subquery: [ OK ] 0.40 sec.
2026-02-05 15:41:21 01518_nullable_aggregate_states2: [ OK ] 3.45 sec.
2026-02-05 15:41:21 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.90 sec.
2026-02-05 15:41:21 02919_segfault_nullable_materialized_update: [ OK ] 0.42 sec.
2026-02-05 15:41:21 01720_type_map_and_casts: [ OK ] 1.03 sec.
2026-02-05 15:41:21 01440_big_int_exotic_casts: [ OK ] 0.95 sec.
2026-02-05 15:41:22 03228_virtual_column_merge_dist: [ OK ] 0.64 sec.
2026-02-05 15:41:22 01418_custom_settings: [ OK ] 0.96 sec.
2026-02-05 15:41:22 01685_json_extract_double_as_float: [ OK ] 0.36 sec.
2026-02-05 15:41:23 00622_select_in_parens: [ OK ] 0.34 sec.
2026-02-05 15:41:23 01361_fover_remote_num_tries: [ OK ] 1.24 sec.
2026-02-05 15:41:24 03257_json_escape_file_names: [ OK ] 0.54 sec.
2026-02-05 15:41:24 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.32 sec.
2026-02-05 15:41:24 02154_bit_slice_for_fixedstring: [ OK ] 1.19 sec.
2026-02-05 15:41:25 01825_type_json_mutations: [ OK ] 0.38 sec.
2026-02-05 15:41:26 01037_polygon_dicts_correctness_all: [ OK ] 5.29 sec.
2026-02-05 15:41:27 00965_logs_level_bugfix: [ OK ] 2.00 sec.
2026-02-05 15:41:27 00763_long_lock_buffer_alter_destination_table: [ OK ] 30.71 sec.
2026-02-05 15:41:27 00222_sequence_aggregate_function_family: [ OK ] 0.64 sec.
2026-02-05 15:41:27 01493_alter_remove_properties_zookeeper: [ OK ] 0.50 sec.
2026-02-05 15:41:27 02915_analyzer_fuzz_1: [ OK ] 0.29 sec.
2026-02-05 15:41:28 00839_bitmask_negative: [ OK ] 0.28 sec.
2026-02-05 15:41:28 01456_low_cardinality_sorting_bugfix: [ OK ] 0.39 sec.
2026-02-05 15:41:28 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.38 sec.
2026-02-05 15:41:28 00534_functions_bad_arguments1: [ OK ] 6.76 sec.
2026-02-05 15:41:28 00124_shard_distributed_with_many_replicas: [ OK ] 0.28 sec.
2026-02-05 15:41:28 02356_trivial_count_with_empty_set: [ OK ] 0.27 sec.
2026-02-05 15:41:29 02347_rank_corr_size_overflow: [ OK ] 1.25 sec.
2026-02-05 15:41:30 02842_capn_proto_outfile_without_schema: [ OK ] 0.90 sec.
2026-02-05 15:41:30 02458_empty_hdfs_url: [ OK ] 0.39 sec.
2026-02-05 15:41:35 02483_elapsed_time: [ OK ] 10.67 sec.
2026-02-05 15:41:35 02380_insert_mv_race: [ OK ] 7.40 sec.
2026-02-05 15:41:35 01278_random_string_utf8: [ OK ] 6.00 sec.
2026-02-05 15:41:35 02014_map_different_keys: [ OK ] 0.34 sec.
2026-02-05 15:41:35 01891_not_in_partition_prune: [ OK ] 5.16 sec.
2026-02-05 15:41:35 01045_dictionaries_restrictions: [ OK ] 0.33 sec.
2026-02-05 15:41:35 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.47 sec.
2026-02-05 15:41:36 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.22 sec.
2026-02-05 15:41:36 00486_if_fixed_string: [ OK ] 0.27 sec.
2026-02-05 15:41:36 00520_tuple_values_interpreter: [ OK ] 0.22 sec.
2026-02-05 15:41:36 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 16.46 sec.
2026-02-05 15:41:37 01271_http_code_parse_error: [ OK ] 1.34 sec.
2026-02-05 15:41:38 03262_column_sizes_with_dynamic_structure: [ OK ] 8.09 sec.
2026-02-05 15:41:38 01926_json_as_string_array: [ OK ] 1.54 sec.
2026-02-05 15:41:38 01780_column_sparse_filter: [ OK ] 0.32 sec.
2026-02-05 15:41:38 00109_shard_totals_after_having: [ OK ] 1.41 sec.
2026-02-05 15:41:39 00700_to_decimal_or_something_1: [ OK ] 1.19 sec.
2026-02-05 15:41:40 00226_zookeeper_deduplication_and_unexpected_parts_long: [ OK ] 0.52 sec.
2026-02-05 15:41:40 00905_compile_expressions_compare_big_dates: [ OK ] 0.22 sec.
2026-02-05 15:41:40 01825_type_json_nbagames: [ OK ] 4.78 sec.
2026-02-05 15:41:40 02386_set_columns_order: [ OK ] 0.23 sec.
2026-02-05 15:41:41 02531_two_level_aggregation_bug: [ OK ] 2.14 sec.
2026-02-05 15:41:41 03231_pr_duplicate_announcement: [ OK ] 0.58 sec.
2026-02-05 15:41:41 02710_topk_with_empty_array: [ OK ] 0.35 sec.
2026-02-05 15:41:41 02100_low_cardinality_nullable_null_default: [ OK ] 5.50 sec.
2026-02-05 15:41:41 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.34 sec.
2026-02-05 15:41:41 01251_string_comparison: [ OK ] 0.27 sec.
2026-02-05 15:41:41 00384_column_aggregate_function_insert_from: [ OK ] 0.35 sec.
2026-02-05 15:41:41 03047_analyzer_alias_join: [ OK ] 0.29 sec.
2026-02-05 15:41:41 00452_left_array_join_and_nullable: [ OK ] 0.28 sec.
2026-02-05 15:41:42 02001_select_with_filter: [ OK ] 0.30 sec.
2026-02-05 15:41:42 01550_type_map_formats: [ OK ] 0.43 sec.
2026-02-05 15:41:42 00814_parsing_ub: [ OK ] 0.31 sec.
2026-02-05 15:41:42 02963_invalid_identifier: [ OK ] 0.29 sec.
2026-02-05 15:41:43 00386_enum_in_pk: [ OK ] 0.67 sec.
2026-02-05 15:41:43 02207_ttl_move_if_exists: [ OK ] 0.17 sec.
2026-02-05 15:41:43 00965_send_logs_level_concurrent_queries: [ OK ] 1.33 sec.
2026-02-05 15:41:43 02518_qualified_asterisks_alias_table_name: [ OK ] 0.33 sec.
2026-02-05 15:41:43 01414_freeze_does_not_prevent_alters: [ OK ] 0.34 sec.
2026-02-05 15:41:44 02013_lc_nullable_and_infinity: [ OK ] 0.22 sec.
2026-02-05 15:41:44 01535_decimal_round_scale_overflow_check: [ OK ] 0.17 sec.
2026-02-05 15:41:44 00907_set_index_with_nullable_and_low_cardinality_bug: [ OK ] 0.25 sec.
2026-02-05 15:41:44 02579_parameterized_replace: [ OK ] 0.22 sec.
2026-02-05 15:41:44 02125_many_mutations: [ OK ] 34.88 sec.
2026-02-05 15:41:44 01337_mysql_global_variables: [ OK ] 0.18 sec.
2026-02-05 15:41:44 00999_settings_no_extra_quotes: [ OK ] 0.22 sec.
2026-02-05 15:41:44 00239_type_conversion_in_in: [ OK ] 0.23 sec.
2026-02-05 15:41:45 02575_merge_prewhere_ephemeral: [ OK ] 0.50 sec.
2026-02-05 15:41:45 00082_append_trailing_char_if_absent: [ OK ] 0.17 sec.
2026-02-05 15:41:45 00999_join_not_nullable_types: [ OK ] 0.28 sec.
2026-02-05 15:41:45 02459_low_cardinality_uint128_aggregator: [ OK ] 0.67 sec.
2026-02-05 15:41:45 02677_analyzer_compound_expressions: [ OK ] 0.39 sec.
2026-02-05 15:41:46 00121_drop_column_zookeeper: [ OK ] 0.44 sec.
2026-02-05 15:41:46 01283_max_threads_simple_query_optimization: [ OK ] 0.94 sec.
2026-02-05 15:41:46 02478_analyzer_table_expression_aliases: [ OK ] 0.55 sec.
2026-02-05 15:41:46 01372_remote_table_function_empty_table: [ OK ] 0.17 sec.
2026-02-05 15:41:47 02098_hashed_array_dictionary_simple_key: [ OK ] 8.03 sec.
2026-02-05 15:41:47 00301_csv: [ OK ] 5.21 sec.
2026-02-05 15:41:47 02111_function_mapExtractKeyLike: [ OK ] 0.38 sec.
2026-02-05 15:41:47 02497_storage_join_right_assert: [ OK ] 0.23 sec.
2026-02-05 15:41:47 00302_http_compression: [ OK ] 2.14 sec.
2026-02-05 15:41:47 03000_virtual_columns_in_prewhere: [ OK ] 0.37 sec.
2026-02-05 15:41:47 01710_projections_and_duplicate_columms: [ OK ] 0.37 sec.
2026-02-05 15:41:47 02070_join_on_disk: [ OK ] 0.32 sec.
2026-02-05 15:41:48 02493_analyzer_uniq_injective_functions_elimination: [ OK ] 0.40 sec.
2026-02-05 15:41:48 02461_cancel_finish_race: [ OK ] 30.44 sec.
2026-02-05 15:41:48 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 1.14 sec.
2026-02-05 15:41:48 00748_insert_array_with_null: [ OK ] 0.48 sec.
2026-02-05 15:41:48 00989_parallel_parts_loading: [ OK ] 6.57 sec.
2026-02-05 15:41:49 02416_json_tuple_to_array_schema_inference: [ OK ] 0.22 sec.
2026-02-05 15:41:49 03035_dynamic_sorting: [ OK ] 0.57 sec.
2026-02-05 15:41:49 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.53 sec.
2026-02-05 15:41:49 01043_geo_distance: [ OK ] 0.34 sec.
2026-02-05 15:41:50 02360_rename_table_along_with_log_name: [ OK ] 1.47 sec.
2026-02-05 15:41:50 02024_compression_in_query: [ OK ] 3.07 sec.
2026-02-05 15:41:50 00569_parse_date_time_best_effort: [ OK ] 0.22 sec.
2026-02-05 15:41:50 02476_fix_lambda_parsing: [ OK ] 0.63 sec.
2026-02-05 15:41:50 00700_decimal_casts_2: [ OK ] 1.33 sec.
2026-02-05 15:41:50 00753_system_columns_and_system_tables_long: [ OK ] 0.57 sec.
2026-02-05 15:41:50 01073_grant_and_revoke: [ OK ] 0.27 sec.
2026-02-05 15:41:50 00219_full_right_join_column_order: [ OK ] 0.22 sec.
2026-02-05 15:41:52 02883_zookeeper_finalize_stress: [ OK ] 4.77 sec.
2026-02-05 15:41:52 02345_create_table_allow_trailing_comma: [ OK ] 0.17 sec.
2026-02-05 15:41:53 02125_lz4_compression_bug_TSV: [ OK ] 3.88 sec.
2026-02-05 15:41:53 01352_add_datetime_bad_get: [ OK ] 0.17 sec.
2026-02-05 15:41:53 00652_mergetree_mutations: [ OK ] 6.01 sec.
2026-02-05 15:41:53 01342_query_parameters_alias: [ OK ] 0.62 sec.
2026-02-05 15:41:53 02692_multiple_joins_unicode: [ OK ] 0.22 sec.
2026-02-05 15:41:53 01018_ddl_dictionaries_special: [ OK ] 0.27 sec.
2026-02-05 15:41:53 02811_insert_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:41:53 03054_analyzer_join_alias: [ OK ] 0.22 sec.
2026-02-05 15:41:53 01395_limit_more_cases: [ OK ] 17.42 sec.
2026-02-05 15:41:54 00623_truncate_all_tables: [ OK ] 0.32 sec.
2026-02-05 15:41:54 00905_field_with_aggregate_function_state: [ OK ] 0.17 sec.
2026-02-05 15:41:54 00261_storage_aliases_and_array_join: [ OK ] 0.52 sec.
2026-02-05 15:41:54 02310_clickhouse_client_INSERT_progress_profile_events: [ OK ] 0.73 sec.
2026-02-05 15:41:54 02893_system_drop_schema_cache_format: [ OK ] 0.17 sec.
2026-02-05 15:41:54 02916_distributed_skip_unavailable_shards: [ OK ] 0.17 sec.
2026-02-05 15:41:54 02885_create_distributed_table_without_as: [ OK ] 0.22 sec.
2026-02-05 15:41:54 02028_tokens: [ OK ] 0.22 sec.
2026-02-05 15:41:54 02244_ip_address_invalid_insert: [ OK ] 0.37 sec.
2026-02-05 15:41:54 01676_reinterpret_as: [ OK ] 0.27 sec.
2026-02-05 15:41:55 02734_sparse_columns_short_circuit: [ OK ] 0.22 sec.
2026-02-05 15:41:55 03001_analyzer_nullable_nothing: [ OK ] 0.17 sec.
2026-02-05 15:41:55 01780_range_msan: [ OK ] 0.12 sec.
2026-02-05 15:41:55 00904_array_with_constant_2: [ OK ] 0.17 sec.
2026-02-05 15:41:55 00712_prewhere_with_alias_and_virtual_column: [ OK ] 0.22 sec.
2026-02-05 15:41:55 02536_distributed_detach_table: [ OK ] 0.22 sec.
2026-02-05 15:41:55 01514_distributed_cancel_query_on_error: [ OK ] 1.63 sec.
2026-02-05 15:41:55 01071_in_array: [ OK ] 0.17 sec.
2026-02-05 15:41:56 01019_parallel_parsing_cancel: [ OK ] 5.15 sec.
2026-02-05 15:41:56 01099_parallel_distributed_insert_select: [ OK ] 0.97 sec.
2026-02-05 15:41:56 03274_format_inference_create_query_file: [ OK ] 0.62 sec.
2026-02-05 15:41:56 00921_datetime64_compatibility_long: [ OK ] 5.74 sec.
2026-02-05 15:41:56 02155_binary_op_between_float_and_decimal: [ OK ] 0.37 sec.
2026-02-05 15:41:56 00951_ngram_search: [ OK ] 0.77 sec.
2026-02-05 15:41:56 02158_contingency: [ OK ] 0.17 sec.
2026-02-05 15:41:57 00054_join_string: [ OK ] 0.17 sec.
2026-02-05 15:41:57 02784_disable_async_with_dedup_correctly: [ OK ] 6.65 sec.
2026-02-05 15:41:57 02426_create_suspicious_fixed_string: [ OK ] 0.17 sec.
2026-02-05 15:41:57 00258_materializing_tuples: [ OK ] 0.22 sec.
2026-02-05 15:41:57 01451_normalize_query: [ OK ] 0.32 sec.
2026-02-05 15:41:57 01677_array_enumerate_bug: [ OK ] 0.12 sec.
2026-02-05 15:41:57 00920_multiply_aggregate_states_constants: [ OK ] 0.22 sec.
2026-02-05 15:41:58 01509_check_parallel_quorum_inserts_long: [ OK ] 1.32 sec.
2026-02-05 15:41:58 00394_replaceall_vector_fixed: [ OK ] 0.27 sec.
2026-02-05 15:41:58 02973_dictionary_table_exception_fix: [ OK ] 0.17 sec.
2026-02-05 15:41:58 00264_uniq_many_args: [ OK ] 0.42 sec.
2026-02-05 15:41:58 01064_window_view_event_hop_to_bounded: [ OK ] 1.43 sec.
2026-02-05 15:41:58 02481_low_cardinality_with_short_circuit_functins_mutations: [ OK ] 0.22 sec.
2026-02-05 15:41:58 00403_to_start_of_day: [ OK ] 0.12 sec.
2026-02-05 15:41:59 02911_join_on_nullsafe_optimization: [ OK ] 0.32 sec.
2026-02-05 15:41:59 03001_backup_matview_after_modify_query: [ OK ] 1.53 sec.
2026-02-05 15:42:01 00956_sensitive_data_masking: [ OK ] 4.03 sec.
2026-02-05 15:42:01 00624_length_utf8: [ OK ] 0.17 sec.
2026-02-05 15:42:01 01593_insert_settings: [ OK ] 0.27 sec.
2026-02-05 15:42:02 01922_client_param: [ OK ] 0.72 sec.
2026-02-05 15:42:02 00045_sorting_by_fixed_string_descending: [ OK ] 0.17 sec.
2026-02-05 15:42:02 02124_insert_deduplication_token_replica: [ OK ] 0.37 sec.
2026-02-05 15:42:03 01889_key_condition_function_chains: [ OK ] 0.27 sec.
2026-02-05 15:42:03 01557_max_parallel_replicas_no_sample: [ OK ] 0.27 sec.
2026-02-05 15:42:03 01195_formats_diagnostic_info: [ OK ] 7.94 sec.
2026-02-05 15:42:03 01112_check_table_with_index: [ OK ] 0.17 sec.
2026-02-05 15:42:03 02366_with_fill_date: [ OK ] 0.13 sec.
2026-02-05 15:42:03 00048_a_stored_aggregates_merge: [ OK ] 0.22 sec.
2026-02-05 15:42:04 02890_untuple_column_names: [ OK ] 0.22 sec.
2026-02-05 15:42:04 01320_optimize_skip_unused_shards_no_non_deterministic: [ OK ] 0.17 sec.
2026-02-05 15:42:04 01755_client_highlight_multi_line_comment_regression: [ OK ] 0.52 sec.
2026-02-05 15:42:04 02128_hex_bin_on_uuid: [ OK ] 0.17 sec.
2026-02-05 15:42:04 01707_join_use_nulls: [ OK ] 0.22 sec.
2026-02-05 15:42:04 02268_json_wrong_root_type_in_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:42:04 02502_fuzz_bad_cast_to_ast_literal: [ OK ] 0.17 sec.
2026-02-05 15:42:04 01012_select_limit_x_0: [ OK ] 0.17 sec.
2026-02-05 15:42:05 01415_table_function_view: [ OK ] 0.17 sec.
2026-02-05 15:42:05 02384_nullable_low_cardinality_as_dict_in_arrow: [ OK ] 0.17 sec.
2026-02-05 15:42:05 00926_adaptive_index_granularity_versioned_collapsing_merge_tree: [ OK ] 0.42 sec.
2026-02-05 15:42:05 01010_pmj_on_disk: [ OK ] 0.17 sec.
2026-02-05 15:42:05 01533_sum_if_nullable_bug: [ OK ] 0.27 sec.
2026-02-05 15:42:05 02971_functions_to_subcolumns_map: [ OK ] 0.22 sec.
2026-02-05 15:42:05 02674_null_default_structure: [ OK ] 0.17 sec.
2026-02-05 15:42:07 00386_long_in_pk: [ OK ] 8.55 sec.
2026-02-05 15:42:07 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 1.88 sec.
2026-02-05 15:42:07 03043_group_array_result_is_expected: [ OK ] 0.17 sec.
2026-02-05 15:42:07 01902_self_aliases_in_columns: [ OK ] 0.17 sec.
2026-02-05 15:42:07 03144_aggregate_states_with_different_types: [ OK ] 0.22 sec.
2026-02-05 15:42:08 01867_support_datetime64_version_column: [ OK ] 0.27 sec.
2026-02-05 15:42:08 02581_parquet_arrow_orc_compressions: [ OK ] 2.43 sec.
2026-02-05 15:42:08 01012_reset_running_accumulate: [ OK ] 0.17 sec.
2026-02-05 15:42:08 03045_unknown_identifier_alias_substitution: [ OK ] 0.17 sec.
2026-02-05 15:42:08 01889_sql_json_functions: [ OK ] 0.47 sec.
2026-02-05 15:42:09 00413_distinct: [ OK ] 0.22 sec.
2026-02-05 15:42:09 02276_full_sort_join_unsupported: [ OK ] 0.27 sec.
2026-02-05 15:42:09 02718_parquet_metadata_format: [ OK ] 1.17 sec.
2026-02-05 15:42:09 02508_bad_graphite: [ OK ] 0.17 sec.
2026-02-05 15:42:09 02765_parallel_replicas_final_modifier: [ OK ] 0.22 sec.
2026-02-05 15:42:09 03208_array_of_json_read_subcolumns_1: [ OK ] 1.78 sec.
2026-02-05 15:42:09 01666_great_circle_distance_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:42:09 01318_map_populate_series: [ OK ] 0.32 sec.
2026-02-05 15:42:10 02541_multiple_ignore_with_nested_select: [ OK ] 0.12 sec.
2026-02-05 15:42:10 01114_materialize_clear_index_compact_parts: [ OK ] 0.27 sec.
2026-02-05 15:42:10 03036_join_filter_push_down_equivalent_sets: [ OK ] 0.32 sec.
2026-02-05 15:42:10 01825_type_json_wide_parts_merge: [ OK ] 0.23 sec.
2026-02-05 15:42:10 00999_full_join_dup_keys_crash: [ OK ] 0.42 sec.
2026-02-05 15:42:10 02362_part_log_merge_algorithm: [ OK ] 0.47 sec.
2026-02-05 15:42:10 01720_join_implicit_cast: [ OK ] 0.82 sec.
2026-02-05 15:42:10 02304_grouping_sets_with_rollup_cube: [ OK ] 0.17 sec.
2026-02-05 15:42:11 01422_array_nullable_element_nullable_index: [ OK ] 0.17 sec.
2026-02-05 15:42:11 02030_rocksdb_race_long: [ OK ] 20.98 sec.
2026-02-05 15:42:11 01493_alter_remove_no_property_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:42:11 02769_parallel_replicas_unavailable_shards: [ OK ] 0.32 sec.
2026-02-05 15:42:11 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.12 sec.
2026-02-05 15:42:11 00337_shard_any_heavy: [ OK ] 0.17 sec.
2026-02-05 15:42:11 03168_read_in_order_buffering_1: [ OK ] 0.27 sec.
2026-02-05 15:42:11 01143_trivial_count_with_join: [ OK ] 0.17 sec.
2026-02-05 15:42:11 02311_range_hashed_dictionary_range_cast: [ OK ] 0.17 sec.
2026-02-05 15:42:11 02160_h3_cell_area_m2: [ OK ] 0.22 sec.
2026-02-05 15:42:11 01800_log_nested: [ OK ] 0.22 sec.
2026-02-05 15:42:11 01413_alter_update_supertype: [ OK ] 0.17 sec.
2026-02-05 15:42:12 01825_type_json_distributed: [ OK ] 0.22 sec.
2026-02-05 15:42:12 03204_format_join_on: [ OK ] 0.52 sec.
2026-02-05 15:42:12 02429_low_cardinality_trash: [ OK ] 0.42 sec.
2026-02-05 15:42:12 03040_dynamic_type_alters_2_compact_merge_tree: [ OK ] 0.27 sec.
2026-02-05 15:42:12 00152_totals_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:42:12 01561_Date_and_DateTime64_comparision: [ OK ] 0.22 sec.
2026-02-05 15:42:13 02861_join_on_nullsafe_compare: [ OK ] 0.57 sec.
2026-02-05 15:42:13 01781_merge_tree_deduplication: [ OK ] 0.72 sec.
2026-02-05 15:42:13 02674_date_int_string_json_inference: [ OK ] 0.18 sec.
2026-02-05 15:42:13 00696_system_columns_limit: [ OK ] 0.17 sec.
2026-02-05 15:42:13 02540_duplicate_primary_key2: [ OK ] 0.12 sec.
2026-02-05 15:42:13 01081_PartialSortingTransform_full_column: [ OK ] 0.22 sec.
2026-02-05 15:42:14 02816_s2_invalid_point: [ OK ] 0.12 sec.
2026-02-05 15:42:14 00098_l_union_all: [ OK ] 0.17 sec.
2026-02-05 15:42:14 02882_primary_key_index_in_function_different_types: [ OK ] 0.22 sec.
2026-02-05 15:42:14 00729_prewhere_array_join: [ OK ] 0.32 sec.
2026-02-05 15:42:14 01147_partial_merge_full_join: [ OK ] 0.62 sec.
2026-02-05 15:42:15 01133_begin_commit_race: [ OK ] 20.69 sec.
2026-02-05 15:42:15 02353_order_by_tuple: [ OK ] 0.62 sec.
2026-02-05 15:42:15 02407_array_element_from_map_wrong_type: [ OK ] 0.12 sec.
2026-02-05 15:42:15 02953_slow_create_view: [ OK ] 0.17 sec.
2026-02-05 15:42:15 02242_negative_datetime64: [ OK ] 0.17 sec.
2026-02-05 15:42:15 01838_system_dictionaries_virtual_key_column: [ OK ] 0.17 sec.
2026-02-05 15:42:15 03033_distinct_transform_const_columns: [ OK ] 0.17 sec.
2026-02-05 15:42:15 01305_nullable-prewhere_bug: [ OK ] 0.17 sec.
2026-02-05 15:42:15 01396_low_cardinality_fixed_string_default: [ OK ] 0.17 sec.
2026-02-05 15:42:15 00597_with_totals_on_empty_set: [ OK ] 0.17 sec.
2026-02-05 15:42:16 01710_projection_fetch_long: [ OK ] 0.47 sec.
2026-02-05 15:42:16 00918_json_functions: [ OK ] 0.87 sec.
2026-02-05 15:42:16 01915_for_each_crakjie: [ OK ] 0.17 sec.
2026-02-05 15:42:16 02568_array_map_const_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:42:16 01510_format_regexp_raw_low_cardinality: [ OK ] 0.77 sec.
2026-02-05 15:42:16 02576_rewrite_array_exists_to_has: [ OK ] 0.17 sec.
2026-02-05 15:42:16 03197_storage_join_strictness_type_restriction: [ OK ] 0.17 sec.
2026-02-05 15:42:16 00515_gcd_lcm: [ OK ] 0.27 sec.
2026-02-05 15:42:16 01538_fuzz_aggregate: [ OK ] 0.12 sec.
2026-02-05 15:42:16 00526_array_join_with_arrays_of_nullable: [ OK ] 0.17 sec.
2026-02-05 15:42:17 01848_http_insert_segfault: [ OK ] 1.12 sec.
2026-02-05 15:42:17 02831_trash: [ OK ] 0.17 sec.
2026-02-05 15:42:18 00429_long_http_bufferization: [ OK ] 18.77 sec.
2026-02-05 15:42:20 01162_strange_mutations: [ OK ] 8.99 sec.
2026-02-05 15:42:21 00754_distributed_optimize_skip_select_on_unused_shards: [ OK ] 4.08 sec.
2026-02-05 15:42:21 01079_new_range_reader_segfault: [ OK ] 0.17 sec.
2026-02-05 15:42:21 01702_system_numbers_scientific_notation: [ OK ] 0.17 sec.
2026-02-05 15:42:21 01548_parallel_parsing_max_memory: [ OK ] 3.68 sec.
2026-02-05 15:42:21 02187_test_final_and_limit_modifier: [ OK ] 0.27 sec.
2026-02-05 15:42:21 03036_test_parquet_bloom_filter_push_down: [ OK ] 3.73 sec.
2026-02-05 15:42:21 00502_string_concat_with_array: [ OK ] 0.25 sec.
2026-02-05 15:42:21 02294_nothing_arguments_in_functions_errors: [ OK ] 1.07 sec.
2026-02-05 15:42:22 02475_analyzer_join_tree_subquery: [ OK ] 0.19 sec.
2026-02-05 15:42:22 02861_index_set_incorrect_args: [ OK ] 0.22 sec.
2026-02-05 15:42:22 01645_system_table_engines: [ OK ] 0.17 sec.
2026-02-05 15:42:22 00426_nulls_sorting: [ OK ] 0.28 sec.
2026-02-05 15:42:22 01700_deltasum: [ OK ] 0.22 sec.
2026-02-05 15:42:22 00710_array_enumerate_dense: [ OK ] 0.37 sec.
2026-02-05 15:42:23 01049_window_view_window_functions: [ OK ] 0.37 sec.
2026-02-05 15:42:23 01268_DateTime64_in_WHERE: [ OK ] 0.37 sec.
2026-02-05 15:42:23 00402_nan_and_extremes: [ OK ] 0.28 sec.
2026-02-05 15:42:23 01758_optimize_skip_unused_shards_once: [ OK ] 0.89 sec.
2026-02-05 15:42:24 01277_fromUnixTimestamp64: [ OK ] 0.39 sec.
2026-02-05 15:42:24 02205_ephemeral_1: [ OK ] 0.38 sec.
2026-02-05 15:42:25 02153_clickhouse_local_profile_info: [ OK ] 0.84 sec.
2026-02-05 15:42:27 02540_input_format_json_ignore_unknown_keys_in_named_tuple: [ OK ] 2.05 sec.
2026-02-05 15:42:27 02967_parallel_replicas_join_algo_and_analyzer_3: [ OK ] 5.52 sec.
2026-02-05 15:42:27 02497_having_without_actual_aggregation_bug: [ OK ] 0.28 sec.
2026-02-05 15:42:27 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.22 sec.
2026-02-05 15:42:27 02686_bson3: [ OK ] 0.17 sec.
2026-02-05 15:42:27 02445_replicated_db_alter_partition: [ OK ] 31.35 sec.
2026-02-05 15:42:27 01802_toDateTime64_large_values: [ OK ] 0.17 sec.
2026-02-05 15:42:27 01952_optimize_distributed_group_by_sharding_key: [ OK ] 0.27 sec.
2026-02-05 15:42:28 01606_git_import: [ OK ] 17.43 sec.
2026-02-05 15:42:28 01275_extract_groups_check: [ OK ] 0.37 sec.
2026-02-05 15:42:28 01621_decode_XML: [ OK ] 0.27 sec.
2026-02-05 15:42:28 01940_custom_tld_sharding_key: [ OK ] 0.22 sec.
2026-02-05 15:42:28 01532_min_max_with_modifiers: [ OK ] 0.22 sec.
2026-02-05 15:42:28 02338_analyzer_constants_basic: [ OK ] 0.32 sec.
2026-02-05 15:42:28 01655_test_isnull_mysql_dialect: [ OK ] 0.12 sec.
2026-02-05 15:42:28 02790_async_queries_in_query_log: [ OK ] 4.56 sec.
2026-02-05 15:42:29 02907_filter_pushdown_crash: [ OK ] 0.28 sec.
2026-02-05 15:42:29 02366_kql_datatype: [ OK ] 0.59 sec.
2026-02-05 15:42:29 00952_part_frozen_info: [ OK ] 0.28 sec.
2026-02-05 15:42:30 02842_one_input_format: [ OK ] 1.93 sec.
2026-02-05 15:42:30 00400_client_external_options: [ OK ] 1.32 sec.
2026-02-05 15:42:30 03135_keeper_client_find_commands: [ OK ] 1.37 sec.
2026-02-05 15:42:31 01474_decimal_scale_bug: [ OK ] 0.24 sec.
2026-02-05 15:42:31 01412_group_array_moving_shard: [ OK ] 0.52 sec.
2026-02-05 15:42:31 03117_analyzer_same_column_name_as_func: [ OK ] 0.27 sec.
2026-02-05 15:42:31 01514_input_format_tsv_enum_as_number_setting: [ OK ] 0.17 sec.
2026-02-05 15:42:31 02815_join_algorithm_setting: [ OK ] 1.19 sec.
2026-02-05 15:42:31 01095_tpch_like_smoke: [ OK ] 0.78 sec.
2026-02-05 15:42:32 01268_mv_scalars: [ OK ] 0.32 sec.
2026-02-05 15:42:32 02559_multiple_read_steps_in_prewhere: [ OK ] 0.32 sec.
2026-02-05 15:42:32 02346_fulltext_index_bug52019: [ OK ] 0.32 sec.
2026-02-05 15:42:33 02481_xxh3_hash_function: [ OK ] 0.23 sec.
2026-02-05 15:42:33 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.15 sec.
2026-02-05 15:42:33 00804_test_delta_codec_compression: [ OK ] 1.93 sec.
2026-02-05 15:42:34 00851_http_insert_json_defaults: [ OK ] 0.93 sec.
2026-02-05 15:42:34 02517_executable_pool_bad_input_query: [ OK ] 0.17 sec.
2026-02-05 15:42:34 01943_pmj_non_joined_stuck: [ OK ] 0.32 sec.
2026-02-05 15:42:34 02835_parallel_replicas_over_distributed: [ OK ] 0.27 sec.
2026-02-05 15:42:34 01358_mutation_delete_null_rows: [ OK ] 0.22 sec.
2026-02-05 15:42:34 03039_dynamic_collapsing_merge_tree: [ OK ] 5.85 sec.
2026-02-05 15:42:34 02468_has_any_tuple: [ OK ] 0.17 sec.
2026-02-05 15:42:35 02791_final_block_structure_mismatch_bug: [ OK ] 0.42 sec.
2026-02-05 15:42:35 02721_parquet_field_not_found: [ OK ] 0.67 sec.
2026-02-05 15:42:35 02012_zookeeper_changed_enum_type_incompatible: [ OK ] 0.28 sec.
2026-02-05 15:42:35 00185_array_literals: [ OK ] 0.22 sec.
2026-02-05 15:42:35 02497_source_part_is_intact_when_mutation: [ OK ] 0.32 sec.
2026-02-05 15:42:35 01021_tuple_parser: [ OK ] 0.17 sec.
2026-02-05 15:42:35 01934_constexpr_aggregate_function_parameters: [ OK ] 0.22 sec.
2026-02-05 15:42:37 01441_low_cardinality_array_index: [ OK ] 2.13 sec.
2026-02-05 15:42:37 00036_array_element: [ OK ] 0.27 sec.
2026-02-05 15:42:38 00514_interval_operators: [ OK ] 0.28 sec.
2026-02-05 15:42:38 00984_parser_stack_overflow: [ OK ] 2.58 sec.
2026-02-05 15:42:38 03001_matview_columns_after_modify_query: [ OK ] 3.28 sec.
2026-02-05 15:42:39 02498_storage_join_key_positions: [ OK ] 0.57 sec.
2026-02-05 15:42:39 02904_empty_order_by_with_setting_enabled: [ OK ] 0.92 sec.
2026-02-05 15:42:39 02560_vertical_merge_memory_usage: [ OK ] 0.97 sec.
2026-02-05 15:42:39 03008_index_small: [ OK ] 0.17 sec.
2026-02-05 15:42:40 03172_system_detached_tables: [ OK ] 0.77 sec.
2026-02-05 15:42:40 01791_dist_INSERT_block_structure_mismatch: [ OK ] 0.57 sec.
2026-02-05 15:42:41 02907_backup_restore_flatten_nested: [ OK ] 1.82 sec.
2026-02-05 15:42:41 02703_keeper_map_concurrent_create_drop: [ OK ] 24.53 sec.
2026-02-05 15:42:41 00980_shard_aggregation_state_deserialization: [ OK ] 0.17 sec.
2026-02-05 15:42:41 00598_create_as_select_http: [ OK ] 0.72 sec.
2026-02-05 15:42:42 02882_clickhouse_keeper_client_no_confirmation: [ OK ] 0.52 sec.
2026-02-05 15:42:42 02690_subquery_identifiers: [ OK ] 0.17 sec.
2026-02-05 15:42:43 03153_format_regexp_usability: [ OK ] 0.82 sec.
2026-02-05 15:42:43 02995_index_10: [ OK ] 10.09 sec.
2026-02-05 15:42:43 00374_any_last_if_merge: [ OK ] 0.17 sec.
2026-02-05 15:42:43 01943_log_column_sizes: [ OK ] 0.22 sec.
2026-02-05 15:42:43 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.17 sec.
2026-02-05 15:42:43 00600_replace_running_query: [ OK ] 1.63 sec.
2026-02-05 15:42:43 03224_nested_json_merges_new_type_in_shared_data: [ OK ] 0.42 sec.
2026-02-05 15:42:43 01278_min_insert_block_size_rows_for_materialized_views: [ OK ] 4.78 sec.
2026-02-05 15:42:43 03100_analyzer_constants_in_multiif: [ OK ] 0.17 sec.
2026-02-05 15:42:43 02419_contingency_array_nullable: [ OK ] 0.12 sec.
2026-02-05 15:42:44 01765_move_to_table_overlapping_block_number: [ OK ] 0.17 sec.
2026-02-05 15:42:44 00818_inner_join_bug_3567: [ OK ] 0.22 sec.
2026-02-05 15:42:44 02127_storage_join_settings_with_persistency: [ OK ] 0.17 sec.
2026-02-05 15:42:44 02290_client_insert_cancel: [ OK ] 0.87 sec.
2026-02-05 15:42:44 03036_with_numbers: [ OK ] 0.17 sec.
2026-02-05 15:42:44 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.12 sec.
2026-02-05 15:42:44 01669_columns_declaration_serde_long: [ OK ] 0.27 sec.
2026-02-05 15:42:44 03018_analyzer_greater_null: [ OK ] 0.17 sec.
2026-02-05 15:42:44 02340_analyzer_functions: [ OK ] 0.17 sec.
2026-02-05 15:42:44 03456_match_index_prefix_extraction: [ OK ] 0.42 sec.
2026-02-05 15:42:44 01338_long_select_and_alter_zookeeper: [ OK ] 13.17 sec.
2026-02-05 15:42:44 03273_format_inference_create_query_s3_url: [ OK ] 0.62 sec.
2026-02-05 15:42:44 02457_filesystem_function: [ OK ] 0.17 sec.
2026-02-05 15:42:45 00737_decimal_group_by: [ OK ] 0.22 sec.
2026-02-05 15:42:45 02366_kql_native_interval_format: [ OK ] 0.27 sec.
2026-02-05 15:42:45 01097_one_more_range_reader_test_wide_part: [ OK ] 0.22 sec.
2026-02-05 15:42:45 03097_query_log_join_processes: [ OK ] 0.32 sec.
2026-02-05 15:42:45 01533_optimize_skip_merged_partitions: [ OK ] 0.27 sec.
2026-02-05 15:42:45 01380_coded_delta_exception_code: [ OK ] 0.22 sec.
2026-02-05 15:42:45 00506_shard_global_in_union: [ OK ] 0.32 sec.
2026-02-05 15:42:45 03143_benchmark_query_id_prefix: [ OK ] 0.92 sec.
2026-02-05 15:42:45 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.17 sec.
2026-02-05 15:42:45 03252_fill_missed_arrays: [ OK ] 0.22 sec.
2026-02-05 15:42:45 03009_consecutive_keys_nullable: [ OK ] 0.37 sec.
2026-02-05 15:42:46 02661_read_from_archive_7z: [ OK ] 5.44 sec.
2026-02-05 15:42:46 00234_disjunctive_equality_chains_optimization: [ OK ] 0.17 sec.
2026-02-05 15:42:46 02346_fulltext_index_old_name: [ OK ] 0.22 sec.
2026-02-05 15:42:46 00800_low_cardinality_merge_join: [ OK ] 0.58 sec.
2026-02-05 15:42:46 00758_array_reverse: [ OK ] 0.22 sec.
2026-02-05 15:42:46 02124_json_each_row_with_progress: [ OK ] 0.82 sec.
2026-02-05 15:42:46 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.22 sec.
2026-02-05 15:42:47 02668_parse_datetime: [ OK ] 0.62 sec.
2026-02-05 15:42:47 02869_insert_filenames_collisions: [ OK ] 0.22 sec.
2026-02-05 15:42:47 02319_quantile_interpolated_weighted: [ OK ] 0.22 sec.
2026-02-05 15:42:47 01318_decrypt: [ OK ] 0.77 sec.
2026-02-05 15:42:47 01825_new_type_json_btc: [ OK ] 1.93 sec.
2026-02-05 15:42:47 03231_prewhere_conditions_order: [ OK ] 0.17 sec.
2026-02-05 15:42:47 01817_storage_buffer_parameters: [ OK ] 0.22 sec.
2026-02-05 15:42:47 01006_simpod_empty_part_single_column_write: [ OK ] 1.52 sec.
2026-02-05 15:42:47 01073_crlf_end_of_line: [ OK ] 0.17 sec.
2026-02-05 15:42:47 01427_pk_and_expression_with_different_type: [ OK ] 0.17 sec.
2026-02-05 15:42:47 01072_select_constant_limit: [ OK ] 0.17 sec.
2026-02-05 15:42:48 02164_materialized_view_support_virtual_column: [ OK ] 0.17 sec.
2026-02-05 15:42:48 01786_group_by_pk_many_streams: [ OK ] 0.42 sec.
2026-02-05 15:42:48 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.17 sec.
2026-02-05 15:42:48 02910_bad_logs_level_in_local: [ OK ] 0.17 sec.
2026-02-05 15:42:48 02122_parallel_formatting_CSVWithNamesAndTypes: [ OK ] 1.27 sec.
2026-02-05 15:42:48 03032_string_to_variant_cast: [ OK ] 0.27 sec.
2026-02-05 15:42:48 01329_compare_tuple_string_constant: [ OK ] 0.22 sec.
2026-02-05 15:42:48 01821_join_table_mutation: [ OK ] 0.22 sec.
2026-02-05 15:42:48 02682_quantiles_too_large_size: [ OK ] 0.17 sec.
2026-02-05 15:42:48 02751_protobuf_ipv6: [ OK ] 0.62 sec.
2026-02-05 15:42:48 02833_sparse_columns_tuple_function: [ OK ] 0.17 sec.
2026-02-05 15:42:49 02418_keeper_map_keys_limit: [ OK ] 0.27 sec.
2026-02-05 15:42:49 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.17 sec.
2026-02-05 15:42:49 02970_visible_width_behavior: [ OK ] 0.17 sec.
2026-02-05 15:42:49 01396_inactive_replica_cleanup_nodes_zookeeper: [ OK ] 5.08 sec.
2026-02-05 15:42:49 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 2.12 sec.
2026-02-05 15:42:49 01146_clickhouse_local_data: [ OK ] 0.67 sec.
2026-02-05 15:42:49 03276_functions_to_subcolumns_lc: [ OK ] 0.22 sec.
2026-02-05 15:42:49 01076_window_view_alter_query_to: [ OK ] 1.87 sec.
2026-02-05 15:42:49 03209_functions_json_msan_fuzzer_issue: [ OK ] 0.17 sec.
2026-02-05 15:42:50 02568_json_array_length: [ OK ] 0.22 sec.
2026-02-05 15:42:50 02156_storage_merge_prewhere_2: [ OK ] 0.17 sec.
2026-02-05 15:42:50 01846_alter_column_without_type_bugfix: [ OK ] 0.17 sec.
2026-02-05 15:42:50 03222_date_time_inference: [ OK ] 1.08 sec.
2026-02-05 15:42:50 00374_json_each_row_input_with_noisy_fields: [ OK ] 1.42 sec.
2026-02-05 15:42:50 02243_arrow_read_null_type_to_nullable_column: [ OK ] 0.87 sec.
2026-02-05 15:42:50 02240_get_type_serialization_streams: [ OK ] 0.17 sec.
2026-02-05 15:42:50 02125_dict_get_type_nullable_fix: [ OK ] 0.22 sec.
2026-02-05 15:42:50 02009_body_query_params: [ OK ] 0.47 sec.
2026-02-05 15:42:50 02421_decimal_in_precision_issue_41125: [ OK ] 0.27 sec.
2026-02-05 15:42:50 02012_low_cardinality_uuid_with_extremes: [ OK ] 0.17 sec.
2026-02-05 15:42:50 02935_date_trunc_case_unsensitiveness: [ OK ] 0.37 sec.
2026-02-05 15:42:50 00804_test_zstd_qat_codec_compression: [ OK ] 0.32 sec.
2026-02-05 15:42:50 01945_show_debug_warning: [ OK ] 1.07 sec.
2026-02-05 15:42:50 03011_adaptative_timeout_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:42:51 02267_type_inference_for_insert_into_function_null: [ OK ] 0.17 sec.
2026-02-05 15:42:51 00760_insert_json_with_defaults: [ OK ] 0.27 sec.
2026-02-05 15:42:51 02724_persist_interval_type: [ OK ] 0.22 sec.
2026-02-05 15:42:51 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.48 sec.
2026-02-05 15:42:51 02096_date_time_1970_saturation: [ OK ] 0.22 sec.
2026-02-05 15:42:51 00179_lambdas_with_common_expressions_and_filter: [ OK ] 0.12 sec.
2026-02-05 15:42:51 02982_changeDate: [ OK ] 0.72 sec.
2026-02-05 15:42:51 00012_array_join_alias_2: [ OK ] 0.17 sec.
2026-02-05 15:42:51 02943_positional_arguments_bugs: [ OK ] 0.17 sec.
2026-02-05 15:42:52 02470_mutation_sync_race: [ OK ] 30.21 sec.
2026-02-05 15:42:52 01285_engine_join_donmikel: [ OK ] 0.92 sec.
2026-02-05 15:42:52 01811_storage_buffer_flush_parameters: [ OK ] 1.97 sec.
2026-02-05 15:42:52 01259_datetime64_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:42:52 00712_prewhere_with_sampling: [ OK ] 0.17 sec.
2026-02-05 15:42:52 02921_file_engine_size_virtual_column: [ OK ] 0.82 sec.
2026-02-05 15:42:52 01825_type_json_7: [ OK ] 1.17 sec.
2026-02-05 15:42:52 02699_polygons_sym_difference_total_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:42:52 03037_dot_product_overflow: [ OK ] 0.17 sec.
2026-02-05 15:42:52 00898_quantile_timing_parameter_check: [ OK ] 0.17 sec.
2026-02-05 15:42:52 01089_alter_settings_old_format: [ OK ] 0.17 sec.
2026-02-05 15:42:53 02559_multiple_read_steps_in_prewhere_missing_columns: [ OK ] 0.27 sec.
2026-02-05 15:42:53 02356_insert_query_log_metrics: [ OK ] 0.34 sec.
2026-02-05 15:42:53 02669_alter_modify_to_nullable: [ OK ] 0.52 sec.
2026-02-05 15:42:53 00825_protobuf_format_no_length_delimiter: [ OK ] 1.17 sec.
2026-02-05 15:42:53 02494_analyzer_cte_resolution_in_subquery_fix: [ OK ] 0.17 sec.
2026-02-05 15:42:53 02293_grouping_function_group_by: [ OK ] 0.37 sec.
2026-02-05 15:42:53 00212_long_shard_aggregate_function_uniq: [ OK ] 2.48 sec.
2026-02-05 15:42:53 03198_group_array_intersect: [ OK ] 0.17 sec.
2026-02-05 15:42:53 00497_whitespaces_in_insert: [ OK ] 2.03 sec.
2026-02-05 15:42:53 01495_subqueries_in_with_statement_2: [ OK ] 0.22 sec.
2026-02-05 15:42:53 02499_escaped_quote_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:42:53 02428_combinators_with_over_statement: [ OK ] 0.22 sec.
2026-02-05 15:42:53 02720_row_policy_column_with_dots: [ OK ] 0.17 sec.
2026-02-05 15:42:53 03299_deep_nested_map_creation: [ OK ] 0.17 sec.
2026-02-05 15:42:54 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.17 sec.
2026-02-05 15:42:54 03003_arrayEnumerate_crash: [ OK ] 0.17 sec.
2026-02-05 15:42:54 02123_MySQLWire_regression: [ OK ] 0.17 sec.
2026-02-05 15:42:54 03002_sample_factor_where: [ OK ] 0.22 sec.
2026-02-05 15:42:54 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.17 sec.
2026-02-05 15:42:54 00825_protobuf_format_nested_optional: [ OK ] 1.12 sec.
2026-02-05 15:42:54 02013_zlib_read_after_eof: [ OK ] 1.42 sec.
2026-02-05 15:42:54 02923_hdfs_engine_size_virtual_column: [ OK ] 1.22 sec.
2026-02-05 15:42:54 02344_distinct_limit_distiributed: [ OK ] 0.62 sec.
2026-02-05 15:42:55 01013_totals_without_aggregation: [ OK ] 0.17 sec.
2026-02-05 15:42:55 01058_zlib_ng_level1_bug: [ OK ] 2.23 sec.
2026-02-05 15:42:55 00494_shard_alias_substitution_bug: [ OK ] 0.17 sec.
2026-02-05 15:42:55 02551_ipv4_implicit_uint64: [ OK ] 0.17 sec.
2026-02-05 15:42:55 02537_system_formats: [ OK ] 0.12 sec.
2026-02-05 15:42:55 01240_join_get_or_null: [ OK ] 0.22 sec.
2026-02-05 15:42:55 01710_projection_analysis_reuse_partition: [ OK ] 1.12 sec.
2026-02-05 15:42:55 03008_deduplication_wrong_mv: [ OK ] 0.17 sec.
2026-02-05 15:42:55 00944_minmax_null: [ OK ] 0.22 sec.
2026-02-05 15:42:56 01718_subtract_seconds_date: [ OK ] 0.17 sec.
2026-02-05 15:42:56 02480_tlp_nan: [ OK ] 0.17 sec.
2026-02-05 15:42:56 00271_agg_state_and_totals: [ OK ] 0.17 sec.
2026-02-05 15:42:56 00148_summing_merge_tree_aggregate_function: [ OK ] 1.12 sec.
2026-02-05 15:42:56 01077_yet_another_prewhere_test: [ OK ] 0.22 sec.
2026-02-05 15:42:56 00997_extract_all_crash_6627: [ OK ] 0.12 sec.
2026-02-05 15:42:56 02122_parallel_formatting_PrettySpaceNoEscapes: [ OK ] 2.08 sec.
2026-02-05 15:42:56 02949_ttl_group_by_bug: [ OK ] 0.17 sec.
2026-02-05 15:42:57 00198_group_by_empty_arrays: [ OK ] 0.17 sec.
2026-02-05 15:42:57 02521_grouping_sets_plus_memory_efficient_aggr: [ OK ] 0.22 sec.
2026-02-05 15:42:57 01519_topK_distributed_parametrized: [ OK ] 0.22 sec.
2026-02-05 15:42:57 01768_extended_range: [ OK ] 0.17 sec.
2026-02-05 15:42:57 00597_push_down_predicate_long: [ OK ] 0.67 sec.
2026-02-05 15:42:57 02907_backup_restore_default_nullable: [ OK ] 1.07 sec.
2026-02-05 15:42:57 00001_select_1: [ OK ] 0.17 sec.
2026-02-05 15:42:58 02496_format_datetime_in_joda_syntax: [ OK ] 0.57 sec.
2026-02-05 15:42:58 00612_pk_in_tuple: [ OK ] 0.32 sec.
2026-02-05 15:42:58 00744_join_not_found_column: [ OK ] 0.17 sec.
2026-02-05 15:42:58 01492_array_join_crash_13829: [ OK ] 0.17 sec.
2026-02-05 15:42:58 00500_point_in_polygon_bug_2: [ OK ] 0.17 sec.
2026-02-05 15:42:58 02834_formats_with_variable_number_of_columns: [ OK ] 0.22 sec.
2026-02-05 15:42:59 01081_window_view_target_table_engine: [ OK ] 1.12 sec.
2026-02-05 15:42:59 02915_input_table_function_in_subquery: [ OK ] 0.72 sec.
2026-02-05 15:42:59 02416_in_set_same_ast_diff_columns: [ OK ] 0.17 sec.
2026-02-05 15:42:59 02668_parse_datetime_in_joda_syntax: [ OK ] 0.72 sec.
2026-02-05 15:42:59 00932_geohash_support: [ OK ] 0.27 sec.
2026-02-05 15:42:59 00072_in_types: [ OK ] 0.17 sec.
2026-02-05 15:42:59 00166_functions_of_aggregation_states: [ OK ] 0.17 sec.
2026-02-05 15:42:59 02889_datetime64_from_string: [ OK ] 0.22 sec.
2026-02-05 15:42:59 02479_nullable_primary_key_non_first_column: [ OK ] 0.17 sec.
2026-02-05 15:43:00 01632_group_array_msan: [ OK ] 0.22 sec.
2026-02-05 15:43:00 02319_lightweight_delete_on_merge_tree: [ OK ] 0.67 sec.
2026-02-05 15:43:00 00016_totals_having_constants: [ OK ] 0.17 sec.
2026-02-05 15:43:00 02967_index_hint_crash: [ OK ] 0.17 sec.
2026-02-05 15:43:00 02969_auto_format_detection: [ OK ] 4.74 sec.
2026-02-05 15:43:00 00178_query_datetime64_index: [ OK ] 0.17 sec.
2026-02-05 15:43:01 01710_projection_query_plan_optimization_misc: [ OK ] 0.17 sec.
2026-02-05 15:43:01 02457_csv_parse_date_out_of_range: [ OK ] 0.92 sec.
2026-02-05 15:43:01 00269_database_table_whitespace: [ OK ] 0.17 sec.
2026-02-05 15:43:01 01231_log_queries_min_type: [ OK ] 0.32 sec.
2026-02-05 15:43:01 02912_ingestion_mv_deduplication: [ OK ] 0.87 sec.
2026-02-05 15:43:01 02041_conversion_between_date32_and_datetime64: [ OK ] 0.22 sec.
2026-02-05 15:43:01 02947_merge_tree_index_table_3: [ OK ] 1.98 sec.
2026-02-05 15:43:01 02006_client_test_hint_error_name: [ OK ] 0.17 sec.
2026-02-05 15:43:01 01178_int_field_to_decimal: [ OK ] 0.27 sec.
2026-02-05 15:43:01 00765_sql_compatibility_aliases: [ OK ] 0.22 sec.
2026-02-05 15:43:01 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.27 sec.
2026-02-05 15:43:02 02781_data_skipping_index_merge_tree_min_for_seek: [ OK ] 0.37 sec.
2026-02-05 15:43:02 02967_http_compressed: [ OK ] 0.42 sec.
2026-02-05 15:43:02 02265_column_ttl: [ OK ] 0.42 sec.
2026-02-05 15:43:02 01499_log_deadlock: [ OK ] 0.27 sec.
2026-02-05 15:43:03 01084_window_view_with_table_identifier: [ OK ] 1.22 sec.
2026-02-05 15:43:03 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.42 sec.
2026-02-05 15:43:03 00933_reserved_word: [ OK ] 0.17 sec.
2026-02-05 15:43:03 02910_object-json-crash-add-column: [ OK ] 0.27 sec.
2026-02-05 15:43:03 01087_storage_generate: [ OK ] 0.17 sec.
2026-02-05 15:43:03 01825_type_json_2: [ OK ] 0.27 sec.
2026-02-05 15:43:03 01401_FORMAT_SETTINGS: [ OK ] 0.47 sec.
2026-02-05 15:43:04 02798_generic_transform: [ OK ] 0.22 sec.
2026-02-05 15:43:04 03050_select_one_one_one: [ OK ] 0.17 sec.
2026-02-05 15:43:04 02421_truncate_isolation_no_merges: [ OK ] 9.80 sec.
2026-02-05 15:43:04 00688_low_cardinality_in: [ OK ] 0.22 sec.
2026-02-05 15:43:04 01837_cast_to_array_from_empty_array: [ OK ] 0.17 sec.
2026-02-05 15:43:04 01939_type_map_json: [ OK ] 0.17 sec.
2026-02-05 15:43:04 02477_age_datetime64: [ OK ] 0.32 sec.
2026-02-05 15:43:04 01503_if_const_optimization: [ OK ] 0.12 sec.
2026-02-05 15:43:04 02915_analyzer_fuzz_6: [ OK ] 0.22 sec.
2026-02-05 15:43:04 00558_parse_floats: [ OK ] 0.17 sec.
2026-02-05 15:43:05 03089_analyzer_alias_replacement: [ OK ] 0.17 sec.
2026-02-05 15:43:05 01763_long_ttl_group_by: [ OK ] 0.87 sec.
2026-02-05 15:43:06 01358_constexpr_constraint: [ OK ] 0.17 sec.
2026-02-05 15:43:06 00097_long_storage_buffer_race_condition_mt: [ OK ] 11.55 sec.
2026-02-05 15:43:06 00365_statistics_in_formats: [ OK ] 1.37 sec.
2026-02-05 15:43:06 02932_refreshable_materialized_views_2: [ OK ] 12.61 sec.
2026-02-05 15:43:06 03122_analyzer_collate_in_window_function: [ OK ] 0.22 sec.
2026-02-05 15:43:06 03207_json_read_subcolumns_2_wide_merge_tree: [ OK ] 66.73 sec.
2026-02-05 15:43:06 00717_default_join_type: [ OK ] 0.22 sec.
2026-02-05 15:43:06 02099_tsv_raw_format_2: [ OK ] 2.18 sec.
2026-02-05 15:43:06 02943_exprs_order_in_group_by_with_rollup: [ OK ] 0.22 sec.
2026-02-05 15:43:06 02798_substring_index: [ OK ] 0.47 sec.
2026-02-05 15:43:06 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.42 sec.
2026-02-05 15:43:06 01586_replicated_mutations_empty_partition: [ OK ] 0.32 sec.
2026-02-05 15:43:06 00609_mv_index_in_in: [ OK ] 0.22 sec.
2026-02-05 15:43:07 03289_tuple_element_to_subcolumn: [ OK ] 0.22 sec.
2026-02-05 15:43:07 02387_parse_date_as_datetime: [ OK ] 0.17 sec.
2026-02-05 15:43:07 02996_index_compaction_counterexample: [ OK ] 0.17 sec.
2026-02-05 15:43:07 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.17 sec.
2026-02-05 15:43:07 01501_clickhouse_client_INSERT_exception: [ OK ] 1.02 sec.
2026-02-05 15:43:07 03039_dynamic_summing_merge_tree: [ OK ] 6.24 sec.
2026-02-05 15:43:07 02797_read_subcolumns_from_files: [ OK ] 0.97 sec.
2026-02-05 15:43:07 01701_clear_projection_and_part_remove: [ OK ] 0.22 sec.
2026-02-05 15:43:07 02808_custom_disk_with_user_defined_name: [ OK ] 0.92 sec.
2026-02-05 15:43:07 03218_materialize_msan: [ OK ] 0.22 sec.
2026-02-05 15:43:08 01583_const_column_in_set_index: [ OK ] 0.17 sec.
2026-02-05 15:43:08 02112_parse_date_yyyymmdd: [ OK ] 0.52 sec.
2026-02-05 15:43:08 00114_float_type_result_of_division: [ OK ] 0.12 sec.
2026-02-05 15:43:08 02542_transform_new: [ OK ] 0.32 sec.
2026-02-05 15:43:08 01890_stem: [ OK ] 0.22 sec.
2026-02-05 15:43:08 03282_memory_transaction_crash: [ OK ] 0.17 sec.
2026-02-05 15:43:08 02155_default_keyword_format_values: [ OK ] 1.27 sec.
2026-02-05 15:43:08 02563_arrow_low_cardinality_bug: [ OK ] 1.02 sec.
2026-02-05 15:43:08 00833_sleep_overflow: [ OK ] 0.12 sec.
2026-02-05 15:43:09 03035_materialized_primary_key: [ OK ] 0.22 sec.
2026-02-05 15:43:09 01925_json_as_string_data_in_square_brackets: [ OK ] 0.17 sec.
2026-02-05 15:43:09 01515_with_global_and_with_propagation: [ OK ] 0.17 sec.
2026-02-05 15:43:09 02319_dict_get_check_arguments_size: [ OK ] 0.27 sec.
2026-02-05 15:43:09 02235_check_table_sparse_serialization: [ OK ] 0.22 sec.
2026-02-05 15:43:09 02433_default_expression_operator_in: [ OK ] 0.27 sec.
2026-02-05 15:43:09 01825_type_json_btc: [ OK ] 1.37 sec.
2026-02-05 15:43:09 00266_read_overflow_mode: [ OK ] 0.17 sec.
2026-02-05 15:43:09 02321_nested_short_circuit_functions: [ OK ] 0.12 sec.
2026-02-05 15:43:09 02990_format_lambdas: [ OK ] 0.67 sec.
2026-02-05 15:43:09 02706_keeper_map_insert_strict: [ OK ] 0.22 sec.
2026-02-05 15:43:09 02243_make_date32_mysql: [ OK ] 0.27 sec.
2026-02-05 15:43:10 02890_describe_table_options: [ OK ] 0.23 sec.
2026-02-05 15:43:10 01889_check_row_policy_defined_using_user_function: [ OK ] 2.13 sec.
2026-02-05 15:43:10 01123_parse_date_time_best_effort_even_more: [ OK ] 0.17 sec.
2026-02-05 15:43:10 02998_http_redirects: [ OK ] 0.47 sec.
2026-02-05 15:43:10 02325_compatibility_setting_2: [ OK ] 0.17 sec.
2026-02-05 15:43:10 01421_assert_in_in: [ OK ] 0.12 sec.
2026-02-05 15:43:10 02180_insert_into_values_settings: [ OK ] 0.12 sec.
2026-02-05 15:43:10 00103_ipv4_num_to_string_class_c: [ OK ] 0.12 sec.
2026-02-05 15:43:10 00564_initial_column_values_with_default_expression: [ OK ] 0.17 sec.
2026-02-05 15:43:10 01683_intdiv_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:43:10 02711_server_uuid_macro: [ OK ] 0.27 sec.
2026-02-05 15:43:10 01018_empty_aggregation_filling: [ OK ] 0.32 sec.
2026-02-05 15:43:10 03164_optimize_read_in_order_nullable: [ OK ] 0.27 sec.
2026-02-05 15:43:10 00613_shard_distributed_max_execution_time: [ OK ] 0.17 sec.
2026-02-05 15:43:10 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.22 sec.
2026-02-05 15:43:10 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.17 sec.
2026-02-05 15:43:10 02573_quantile_fuse_msan: [ OK ] 0.17 sec.
2026-02-05 15:43:11 00253_insert_recursive_defaults: [ OK ] 0.22 sec.
2026-02-05 15:43:11 01910_client_replxx_container_overflow_long: [ OK ] 0.57 sec.
2026-02-05 15:43:11 02183_combinator_if: [ OK ] 0.37 sec.
2026-02-05 15:43:11 00910_buffer_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:43:11 02167_format_from_file_extension: [ OK ] 4.98 sec.
2026-02-05 15:43:11 01284_fuzz_bits: [ OK ] 0.32 sec.
2026-02-05 15:43:11 02532_send_logs_level_test: [ OK ] 0.82 sec.
2026-02-05 15:43:11 01264_nested_baloo_bear: [ OK ] 0.17 sec.
2026-02-05 15:43:11 03325_distributed_join_json_array_subcolumns: [ OK ] 0.17 sec.
2026-02-05 15:43:11 02811_read_in_order_and_array_join_bug: [ OK ] 0.17 sec.
2026-02-05 15:43:11 01047_no_alias_columns_with_table_aliases: [ OK ] 0.22 sec.
2026-02-05 15:43:11 01711_decimal_multiplication: [ OK ] 0.17 sec.
2026-02-05 15:43:11 00464_array_element_out_of_range: [ OK ] 0.17 sec.
2026-02-05 15:43:11 00187_like_regexp_prefix: [ OK ] 0.17 sec.
2026-02-05 15:43:11 01458_is_decimal_overflow: [ OK ] 0.22 sec.
2026-02-05 15:43:12 02734_sparse_columns_mutation: [ OK ] 0.22 sec.
2026-02-05 15:43:12 00803_xxhash: [ OK ] 0.27 sec.
2026-02-05 15:43:12 03168_cld2_tsan: [ OK ] 0.22 sec.
2026-02-05 15:43:12 01493_table_function_null: [ OK ] 0.12 sec.
2026-02-05 15:43:12 01914_ubsan_quantile_timing: [ OK ] 0.22 sec.
2026-02-05 15:43:12 01254_dict_load_after_detach_attach: [ OK ] 0.17 sec.
2026-02-05 15:43:12 02675_sparse_columns_clear_column: [ OK ] 0.42 sec.
2026-02-05 15:43:12 03129_update_nested_materialized_column_check: [ OK ] 0.19 sec.
2026-02-05 15:43:12 00162_shard_global_join: [ OK ] 0.17 sec.
2026-02-05 15:43:12 02995_bad_formatting_union_intersect: [ OK ] 0.17 sec.
2026-02-05 15:43:13 00411_long_accurate_number_comparison_int1: [ OK ] 6.39 sec.
2026-02-05 15:43:13 00564_temporary_table_management: [ OK ] 0.12 sec.
2026-02-05 15:43:13 01602_array_aggregation: [ OK ] 0.37 sec.
2026-02-05 15:43:13 03008_local_plain_rewritable: [ OK ] 1.32 sec.
2026-02-05 15:43:13 02813_array_agg: [ OK ] 0.17 sec.
2026-02-05 15:43:14 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 1.42 sec.
2026-02-05 15:43:14 01710_projection_part_check: [ OK ] 0.32 sec.
2026-02-05 15:43:14 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 2.33 sec.
2026-02-05 15:43:14 02531_ipv4_arithmetic: [ OK ] 0.17 sec.
2026-02-05 15:43:14 02552_sparse_columns_intersect: [ OK ] 0.22 sec.
2026-02-05 15:43:14 01314_position_in_system_columns: [ OK ] 0.17 sec.
2026-02-05 15:43:14 00038_totals_limit: [ OK ] 0.17 sec.
2026-02-05 15:43:14 00557_array_resize: [ OK ] 0.22 sec.
2026-02-05 15:43:14 01324_insert_tsv_raw: [ OK ] 0.17 sec.
2026-02-05 15:43:14 01079_order_by_pk: [ OK ] 1.32 sec.
2026-02-05 15:43:15 00715_json_each_row_input_nested: [ OK ] 1.97 sec.
2026-02-05 15:43:15 01308_orc_output_format_arrays: [ OK ] 0.93 sec.
2026-02-05 15:43:15 01065_array_zip_mixed_const: [ OK ] 0.17 sec.
2026-02-05 15:43:15 01083_aggregation_memory_efficient_bug: [ OK ] 0.32 sec.
2026-02-05 15:43:15 00238_removal_of_temporary_columns: [ OK ] 0.17 sec.
2026-02-05 15:43:15 00366_multi_statements: [ OK ] 3.93 sec.
2026-02-05 15:43:15 00460_vertical_and_totals_extremes: [ OK ] 0.17 sec.
2026-02-05 15:43:15 00818_alias_bug_4110: [ OK ] 0.27 sec.
2026-02-05 15:43:15 01280_unicode_whitespaces_lexer: [ OK ] 0.17 sec.
2026-02-05 15:43:15 00573_shard_aggregation_by_empty_set: [ OK ] 0.27 sec.
2026-02-05 15:43:15 00976_ttl_with_old_parts: [ OK ] 1.22 sec.
2026-02-05 15:43:15 02921_fuzzbits_with_array_join: [ OK ] 0.17 sec.
2026-02-05 15:43:15 01413_allow_non_metadata_alters: [ OK ] 0.22 sec.
2026-02-05 15:43:15 00362_great_circle_distance: [ OK ] 0.17 sec.
2026-02-05 15:43:15 02811_ip_dict_attribute: [ OK ] 0.17 sec.
2026-02-05 15:43:15 02294_stringsearch_with_nonconst_needle: [ OK ] 0.32 sec.
2026-02-05 15:43:16 00315_quantile_off_by_one: [ OK ] 0.17 sec.
2026-02-05 15:43:16 01836_date_time_keep_default_timezone_on_operations_den_crane: [ OK ] 0.22 sec.
2026-02-05 15:43:16 00755_avg_value_size_hint_passing: [ OK ] 0.87 sec.
2026-02-05 15:43:16 02947_merge_tree_index_table_2: [ OK ] 0.17 sec.
2026-02-05 15:43:16 03171_condition_pushdown: [ OK ] 0.12 sec.
2026-02-05 15:43:16 01576_if_null_external_aggregation: [ OK ] 1.37 sec.
2026-02-05 15:43:16 00169_join_constant_keys: [ OK ] 0.17 sec.
2026-02-05 15:43:16 01690_quantilesTiming_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:43:17 02703_storage_s3_race: [ OK ] 1.22 sec.
2026-02-05 15:43:17 02875_fix_column_decimal_serialization: [ OK ] 0.17 sec.
2026-02-05 15:43:17 00804_test_deflate_qpl_codec_compression: [ OK ] 0.22 sec.
2026-02-05 15:43:17 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.02 sec.
2026-02-05 15:43:17 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 1.32 sec.
2026-02-05 15:43:17 02417_keeper_map_create_drop: [ OK ] 0.22 sec.
2026-02-05 15:43:17 02453_check_path_in_errors_logger: [ OK ] 0.17 sec.
2026-02-05 15:43:18 02455_default_union_except_intersect: [ OK ] 0.53 sec.
2026-02-05 15:43:18 01569_query_profiler_big_query_id: [ OK ] 1.92 sec.
2026-02-05 15:43:18 00900_orc_arrow_parquet_tuples: [ OK ] 2.53 sec.
2026-02-05 15:43:18 01128_generate_random_nested: [ OK ] 0.47 sec.
2026-02-05 15:43:18 00807_regexp_quote_meta: [ OK ] 0.22 sec.
2026-02-05 15:43:18 03170_float_schema_inference_small_block: [ OK ] 1.38 sec.
2026-02-05 15:43:18 00577_replacing_merge_tree_vertical_merge: [ OK ] 0.32 sec.
2026-02-05 15:43:18 02354_window_expression_with_aggregation_expression: [ OK ] 0.17 sec.
2026-02-05 15:43:18 02841_check_table_progress: [ OK ] 0.87 sec.
2026-02-05 15:43:18 00723_remerge_sort: [ OK ] 0.22 sec.
2026-02-05 15:43:18 02416_rocksdb_delete_update: [ OK ] 0.27 sec.
2026-02-05 15:43:19 02922_respect_nulls_parser: [ OK ] 0.27 sec.
2026-02-05 15:43:19 01035_lc_empty_part_bug: [ OK ] 0.72 sec.
2026-02-05 15:43:19 02293_ttest_large_samples: [ OK ] 0.72 sec.
2026-02-05 15:43:19 02002_system_table_with_tuple: [ OK ] 0.52 sec.
2026-02-05 15:43:19 01917_system_data_skipping_indices: [ OK ] 0.22 sec.
2026-02-05 15:43:19 02187_async_inserts_all_formats: [ OK ] 17.83 sec.
2026-02-05 15:43:20 02030_quantiles_underflow: [ OK ] 0.17 sec.
2026-02-05 15:43:20 01213_optimize_skip_unused_shards_DISTINCT: [ OK ] 0.22 sec.
2026-02-05 15:43:20 02364_setting_cross_to_inner_rewrite: [ OK ] 0.17 sec.
2026-02-05 15:43:20 02369_lost_part_intersecting_merges: [ OK ] 3.38 sec.
2026-02-05 15:43:20 02475_analysis_of_variance: [ OK ] 0.22 sec.
2026-02-05 15:43:20 02270_errors_in_files: [ OK ] 1.82 sec.
2026-02-05 15:43:20 01412_row_from_totals: [ OK ] 0.22 sec.
2026-02-05 15:43:20 01907_multiple_aliases: [ OK ] 0.17 sec.
2026-02-05 15:43:20 02474_timeDiff_UTCTimestamp: [ OK ] 0.17 sec.
2026-02-05 15:43:21 00562_rewrite_select_expression_with_union: [ OK ] 0.17 sec.
2026-02-05 15:43:21 02815_analyzer_aggregate_functions_of_group_by_keys: [ OK ] 0.72 sec.
2026-02-05 15:43:21 00070_insert_fewer_columns_http: [ OK ] 0.47 sec.
2026-02-05 15:43:21 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.17 sec.
2026-02-05 15:43:21 01114_mysql_database_engine_segfault: [ OK ] 0.17 sec.
2026-02-05 15:43:21 00602_throw_if: [ OK ] 2.08 sec.
2026-02-05 15:43:21 01456_ast_optimizations_over_distributed: [ OK ] 0.22 sec.
2026-02-05 15:43:22 01710_projection_pk_trivial_count: [ OK ] 0.17 sec.
2026-02-05 15:43:22 01317_no_password_in_command_line: [ OK ] 3.13 sec.
2026-02-05 15:43:22 02475_or_function_alias_and_const_where: [ OK ] 0.17 sec.
2026-02-05 15:43:22 03199_queries_with_new_analyzer: [ OK ] 0.22 sec.
2026-02-05 15:43:22 02304_grouping_set_order_by: [ OK ] 0.12 sec.
2026-02-05 15:43:22 02340_union_header: [ OK ] 0.22 sec.
2026-02-05 15:43:23 03198_unload_primary_key_outdated: [ OK ] 1.98 sec.
2026-02-05 15:43:23 00976_max_execution_speed: [ OK ] 3.13 sec.
2026-02-05 15:43:23 02122_parallel_formatting_Values: [ OK ] 1.17 sec.
2026-02-05 15:43:24 00354_host_command_line_option: [ OK ] 0.82 sec.
2026-02-05 15:43:24 02521_merge_over_gap: [ OK ] 2.58 sec.
2026-02-05 15:43:24 00250_tuple_comparison: [ OK ] 0.27 sec.
2026-02-05 15:43:24 02133_classification: [ OK ] 0.37 sec.
2026-02-05 15:43:24 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.17 sec.
2026-02-05 15:43:24 03203_hive_style_partitioning: [ OK ] 2.18 sec.
2026-02-05 15:43:24 03144_invalid_filter: [ OK ] 0.22 sec.
2026-02-05 15:43:25 02919_skip_lots_of_parsing_errors: [ OK ] 5.64 sec.
2026-02-05 15:43:25 01435_lcm_overflow: [ OK ] 0.22 sec.
2026-02-05 15:43:25 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.27 sec.
2026-02-05 15:43:25 01277_alter_rename_column_constraint_zookeeper_long: [ OK ] 0.52 sec.
2026-02-05 15:43:25 02763_mutate_compact_part_with_skip_indices_and_projections: [ OK ] 0.22 sec.
2026-02-05 15:43:25 03014_analyzer_group_by_use_nulls: [ OK ] 0.17 sec.
2026-02-05 15:43:25 01353_nullable_tuple: [ OK ] 0.42 sec.
2026-02-05 15:43:25 02175_distributed_join_current_database: [ OK ] 0.17 sec.
2026-02-05 15:43:25 02372_analyzer_join: [ OK ] 2.08 sec.
2026-02-05 15:43:25 00057_join_aliases: [ OK ] 0.17 sec.
2026-02-05 15:43:25 02813_series_period_detect: [ OK ] 0.22 sec.
2026-02-05 15:43:25 02864_replace_regexp_string_fallback: [ OK ] 0.22 sec.
2026-02-05 15:43:25 00129_quantile_timing_weighted: [ OK ] 0.17 sec.
2026-02-05 15:43:25 01797_StripeLog_rwlock_ub: [ OK ] 0.17 sec.
2026-02-05 15:43:25 02945_blake3_msan: [ OK ] 0.12 sec.
2026-02-05 15:43:25 00640_endsWith: [ OK ] 0.27 sec.
2026-02-05 15:43:26 00117_parsing_arrays: [ OK ] 0.17 sec.
2026-02-05 15:43:26 00475_in_join_db_table: [ OK ] 0.27 sec.
2026-02-05 15:43:26 00906_low_cardinality_const_argument: [ OK ] 0.12 sec.
2026-02-05 15:43:26 01000_subquery_requires_alias: [ OK ] 0.17 sec.
2026-02-05 15:43:26 02496_row_binary_large_string_size: [ OK ] 0.57 sec.
2026-02-05 15:43:26 02206_information_schema_show_database: [ OK ] 0.17 sec.
2026-02-05 15:43:26 02366_kql_func_dynamic: [ OK ] 0.72 sec.
2026-02-05 15:43:26 01747_transform_empty_arrays: [ OK ] 0.12 sec.
2026-02-05 15:43:26 01472_many_rows_in_totals: [ OK ] 0.17 sec.
2026-02-05 15:43:26 01451_wrong_error_long_query: [ OK ] 0.47 sec.
2026-02-05 15:43:27 02680_mysql_ast_logical_err: [ OK ] 0.17 sec.
2026-02-05 15:43:27 03120_analyzer_dist_join: [ OK ] 0.37 sec.
2026-02-05 15:43:27 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.17 sec.
2026-02-05 15:43:27 00700_decimal_in_keys: [ OK ] 0.22 sec.
2026-02-05 15:43:27 02202_use_skip_indexes_if_final: [ OK ] 0.27 sec.
2026-02-05 15:43:28 00564_versioned_collapsing_merge_tree: [ OK ] 2.88 sec.
2026-02-05 15:43:28 01824_move_to_prewhere_many_columns: [ OK ] 0.22 sec.
2026-02-05 15:43:28 02122_parallel_formatting_Template: [ OK ] 1.13 sec.
2026-02-05 15:43:28 01825_new_type_json_11: [ OK ] 1.72 sec.
2026-02-05 15:43:28 00390_array_sort: [ OK ] 0.32 sec.
2026-02-05 15:43:28 01032_cityHash64_for_decimal: [ OK ] 0.17 sec.
2026-02-05 15:43:28 00488_non_ascii_column_names: [ OK ] 0.17 sec.
2026-02-05 15:43:28 02710_date_diff_aliases: [ OK ] 0.17 sec.
2026-02-05 15:43:28 00143_number_classification_functions: [ OK ] 0.22 sec.
2026-02-05 15:43:29 02895_npy_format: [ OK ] 5.99 sec.
2026-02-05 15:43:29 02814_age_datediff: [ OK ] 0.32 sec.
2026-02-05 15:43:29 02243_make_date32: [ OK ] 0.42 sec.
2026-02-05 15:43:29 02771_skip_empty_files: [ OK ] 1.82 sec.
2026-02-05 15:43:29 02271_fix_column_matcher_and_column_transformer: [ OK ] 0.22 sec.
2026-02-05 15:43:29 01910_memory_tracking_topk: [ OK ] 0.17 sec.
2026-02-05 15:43:29 02501_analyzer_expired_context_crash_fix: [ OK ] 0.22 sec.
2026-02-05 15:43:29 01601_accurate_cast: [ OK ] 0.87 sec.
2026-02-05 15:43:29 01664_decimal_ubsan: [ OK ] 0.23 sec.
2026-02-05 15:43:30 02933_group_by_memory_usage: [ OK ] 1.42 sec.
2026-02-05 15:43:30 01947_mv_subquery: [ OK ] 0.77 sec.
2026-02-05 15:43:30 01010_partial_merge_join: [ OK ] 1.12 sec.
2026-02-05 15:43:30 01496_signedness_conversion_monotonicity: [ OK ] 0.17 sec.
2026-02-05 15:43:30 00809_add_days_segfault: [ OK ] 0.27 sec.
2026-02-05 15:43:30 01825_new_type_json_bools: [ OK ] 0.17 sec.
2026-02-05 15:43:30 00933_ttl_with_default: [ OK ] 0.27 sec.
2026-02-05 15:43:30 02226_parallel_reading_from_replicas_benchmark: [ OK ] 0.98 sec.
2026-02-05 15:43:31 01820_unhex_case_insensitive: [ OK ] 0.17 sec.
2026-02-05 15:43:31 02016_order_by_with_fill_monotonic_functions_removal: [ OK ] 0.17 sec.
2026-02-05 15:43:31 03009_storage_memory_circ_buffer_usage: [ OK ] 0.32 sec.
2026-02-05 15:43:31 01759_optimize_skip_unused_shards_zero_shards: [ OK ] 0.17 sec.
2026-02-05 15:43:31 00098_shard_i_union_all: [ OK ] 0.22 sec.
2026-02-05 15:43:31 03033_final_undefined_last_mark: [ OK ] 0.17 sec.
2026-02-05 15:43:31 02966_nested_offsets_subcolumn: [ OK ] 0.47 sec.
2026-02-05 15:43:31 02364_window_case: [ OK ] 0.17 sec.
2026-02-05 15:43:31 02122_parallel_formatting_Vertical: [ OK ] 2.07 sec.
2026-02-05 15:43:31 02097_polygon_dictionary_store_key: [ OK ] 0.22 sec.
2026-02-05 15:43:31 01670_distributed_bytes_to_throw_insert: [ OK ] 0.22 sec.
2026-02-05 15:43:31 01671_merge_join_and_constants: [ OK ] 0.22 sec.
2026-02-05 15:43:31 00262_alter_alias: [ OK ] 0.22 sec.
2026-02-05 15:43:31 02725_sleep_max_time: [ OK ] 0.12 sec.
2026-02-05 15:43:31 01479_cross_join_9855: [ OK ] 0.17 sec.
2026-02-05 15:43:31 00347_has_tuple: [ OK ] 0.22 sec.
2026-02-05 15:43:32 01380_nullable_state: [ OK ] 0.37 sec.
2026-02-05 15:43:32 02900_issue_55858: [ OK ] 0.32 sec.
2026-02-05 15:43:32 00233_position_function_sql_comparibilty: [ OK ] 0.22 sec.
2026-02-05 15:43:32 02174_cte_scalar_cache_mv: [ OK ] 1.07 sec.
2026-02-05 15:43:32 01144_join_rewrite_with_ambiguous_column_and_view: [ OK ] 0.22 sec.
2026-02-05 15:43:32 01892_setting_limit_offset_distributed: [ OK ] 0.17 sec.
2026-02-05 15:43:32 02124_clickhouse_dictionary_with_predefined_configuration: [ OK ] 0.17 sec.
2026-02-05 15:43:32 03071_fix_short_circuit_logic: [ OK ] 0.22 sec.
2026-02-05 15:43:32 02342_window_view_different_struct: [ OK ] 0.27 sec.
2026-02-05 15:43:33 02221_system_zookeeper_unrestricted: [ OK ] 1.17 sec.
2026-02-05 15:43:33 02921_bit_hamming_distance_big_int: [ OK ] 0.17 sec.
2026-02-05 15:43:33 02677_decode_url_component: [ OK ] 0.27 sec.
2026-02-05 15:43:33 02675_grant_query_formatting: [ OK ] 0.42 sec.
2026-02-05 15:43:33 00974_final_predicate_push_down: [ OK ] 0.17 sec.
2026-02-05 15:43:34 03006_join_on_inequal_expression_4: [ OK ] 0.47 sec.
2026-02-05 15:43:34 01821_join_table_race_long: [ OK ] 1.72 sec.
2026-02-05 15:43:34 01556_explain_select_with_union_query: [ OK ] 0.22 sec.
2026-02-05 15:43:34 00405_PrettyCompactMonoBlock: [ OK ] 0.77 sec.
2026-02-05 15:43:34 00917_least_sqr: [ OK ] 0.22 sec.
2026-02-05 15:43:34 01910_view_dictionary_check_refresh: [ OK ] 24.29 sec.
2026-02-05 15:43:34 01273_lc_fixed_string_field: [ OK ] 0.17 sec.
2026-02-05 15:43:34 01125_dict_ddl_cannot_add_column: [ OK ] 0.22 sec.
2026-02-05 15:43:34 00326_long_function_multi_if: [ OK ] 13.28 sec.
2026-02-05 15:43:34 02184_nested_tuple: [ OK ] 0.27 sec.
2026-02-05 15:43:34 00005_shard_format_ast_and_remote_table_lambda: [ OK ] 0.22 sec.
2026-02-05 15:43:34 02271_temporary_table_show_rows_bytes: [ OK ] 0.17 sec.
2026-02-05 15:43:34 00861_decimal_quoted_csv: [ OK ] 0.22 sec.
2026-02-05 15:43:34 02918_wrong_dictionary_source: [ OK ] 0.17 sec.
2026-02-05 15:43:34 01552_alter_name_collision: [ OK ] 0.17 sec.
2026-02-05 15:43:35 00732_quorum_insert_have_data_before_quorum_zookeeper_long: [ OK ] 0.37 sec.
2026-02-05 15:43:35 03252_recursive_proto_with_skip_unsupported_fields: [ OK ] 0.72 sec.
2026-02-05 15:43:35 01018_optimize_read_in_order_with_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:43:35 00746_hashing_tuples: [ OK ] 0.22 sec.
2026-02-05 15:43:35 00688_low_cardinality_prewhere: [ OK ] 0.32 sec.
2026-02-05 15:43:35 01272_suspicious_codecs: [ OK ] 0.57 sec.
2026-02-05 15:43:35 01103_check_cpu_instructions_at_startup: [ OK ] 3.33 sec.
2026-02-05 15:43:35 01665_running_difference_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:43:35 00308_write_buffer_valid_utf8: [ OK ] 0.17 sec.
2026-02-05 15:43:35 02245_make_datetime64: [ OK ] 0.58 sec.
2026-02-05 15:43:35 00383_utf8_validation: [ OK ] 0.12 sec.
2026-02-05 15:43:35 02984_topk_empty_merge: [ OK ] 0.17 sec.
2026-02-05 15:43:35 02813_starting_in_text_log: [ OK ] 0.57 sec.
2026-02-05 15:43:36 02366_kql_mvexpand: [ OK ] 0.27 sec.
2026-02-05 15:43:36 02122_parallel_formatting_JSONCompact: [ OK ] 1.27 sec.
2026-02-05 15:43:36 02454_compressed_marks_in_compact_part: [ OK ] 0.17 sec.
2026-02-05 15:43:36 00414_time_zones_direct_conversion: [ OK ] 0.17 sec.
2026-02-05 15:43:36 01393_benchmark_secure_port: [ OK ] 0.77 sec.
2026-02-05 15:43:36 01813_distributed_scalar_subqueries_alias: [ OK ] 0.22 sec.
2026-02-05 15:43:36 00926_adaptive_index_granularity_merge_tree: [ OK ] 0.77 sec.
2026-02-05 15:43:36 01803_const_nullable_map: [ OK ] 0.17 sec.
2026-02-05 15:43:36 02985_parser_check_stack_size: [ OK ] 0.77 sec.
2026-02-05 15:43:36 01227_distributed_global_in_issue_2610: [ OK ] 0.22 sec.
2026-02-05 15:43:36 02552_regression_crash: [ OK ] 0.17 sec.
2026-02-05 15:43:36 02012_zookeeper_changed_enum_type: [ OK ] 0.22 sec.
2026-02-05 15:43:36 00229_prewhere_column_missing: [ OK ] 0.27 sec.
2026-02-05 15:43:36 00623_truncate_table: [ OK ] 0.47 sec.
2026-02-05 15:43:37 01779_quantile_deterministic_msan: [ OK ] 0.17 sec.
2026-02-05 15:43:37 03209_parallel_replicas_order_by_all: [ OK ] 0.22 sec.
2026-02-05 15:43:37 02024_storage_filelog_mv: [ OK ] 5.24 sec.
2026-02-05 15:43:37 00911_tautological_compare: [ OK ] 0.12 sec.
2026-02-05 15:43:37 03274_udf_in_join: [ OK ] 0.62 sec.
2026-02-05 15:43:37 02417_null_variadic_behaviour: [ OK ] 0.62 sec.
2026-02-05 15:43:37 01373_summing_merge_tree_explicit_columns_definition: [ OK ] 0.12 sec.
2026-02-05 15:43:37 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.17 sec.
2026-02-05 15:43:37 00662_has_nullable: [ OK ] 0.23 sec.
2026-02-05 15:43:38 02126_url_auth: [ OK ] 1.07 sec.
2026-02-05 15:43:38 02441_alter_delete_and_drop_column: [ OK ] 0.42 sec.
2026-02-05 15:43:38 02383_array_signed_const_positive_index: [ OK ] 0.27 sec.
2026-02-05 15:43:38 01605_key_condition_enum_int: [ OK ] 0.17 sec.
2026-02-05 15:43:38 01300_group_by_other_keys: [ OK ] 1.07 sec.
2026-02-05 15:43:38 02702_logical_optimizer_with_nulls: [ OK ] 0.22 sec.
2026-02-05 15:43:38 01345_index_date_vs_datetime: [ OK ] 0.22 sec.
2026-02-05 15:43:38 02922_analyzer_aggregate_nothing_type: [ OK ] 0.87 sec.
2026-02-05 15:43:39 02427_column_nullable_ubsan: [ OK ] 0.22 sec.
2026-02-05 15:43:39 01772_intdiv_minus_one_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:43:39 03173_distinct_combinator_alignment: [ OK ] 0.17 sec.
2026-02-05 15:43:39 02784_schema_inference_null_as_default: [ OK ] 0.17 sec.
2026-02-05 15:43:39 02572_materialized_views_ignore_errors: [ OK ] 0.42 sec.
2026-02-05 15:43:39 01659_h3_buffer_overflow: [ OK ] 0.27 sec.
2026-02-05 15:43:39 01049_join_low_card_crash: [ OK ] 0.17 sec.
2026-02-05 15:43:39 03008_uniq_exact_equal_ranges: [ OK ] 2.42 sec.
2026-02-05 15:43:40 01923_ttl_with_modify_column: [ OK ] 0.22 sec.
2026-02-05 15:43:40 01822_async_read_from_socket_crash: [ OK ] 4.53 sec.
2026-02-05 15:43:40 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.12 sec.
2026-02-05 15:43:40 00705_aggregate_states_addition: [ OK ] 0.27 sec.
2026-02-05 15:43:40 02493_inconsistent_hex_and_binary_number: [ OK ] 1.02 sec.
2026-02-05 15:43:40 02355_column_type_name_lc: [ OK ] 0.12 sec.
2026-02-05 15:43:40 02963_test_flexible_disk_configuration: [ OK ] 0.47 sec.
2026-02-05 15:43:40 01001_enums_in_in_section: [ OK ] 0.17 sec.
2026-02-05 15:43:40 03246_alter_update_dynamic_hung: [ OK ] 0.22 sec.
2026-02-05 15:43:40 00563_insert_into_remote_and_zookeeper_long: [ OK ] 0.27 sec.
2026-02-05 15:43:41 01227_distributed_merge_global_in_primary_key: [ OK ] 0.37 sec.
2026-02-05 15:43:41 00834_not_between: [ OK ] 0.17 sec.
2026-02-05 15:43:41 00732_quorum_insert_select_with_old_data_and_without_quorum_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:43:41 01115_join_with_dictionary: [ OK ] 0.42 sec.
2026-02-05 15:43:41 00417_system_build_options: [ OK ] 0.52 sec.
2026-02-05 15:43:42 00747_contributors: [ OK ] 0.17 sec.
2026-02-05 15:43:42 01773_datetime64_add_ubsan: [ OK ] 0.12 sec.
2026-02-05 15:43:42 01417_query_time_in_system_events: [ OK ] 3.13 sec.
2026-02-05 15:43:42 02531_semi_join_null_const_bug: [ OK ] 0.17 sec.
2026-02-05 15:43:42 03210_nested_short_circuit_functions_bug: [ OK ] 0.17 sec.
2026-02-05 15:43:42 03148_asof_join_ddb_subquery: [ OK ] 0.22 sec.
2026-02-05 15:43:42 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.17 sec.
2026-02-05 15:43:42 02260_alter_compact_part_drop_nested_column: [ OK ] 0.27 sec.
2026-02-05 15:43:43 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.27 sec.
2026-02-05 15:43:43 01062_window_view_event_hop_watch_asc: [ OK ] 1.37 sec.
2026-02-05 15:43:43 01801_distinct_group_by_shard: [ OK ] 0.12 sec.
2026-02-05 15:43:43 02841_with_clause_resolve: [ OK ] 0.42 sec.
2026-02-05 15:43:43 02179_bool_type: [ OK ] 0.27 sec.
2026-02-05 15:43:43 02934_merge_tree_max_projections: [ OK ] 0.22 sec.
2026-02-05 15:43:43 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:43:43 01177_group_array_moving: [ OK ] 0.17 sec.
2026-02-05 15:43:43 00331_final_and_prewhere_condition_ver_column: [ OK ] 0.17 sec.
2026-02-05 15:43:43 02884_duplicate_index_name: [ OK ] 0.12 sec.
2026-02-05 15:43:43 02524_fuzz_and_fuss: [ OK ] 0.12 sec.
2026-02-05 15:43:43 03222_datetime64_small_value_const: [ OK ] 0.37 sec.
2026-02-05 15:43:44 02007_test_any_all_operators: [ OK ] 0.27 sec.
2026-02-05 15:43:44 01399_http_request_headers: [ OK ] 0.57 sec.
2026-02-05 15:43:44 00145_empty_likes: [ OK ] 0.22 sec.
2026-02-05 15:43:44 02210_toColumnTypeName_toLowCardinality_const: [ OK ] 0.17 sec.
2026-02-05 15:43:44 01091_insert_with_default_json: [ OK ] 0.22 sec.
2026-02-05 15:43:44 01350_intdiv_nontrivial_fpe: [ OK ] 0.22 sec.
2026-02-05 15:43:44 01344_min_bytes_to_use_mmap_io_index: [ OK ] 0.32 sec.
2026-02-05 15:43:44 01175_distributed_ddl_output_mode_long: [ OK ] 8.20 sec.
2026-02-05 15:43:45 01428_hash_set_nan_key: [ OK ] 0.17 sec.
2026-02-05 15:43:45 02430_bitmap_transform_exception_code: [ OK ] 0.17 sec.
2026-02-05 15:43:45 03248_invalid_where: [ OK ] 0.12 sec.
2026-02-05 15:43:45 02017_columns_with_dot: [ OK ] 0.22 sec.
2026-02-05 15:43:45 02242_throw_if_constant_argument: [ OK ] 0.17 sec.
2026-02-05 15:43:45 02485_zero_copy_commit_error: [ OK ] 4.39 sec.
2026-02-05 15:43:45 02030_function_mapContainsKeyLike: [ OK ] 0.27 sec.
2026-02-05 15:43:45 02704_max_backup_bandwidth: [ OK ] 7.84 sec.
2026-02-05 15:43:45 00207_left_array_join: [ OK ] 0.12 sec.
2026-02-05 15:43:45 02141_clickhouse_local_interactive_table: [ OK ] 0.57 sec.
2026-02-05 15:43:45 02981_insert_select_resize_to_max_insert_threads: [ OK ] 0.82 sec.
2026-02-05 15:43:46 02944_variant_as_common_type: [ FAIL ] 0.32 sec.
2026-02-05 15:43:46 Reason: result differs with reference:
2026-02-05 15:43:46 --- /usr/share/clickhouse-test/queries/0_stateless/02944_variant_as_common_type.reference 2026-02-05 15:33:32.984792405 -0300
2026-02-05 15:43:46 +++ /tmp/clickhouse-test/0_stateless/02944_variant_as_common_type.stdout 2026-02-05 15:43:46.131527838 -0300
2026-02-05 15:43:46 @@ -1,51 +1,51 @@
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -Array(UInt8) [1,2,3]
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 -String str_0
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -String str_2
2026-02-05 15:43:46 -String str_3
2026-02-05 15:43:46 -Nullable(String) str_0
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -Nullable(String) str_2
2026-02-05 15:43:46 -Nullable(String) str_3
2026-02-05 15:43:46 -Array(UInt64) [0]
2026-02-05 15:43:46 -Array(UInt64) [0,1]
2026-02-05 15:43:46 -Array(UInt64) [0,1,2]
2026-02-05 15:43:46 -Array(UInt64) [0,1,2,3]
2026-02-05 15:43:46 -Array(UInt64) [0]
2026-02-05 15:43:46 -Array(UInt64) [0,1]
2026-02-05 15:43:46 -Array(UInt64) [0,1,2]
2026-02-05 15:43:46 -Array(UInt64) [0,1,2,3]
2026-02-05 15:43:46 -String str_0
2026-02-05 15:43:46 -String str_1
2026-02-05 15:43:46 -String str_2
2026-02-05 15:43:46 -String str_3
2026-02-05 15:43:46 -Nullable(String) str_0
2026-02-05 15:43:46 -Nullable(String) str_1
2026-02-05 15:43:46 -Nullable(String) str_2
2026-02-05 15:43:46 -Nullable(String) str_3
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) [1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt8), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_0
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_2
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_3
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_0
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_2
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_3
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1,2]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1,2]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) [0,1,2,3]
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_0
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_2
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_3
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_0
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_1
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_2
2026-02-05 15:43:46 +Variant(Array(UInt64), String) str_3
2026-02-05 15:43:46 Variant(Array(UInt64), String) str_0
2026-02-05 15:43:46 Variant(Array(UInt64), String) str_1
2026-02-05 15:43:46 Variant(Array(UInt64), String) str_2
2026-02-05 15:43:46
2026-02-05 15:43:46
2026-02-05 15:43:46 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 693251 --group_by_two_level_threshold_bytes 43166948 --distributed_aggregation_memory_efficient 1 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 6441677 --max_read_buffer_size 949865 --prefer_localhost_replica 1 --max_block_size 53051 --max_joined_block_size_rows 45294 --max_threads 3 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 64 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 30801243 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1415224440 --min_bytes_to_use_mmap_io 8381328791 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 16 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1984877893 --min_compress_block_size 1776051 --max_compress_block_size 2414626 --merge_tree_compact_parts_min_granules_to_multibuffer_read 13 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 3702050 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.88 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0
2026-02-05 15:43:46
2026-02-05 15:43:46 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 6336980450 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 19869481 --merge_max_block_size 22199 --index_granularity 26743 --min_bytes_for_wide_part 820176080 --marks_compress_block_size 67878 --primary_key_compress_block_size 32579 --replace_long_file_name_to_hash 0 --max_file_name_length 86 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 188340965 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 23834056 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 10
2026-02-05 15:43:46
2026-02-05 15:43:46 Database: test_avc7rvcs
2026-02-05 15:43:46 00702_join_with_using_dups: [ OK ] 0.22 sec.
2026-02-05 15:43:46 02895_peak_memory_usage_http_headers_regression: [ OK ] 0.47 sec.
2026-02-05 15:43:46 02462_distributions: [ OK ] 0.37 sec.
2026-02-05 15:43:47 01676_range_hashed_dictionary: [ OK ] 0.37 sec.
2026-02-05 15:43:47 01300_client_save_history_when_terminated_long: [ OK ] 1.02 sec.
2026-02-05 15:43:47 00539_functions_for_working_with_json: [ OK ] 0.22 sec.
2026-02-05 15:43:47 02115_write_buffers_finalize: [ OK ] 3.88 sec.
2026-02-05 15:43:47 01670_test_repeat_mysql_dialect: [ OK ] 0.17 sec.
2026-02-05 15:43:47 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.12 sec.
2026-02-05 15:43:47 02317_functions_with_nothing: [ OK ] 0.22 sec.
2026-02-05 15:43:48 03291_json_big_structure_deserialization: [ OK ] 8.44 sec.
2026-02-05 15:43:48 01066_bit_count: [ OK ] 0.22 sec.
2026-02-05 15:43:48 01710_normal_projections: [ OK ] 3.04 sec.
2026-02-05 15:43:49 00039_inserts_through_http: [ OK ] 0.78 sec.
2026-02-05 15:43:49 01231_markdown_format: [ OK ] 0.22 sec.
2026-02-05 15:43:49 00842_array_with_constant_overflow: [ OK ] 0.17 sec.
2026-02-05 15:43:49 02807_math_unary_crash: [ OK ] 0.17 sec.
2026-02-05 15:43:49 03290_final_sample: [ OK ] 0.22 sec.
2026-02-05 15:43:49 00937_ipv4_cidr_range: [ OK ] 0.17 sec.
2026-02-05 15:43:50 02907_preferred_optimize_projection_name: [ OK ] 2.68 sec.
2026-02-05 15:43:50 02661_read_from_archive_targz: [ OK ] 5.23 sec.
2026-02-05 15:43:50 02476_fuse_sum_count: [ OK ] 0.27 sec.
2026-02-05 15:43:51 01504_view_type_conversion: [ OK ] 0.17 sec.
2026-02-05 15:43:51 01686_event_time_microseconds_part_log: [ OK ] 1.78 sec.
2026-02-05 15:43:51 03144_asof_join_ddb_doubles: [ OK ] 0.22 sec.
2026-02-05 15:43:51 00649_quantile_tdigest_negative: [ OK ] 0.12 sec.
2026-02-05 15:43:51 00063_check_query: [ OK ] 0.22 sec.
2026-02-05 15:43:51 00995_exception_while_insert: [ OK ] 1.12 sec.
2026-02-05 15:43:52 02373_progress_contain_result: [ OK ] 0.42 sec.
2026-02-05 15:43:52 02114_offset_fetch_without_order_by: [ OK ] 0.42 sec.
2026-02-05 15:43:52 02990_optimize_uniq_to_count_alias: [ OK ] 0.22 sec.
2026-02-05 15:43:52 00750_merge_tree_merge_with_o_direct: [ OK ] 0.22 sec.
2026-02-05 15:43:52 02426_pod_array_overflow_3: [ OK ] 0.12 sec.
2026-02-05 15:43:52 02125_lz4_compression_bug_Values: [ OK ] 2.98 sec.
2026-02-05 15:43:52 00825_protobuf_format_splitted_nested: [ OK ] 1.07 sec.
2026-02-05 15:43:52 02521_analyzer_aggregation_without_column: [ OK ] 0.17 sec.
2026-02-05 15:43:52 02680_instr_alias_for_position_case_insensitive: [ OK ] 0.17 sec.
2026-02-05 15:43:52 02292_h3_unidirectional_funcs: [ OK ] 0.22 sec.
2026-02-05 15:43:52 00734_timeslot: [ OK ] 0.22 sec.
2026-02-05 15:43:52 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.32 sec.
2026-02-05 15:43:52 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.22 sec.
2026-02-05 15:43:53 00733_if_datetime: [ OK ] 0.17 sec.
2026-02-05 15:43:53 03032_variant_bool_number_not_suspicious: [ OK ] 0.17 sec.
2026-02-05 15:43:53 02534_join_prewhere_bug: [ OK ] 0.22 sec.
2026-02-05 15:43:53 02379_analyzer_subquery_depth: [ OK ] 0.17 sec.
2026-02-05 15:43:53 01870_modulo_partition_key: [ OK ] 0.57 sec.
2026-02-05 15:43:53 00483_cast_syntax: [ OK ] 0.17 sec.
2026-02-05 15:43:53 01622_defaults_for_url_engine: [ OK ] 0.52 sec.
2026-02-05 15:43:53 02508_index_analysis_to_date_timezone: [ OK ] 0.22 sec.
2026-02-05 15:43:53 01308_row_policy_and_trivial_count_query: [ OK ] 0.22 sec.
2026-02-05 15:43:53 02481_merge_array_join_sample_by: [ OK ] 0.27 sec.
2026-02-05 15:43:54 02475_date_time_schema_inference_bug: [ OK ] 0.12 sec.
2026-02-05 15:43:54 02998_analyzer_secret_args_tree_node: [ OK ] 0.17 sec.
2026-02-05 15:43:54 03155_explain_current_transaction: [ OK ] 0.17 sec.
2026-02-05 15:43:54 02900_buffer_table_alter_race: [ OK ] 6.69 sec.
2026-02-05 15:43:54 02205_map_populate_series_non_const: [ OK ] 0.47 sec.
2026-02-05 15:43:54 02932_kill_query_sleep: [ OK ] 2.07 sec.
2026-02-05 15:43:54 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:43:54 01255_geo_types_livace: [ OK ] 0.17 sec.
2026-02-05 15:43:54 02995_index_5: [ OK ] 28.46 sec.
2026-02-05 15:43:54 00448_replicate_nullable_tuple_generic: [ OK ] 0.17 sec.
2026-02-05 15:43:54 01660_system_parts_smoke: [ OK ] 0.32 sec.
2026-02-05 15:43:54 02346_non_negative_derivative: [ OK ] 0.37 sec.
2026-02-05 15:43:55 01646_rewrite_sum_if: [ OK ] 0.27 sec.
2026-02-05 15:43:55 00726_materialized_view_concurrent: [ OK ] 0.22 sec.
2026-02-05 15:43:55 01913_names_of_tuple_literal: [ OK ] 0.17 sec.
2026-02-05 15:43:55 00543_null_and_prewhere: [ OK ] 0.17 sec.
2026-02-05 15:43:55 00276_sample: [ OK ] 0.87 sec.
2026-02-05 15:43:55 02161_array_first_last: [ OK ] 0.22 sec.
2026-02-05 15:43:55 02158_explain_ast_alter_commands: [ OK ] 0.62 sec.
2026-02-05 15:43:55 01560_cancel_agg_func_combinator_native_name_constraint: [ OK ] 0.17 sec.
2026-02-05 15:43:55 00298_enum_width_and_cast: [ OK ] 0.17 sec.
2026-02-05 15:43:55 02574_suspicious_low_cardinality_msan: [ OK ] 0.27 sec.
2026-02-05 15:43:55 02481_default_value_used_in_row_level_filter: [ OK ] 0.22 sec.
2026-02-05 15:43:55 01582_any_join_supertype: [ OK ] 0.27 sec.
2026-02-05 15:43:56 02681_aggregation_by_partitions_bug: [ OK ] 0.27 sec.
2026-02-05 15:43:56 02792_alter_table_modify_comment: [ OK ] 2.52 sec.
2026-02-05 15:43:56 01825_type_json_nullable: [ OK ] 0.27 sec.
2026-02-05 15:43:56 02364_multiSearch_function_family: [ OK ] 1.67 sec.
2026-02-05 15:43:56 03006_join_on_inequal_expression_2: [ OK ] 0.62 sec.
2026-02-05 15:43:57 01075_in_arrays_enmk: [ OK ] 0.22 sec.
2026-02-05 15:43:57 01017_in_unconvertible_complex_type: [ OK ] 0.22 sec.
2026-02-05 15:43:57 00825_protobuf_format_map: [ OK ] 1.07 sec.
2026-02-05 15:43:57 03198_settings_in_csv_tsv_schema_cache: [ OK ] 0.82 sec.
2026-02-05 15:43:57 02122_parallel_formatting_PrettyCompact: [ OK ] 1.97 sec.
2026-02-05 15:43:57 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.27 sec.
2026-02-05 15:43:57 02020_alter_table_modify_comment: [ OK ] 12.20 sec.
2026-02-05 15:43:57 02863_non_const_timezone_check: [ OK ] 0.22 sec.
2026-02-05 15:43:58 03156_default_multiquery_split: [ OK ] 0.67 sec.
2026-02-05 15:43:58 02303_cast_nullable_to_custom_types: [ OK ] 0.27 sec.
2026-02-05 15:43:58 01302_polygons_distance: [ OK ] 0.17 sec.
2026-02-05 15:43:58 02500_numbers_inference: [ OK ] 2.33 sec.
2026-02-05 15:43:58 02421_new_type_json_async_insert: [ OK ] 3.18 sec.
2026-02-05 15:43:58 02499_analyzer_aggregate_function_lambda_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:43:58 02884_virtual_column_order_by: [ OK ] 0.17 sec.
2026-02-05 15:43:58 03143_window_functions_qualify_validation: [ OK ] 0.17 sec.
2026-02-05 15:43:58 01039_row_policy_dcl: [ OK ] 0.52 sec.
2026-02-05 15:43:58 00218_like_regexp_newline: [ OK ] 0.17 sec.
2026-02-05 15:43:58 00614_shard_same_header_for_local_and_remote_node_in_distributed_query: [ OK ] 0.17 sec.
2026-02-05 15:43:58 00499_json_enum_insert: [ OK ] 0.22 sec.
2026-02-05 15:43:58 00997_set_index_array: [ OK ] 0.72 sec.
2026-02-05 15:43:58 03094_analyzer_fiddle_multiif: [ OK ] 0.17 sec.
2026-02-05 15:43:58 02458_datediff_date32: [ OK ] 0.37 sec.
2026-02-05 15:43:58 03245_views_and_filter_push_down_bug: [ OK ] 0.17 sec.
2026-02-05 15:43:59 02270_client_name: [ OK ] 0.42 sec.
2026-02-05 15:43:59 02245_s3_schema_desc: [ OK ] 0.33 sec.
2026-02-05 15:43:59 00107_totals_after_having: [ OK ] 1.18 sec.
2026-02-05 15:43:59 02501_limits_on_result_for_view: [ OK ] 0.17 sec.
2026-02-05 15:43:59 03112_analyzer_not_found_column_in_block: [ OK ] 0.17 sec.
2026-02-05 15:43:59 01526_param_uuid: [ OK ] 0.52 sec.
2026-02-05 15:43:59 03146_create_index_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:44:00 01292_quantile_array_bug: [ OK ] 0.17 sec.
2026-02-05 15:44:00 01785_parallel_formatting_memory: [ OK ] 1.02 sec.
2026-02-05 15:44:00 02497_schema_inference_nulls: [ OK ] 0.27 sec.
2026-02-05 15:44:00 01387_clear_column_default_depends: [ OK ] 0.37 sec.
2026-02-05 15:44:00 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.57 sec.
2026-02-05 15:44:01 03008_deduplication_random_setttings: [ OK ] 1.57 sec.
2026-02-05 15:44:01 02122_parallel_formatting_JSONStringsEachRow: [ OK ] 2.19 sec.
2026-02-05 15:44:01 03173_row_binary_and_native_with_binary_encoded_types: [ OK ] 13.71 sec.
2026-02-05 15:44:01 00936_function_result_with_operator_in: [ OK ] 0.27 sec.
2026-02-05 15:44:01 01531_query_log_query_comment: [ OK ] 0.42 sec.
2026-02-05 15:44:01 00128_group_by_number_and_fixed_string: [ OK ] 0.18 sec.
2026-02-05 15:44:02 01798_uniq_theta_union_intersect_not: [ OK ] 0.37 sec.
2026-02-05 15:44:02 01060_window_view_event_tumble_to_asc: [ OK ] 1.38 sec.
2026-02-05 15:44:02 00690_insert_select_converting_exception_message: [ OK ] 1.17 sec.
2026-02-05 15:44:03 00933_ttl_replicated_zookeeper: [ OK ] 2.07 sec.
2026-02-05 15:44:03 01921_test_progress_bar: [ OK ] 0.47 sec.
2026-02-05 15:44:03 02597_column_update_and_replication: [ OK ] 1.27 sec.
2026-02-05 15:44:03 01213_point_in_Myanmar: [ OK ] 0.17 sec.
2026-02-05 15:44:04 01172_transaction_counters: [ OK ] 0.47 sec.
2026-02-05 15:44:04 03013_fuzz_arrayPartialReverseSort: [ OK ] 0.17 sec.
2026-02-05 15:44:04 02254_projection_broken_part: [ OK ] 2.43 sec.
2026-02-05 15:44:04 00175_if_num_arrays: [ OK ] 0.22 sec.
2026-02-05 15:44:04 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.17 sec.
2026-02-05 15:44:05 02661_read_from_archive_tarbzip2: [ OK ] 5.89 sec.
2026-02-05 15:44:05 02943_use_full_text_skip_index_with_has_any: [ OK ] 0.22 sec.
2026-02-05 15:44:05 01385_not_function: [ OK ] 0.17 sec.
2026-02-05 15:44:05 00472_compare_uuid_with_constant_string: [ OK ] 0.27 sec.
2026-02-05 15:44:05 02346_read_in_order_fixed_prefix: [ OK ] 7.24 sec.
2026-02-05 15:44:05 00988_expansion_aliases_limit: [ OK ] 0.22 sec.
2026-02-05 15:44:05 00118_storage_join: [ OK ] 0.32 sec.
2026-02-05 15:44:05 01137_sample_final: [ OK ] 0.42 sec.
2026-02-05 15:44:06 01585_use_index_for_global_in_with_null: [ OK ] 0.39 sec.
2026-02-05 15:44:06 02784_projections_read_in_order_bug: [ OK ] 0.34 sec.
2026-02-05 15:44:06 00259_hashing_tuples: [ OK ] 0.27 sec.
2026-02-05 15:44:06 03039_dynamic_versioned_collapsing_merge_tree: [ OK ] 5.60 sec.
2026-02-05 15:44:06 03004_force_null_for_omitted: [ OK ] 0.39 sec.
2026-02-05 15:44:06 01015_empty_in_inner_right_join: [ OK ] 0.44 sec.
2026-02-05 15:44:06 01692_DateTime64_from_DateTime: [ OK ] 0.33 sec.
2026-02-05 15:44:06 02032_short_circuit_least_greatest_bug: [ OK ] 0.27 sec.
2026-02-05 15:44:07 01916_low_cardinality_interval: [ OK ] 0.23 sec.
2026-02-05 15:44:07 01549_low_cardinality_materialized_view: [ OK ] 0.27 sec.
2026-02-05 15:44:07 02515_generate_ulid: [ OK ] 0.18 sec.
2026-02-05 15:44:07 01825_type_json_ephemeral: [ OK ] 0.27 sec.
2026-02-05 15:44:07 00508_materialized_view_to: [ OK ] 0.43 sec.
2026-02-05 15:44:07 00981_topK_topKWeighted_long: [ OK ] 4.09 sec.
2026-02-05 15:44:07 00841_temporary_table_database: [ OK ] 0.28 sec.
2026-02-05 15:44:08 02474_extract_fixedstring_from_json: [ OK ] 0.27 sec.
2026-02-05 15:44:08 00071_insert_fewer_columns: [ OK ] 0.27 sec.
2026-02-05 15:44:08 02898_input_format_values_allow_data_after_semicolon: [ OK ] 0.73 sec.
2026-02-05 15:44:08 01060_avro: [ OK ] 6.24 sec.
2026-02-05 15:44:08 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.22 sec.
2026-02-05 15:44:08 01295_aggregation_bug_11413: [ OK ] 0.18 sec.
2026-02-05 15:44:09 00688_aggregation_retention: [ OK ] 0.28 sec.
2026-02-05 15:44:09 01543_toModifiedJulianDay: [ OK ] 0.39 sec.
2026-02-05 15:44:09 02383_join_and_filtering_set: [ OK ] 2.98 sec.
2026-02-05 15:44:09 01164_detach_attach_partition_race: [ OK ] 10.81 sec.
2026-02-05 15:44:09 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.17 sec.
2026-02-05 15:44:09 03199_has_lc_fixed_string: [ OK ] 0.25 sec.
2026-02-05 15:44:09 02876_formats_with_names_dont_use_header: [ OK ] 0.68 sec.
2026-02-05 15:44:09 01030_storage_hdfs_syntax: [ OK ] 0.12 sec.
2026-02-05 15:44:09 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.33 sec.
2026-02-05 15:44:09 02133_distributed_queries_formatting: [ OK ] 0.22 sec.
2026-02-05 15:44:09 00477_parsing_data_types: [ OK ] 0.18 sec.
2026-02-05 15:44:09 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.17 sec.
2026-02-05 15:44:10 03210_inconsistent_formatting_of_data_types: [ OK ] 0.92 sec.
2026-02-05 15:44:10 02165_replicated_grouping_sets: [ OK ] 0.68 sec.
2026-02-05 15:44:10 00646_weird_mmx: [ OK ] 0.24 sec.
2026-02-05 15:44:10 02382_query_parameters_post: [ OK ] 0.62 sec.
2026-02-05 15:44:10 02497_if_transform_strings_to_enum: [ OK ] 0.53 sec.
2026-02-05 15:44:10 01042_check_query_and_last_granule_size: [ OK ] 0.32 sec.
2026-02-05 15:44:10 00102_insert_into_temporary_table: [ OK ] 0.17 sec.
2026-02-05 15:44:10 00177_inserts_through_http_parts: [ OK ] 0.68 sec.
2026-02-05 15:44:10 02734_optimize_group_by: [ OK ] 0.19 sec.
2026-02-05 15:44:10 02731_replace_partition_from_temporary_table: [ OK ] 0.78 sec.
2026-02-05 15:44:10 02564_analyzer_cross_to_inner: [ OK ] 0.43 sec.
2026-02-05 15:44:10 03262_udf_in_constraint: [ OK ] 0.64 sec.
2026-02-05 15:44:10 01497_now_support_timezone: [ OK ] 0.22 sec.
2026-02-05 15:44:11 01353_topk_enum: [ OK ] 0.17 sec.
2026-02-05 15:44:11 01655_plan_optimizations_optimize_read_in_window_order: [ OK ] 4.37 sec.
2026-02-05 15:44:11 01300_read_wkt: [ OK ] 0.32 sec.
2026-02-05 15:44:11 02366_union_decimal_conversion: [ OK ] 0.23 sec.
2026-02-05 15:44:11 02789_object_type_invalid_num_of_rows: [ OK ] 0.18 sec.
2026-02-05 15:44:11 03201_local_named_collections: [ OK ] 0.98 sec.
2026-02-05 15:44:12 01445_create_table_as_table_function: [ OK ] 1.03 sec.
2026-02-05 15:44:12 02561_sorting_constants_and_distinct_crash: [ OK ] 1.59 sec.
2026-02-05 15:44:12 02800_clickhouse_local_default_settings: [ OK ] 0.74 sec.
2026-02-05 15:44:12 03157_dynamic_type_json: [ OK ] 0.30 sec.
2026-02-05 15:44:13 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 5.07 sec.
2026-02-05 15:44:13 03163_dynamic_as_supertype: [ OK ] 0.22 sec.
2026-02-05 15:44:13 00800_low_cardinality_distributed_insert: [ OK ] 0.24 sec.
2026-02-05 15:44:13 02480_max_map_null_totals: [ OK ] 0.42 sec.
2026-02-05 15:44:13 02950_reading_array_tuple_subcolumns: [ OK ] 0.47 sec.
2026-02-05 15:44:14 02844_table_function_url_filter_by_virtual_columns: [ OK ] 0.77 sec.
2026-02-05 15:44:14 02158_ztest_cmp: [ OK ] 2.73 sec.
2026-02-05 15:44:14 01179_insert_values_semicolon: [ OK ] 0.62 sec.
2026-02-05 15:44:14 02113_base64encode_trailing_bytes_1: [ OK ] 0.17 sec.
2026-02-05 15:44:15 02785_global_join_too_many_columns: [ OK ] 0.27 sec.
2026-02-05 15:44:15 01050_engine_join_crash: [ OK ] 0.39 sec.
2026-02-05 15:44:15 00804_test_alter_compression_codecs: [ OK ] 3.40 sec.
2026-02-05 15:44:15 01772_to_start_of_hour_align: [ OK ] 0.27 sec.
2026-02-05 15:44:15 01069_materialized_view_alter_target_table: [ OK ] 0.27 sec.
2026-02-05 15:44:15 02176_dict_get_has_implicit_key_cast: [ OK ] 0.37 sec.
2026-02-05 15:44:15 01710_projections_order_by_complete: [ OK ] 0.22 sec.
2026-02-05 15:44:15 00500_point_in_polygon_2d_const: [ OK ] 0.17 sec.
2026-02-05 15:44:16 00931_low_cardinality_read_with_empty_array: [ OK ] 0.38 sec.
2026-02-05 15:44:16 00616_final_single_part: [ OK ] 0.27 sec.
2026-02-05 15:44:16 01213_alter_rename_primary_key_zookeeper_long: [ OK ] 0.37 sec.
2026-02-05 15:44:16 00274_shard_group_array: [ OK ] 0.32 sec.
2026-02-05 15:44:16 02458_insert_select_progress_tcp: [ OK ] 2.81 sec.
2026-02-05 15:44:16 03095_group_by_server_constants_bug: [ OK ] 0.27 sec.
2026-02-05 15:44:16 02377_majority_insert_quorum_zookeeper_long: [ OK ] 5.75 sec.
2026-02-05 15:44:16 00163_shard_join_with_empty_table: [ OK ] 0.62 sec.
2026-02-05 15:44:16 01459_decimal_casts: [ OK ] 0.30 sec.
2026-02-05 15:44:17 02039_group_by_with_totals_having: [ OK ] 0.23 sec.
2026-02-05 15:44:17 01946_profile_sleep: [ OK ] 1.09 sec.
2026-02-05 15:44:17 00718_low_cardinaliry_alter: [ OK ] 0.38 sec.
2026-02-05 15:44:17 02271_int_sql_compatibility: [ OK ] 0.22 sec.
2026-02-05 15:44:17 02358_file_default_value: [ OK ] 0.83 sec.
2026-02-05 15:44:17 02707_analyzer_nested_lambdas_types: [ OK ] 0.22 sec.
2026-02-05 15:44:17 02155_h3_to_center_child: [ OK ] 0.48 sec.
2026-02-05 15:44:17 02118_show_create_table_rocksdb: [ OK ] 0.17 sec.
2026-02-05 15:44:18 00762_date_comparsion: [ OK ] 0.28 sec.
2026-02-05 15:44:18 00700_decimal_bounds: [ OK ] 0.53 sec.
2026-02-05 15:44:18 02020_exponential_smoothing: [ OK ] 0.98 sec.
2026-02-05 15:44:18 02096_bad_options_in_client_and_local: [ OK ] 0.94 sec.
2026-02-05 15:44:19 02675_profile_events_from_query_log_and_client: [ OK ] 2.14 sec.
2026-02-05 15:44:19 02900_clickhouse_local_drop_current_database: [ OK ] 0.57 sec.
2026-02-05 15:44:19 01710_projection_optimize_materialize: [ OK ] 0.48 sec.
2026-02-05 15:44:19 01247_some_msan_crashs_from_22517: [ OK ] 0.22 sec.
2026-02-05 15:44:19 02457_morton_coding: [ OK ] 0.68 sec.
2026-02-05 15:44:19 02446_parent_zero_copy_locks: [ OK ] 3.04 sec.
2026-02-05 15:44:20 02009_mysql_client_empty_result: [ OK ] 0.68 sec.
2026-02-05 15:44:20 00799_function_dry_run: [ OK ] 0.22 sec.
2026-02-05 15:44:20 00941_system_columns_race_condition: [ OK ] 15.48 sec.
2026-02-05 15:44:20 01071_window_view_event_tumble_asc_join: [ OK ] 1.53 sec.
2026-02-05 15:44:20 01319_query_formatting_in_server_log: [ OK ] 0.37 sec.
2026-02-05 15:44:20 02962_analyzer_resolve_group_by_on_shards: [ OK ] 0.22 sec.
2026-02-05 15:44:20 01116_asof_join_dolbyzerr: [ OK ] 0.17 sec.
2026-02-05 15:44:20 02454_create_table_with_custom_disk: [ OK ] 0.27 sec.
2026-02-05 15:44:20 01804_uniq_up_to_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:44:20 01463_resample_overflow: [ OK ] 0.12 sec.
2026-02-05 15:44:20 00174_compare_date_time_with_constant_string_in_in: [ OK ] 0.17 sec.
2026-02-05 15:44:21 01475_read_subcolumns_3: [ OK ] 0.38 sec.
2026-02-05 15:44:21 00340_squashing_insert_select: [ OK ] 1.88 sec.
2026-02-05 15:44:21 02030_client_unknown_database: [ OK ] 0.59 sec.
2026-02-05 15:44:21 01018_ambiguous_column: [ OK ] 0.17 sec.
2026-02-05 15:44:21 01523_date_time_compare_with_date_literal: [ OK ] 0.59 sec.
2026-02-05 15:44:21 01778_where_with_column_name: [ OK ] 0.22 sec.
2026-02-05 15:44:22 03237_max_map_state_decimal_serialization: [ OK ] 0.13 sec.
2026-02-05 15:44:22 01296_pipeline_stuck: [ OK ] 0.39 sec.
2026-02-05 15:44:22 02898_parallel_replicas_progress_bar: [ OK ] 1.24 sec.
2026-02-05 15:44:23 03166_skip_indexes_vertical_merge_1: [ OK ] 0.62 sec.
2026-02-05 15:44:23 00700_decimal_defaults: [ OK ] 0.22 sec.
2026-02-05 15:44:23 02246_tsv_csv_best_effort_schema_inference: [ OK ] 10.88 sec.
2026-02-05 15:44:24 02721_url_cluster: [ OK ] 0.52 sec.
2026-02-05 15:44:24 02469_fix_aliases_parser: [ OK ] 0.27 sec.
2026-02-05 15:44:24 02047_client_exception: [ OK ] 0.83 sec.
2026-02-05 15:44:24 02534_keyed_siphash: [ OK ] 2.50 sec.
2026-02-05 15:44:24 00160_merge_and_index_in_in: [ OK ] 2.42 sec.
2026-02-05 15:44:24 00353_join_by_tuple: [ OK ] 0.17 sec.
2026-02-05 15:44:24 02525_jit_logical_functions_nan: [ OK ] 0.17 sec.
2026-02-05 15:44:26 00481_reading_from_last_granula: [ OK ] 1.68 sec.
2026-02-05 15:44:26 03008_s3_plain_rewritable: [ OK ] 5.59 sec.
2026-02-05 15:44:26 01045_bloom_filter_null_array: [ OK ] 1.43 sec.
2026-02-05 15:44:26 01855_jit_comparison_constant_result: [ OK ] 1.63 sec.
2026-02-05 15:44:26 02581_share_big_sets_between_mutation_tasks: [ OK ] 15.34 sec.
2026-02-05 15:44:26 01891_partition_hash_no_long_int: [ OK ] 0.22 sec.
2026-02-05 15:44:26 00530_arrays_of_nothing: [ OK ] 0.27 sec.
2026-02-05 15:44:26 02317_distinct_in_order_optimization: [ OK ] 2.19 sec.
2026-02-05 15:44:26 02809_has_subsequence: [ OK ] 0.43 sec.
2026-02-05 15:44:26 03231_dynamic_not_safe_primary_key: [ OK ] 0.27 sec.
2026-02-05 15:44:27 00975_move_partition_merge_tree: [ OK ] 0.62 sec.
2026-02-05 15:44:27 03243_create_or_replace_view_dependency_check: [ OK ] 0.18 sec.
2026-02-05 15:44:27 00211_shard_query_formatting_aliases: [ OK ] 0.27 sec.
2026-02-05 15:44:27 02387_analyzer_cte: [ OK ] 0.27 sec.
2026-02-05 15:44:27 02903_empty_order_by_throws_error: [ OK ] 0.73 sec.
2026-02-05 15:44:27 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.18 sec.
2026-02-05 15:44:27 00413_least_greatest_new_behavior: [ OK ] 0.23 sec.
2026-02-05 15:44:27 02918_sqlite_path_check: [ OK ] 0.78 sec.
2026-02-05 15:44:27 03168_fuzz_multiIf_short_circuit: [ OK ] 0.17 sec.
2026-02-05 15:44:27 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.17 sec.
2026-02-05 15:44:27 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.13 sec.
2026-02-05 15:44:27 00367_visible_width_of_array_tuple_enum: [ OK ] 0.17 sec.
2026-02-05 15:44:27 03001_max_parallel_replicas_zero_value: [ OK ] 0.17 sec.
2026-02-05 15:44:27 01104_distributed_numbers_test: [ OK ] 0.24 sec.
2026-02-05 15:44:27 02802_clickhouse_disks_s3_copy: [ OK ] 1.28 sec.
2026-02-05 15:44:27 02359_send_logs_source_regexp: [ OK ] 0.62 sec.
2026-02-05 15:44:28 01503_fixed_string_primary_key: [ OK ] 0.23 sec.
2026-02-05 15:44:28 02026_describe_include_subcolumns: [ OK ] 0.22 sec.
2026-02-05 15:44:28 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.27 sec.
2026-02-05 15:44:28 01265_datetime_string_comparison_felix_mueller: [ OK ] 0.34 sec.
2026-02-05 15:44:28 02565_analyzer_limit_settings: [ OK ] 0.33 sec.
2026-02-05 15:44:29 03144_alter_column_and_read: [ OK ] 0.23 sec.
2026-02-05 15:44:29 01869_function_modulo_legacy: [ OK ] 0.22 sec.
2026-02-05 15:44:30 00719_format_datetime_rand: [ OK ] 2.14 sec.
2026-02-05 15:44:30 02817_structure_to_schema: [ OK ] 10.59 sec.
2026-02-05 15:44:30 03044_analyzer_alias_join: [ OK ] 0.23 sec.
2026-02-05 15:44:31 02676_analyzer_limit_offset: [ OK ] 0.33 sec.
2026-02-05 15:44:31 02474_fix_function_parser_bug: [ OK ] 0.19 sec.
2026-02-05 15:44:31 02124_buffer_insert_select_race: [ OK ] 11.07 sec.
2026-02-05 15:44:31 02998_ipv6_hashing: [ OK ] 0.23 sec.
2026-02-05 15:44:31 01117_chain_finalize_bug: [ OK ] 0.28 sec.
2026-02-05 15:44:31 01823_explain_json: [ OK ] 2.10 sec.
2026-02-05 15:44:32 00974_distributed_join_on: [ OK ] 0.47 sec.
2026-02-05 15:44:32 02154_bit_slice_for_string: [ OK ] 0.69 sec.
2026-02-05 15:44:32 00704_drop_truncate_memory_table: [ OK ] 1.28 sec.
2026-02-05 15:44:32 03094_named_tuple_bug24607: [ OK ] 0.18 sec.
2026-02-05 15:44:32 02235_add_part_offset_virtual_column: [ OK ] 0.98 sec.
2026-02-05 15:44:32 02888_integer_type_inference_in_if_function: [ OK ] 0.27 sec.
2026-02-05 15:44:32 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 3.92 sec.
2026-02-05 15:44:32 00837_insert_select_and_read_prefix: [ OK ] 0.23 sec.
2026-02-05 15:44:32 03215_parquet_index: [ OK ] 0.22 sec.
2026-02-05 15:44:32 03198_dictionary_validate_primary_key_type: [ OK ] 0.27 sec.
2026-02-05 15:44:32 00432_aggregate_function_scalars_and_constants: [ OK ] 0.27 sec.
2026-02-05 15:44:33 03074_analyzer_alias_column_in_view: [ OK ] 0.17 sec.
2026-02-05 15:44:33 02451_variadic_null_garbage_data: [ OK ] 0.27 sec.
2026-02-05 15:44:33 01010_partial_merge_join_const_and_lc: [ OK ] 0.27 sec.
2026-02-05 15:44:33 00648_replacing_empty_set_from_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:44:33 01603_remove_column_ttl: [ OK ] 0.27 sec.
2026-02-05 15:44:33 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.57 sec.
2026-02-05 15:44:33 01710_projections_order_by_incomplete: [ OK ] 0.22 sec.
2026-02-05 15:44:33 00960_eval_ml_method_const: [ OK ] 0.17 sec.
2026-02-05 15:44:33 02834_alter_exception: [ OK ] 0.17 sec.
2026-02-05 15:44:33 02420_stracktrace_debug_symbols: [ OK ] 0.67 sec.
2026-02-05 15:44:33 02316_expressions_with_window_functions: [ OK ] 0.18 sec.
2026-02-05 15:44:34 03023_analyzer_optimize_group_by_function_keys_with_nulls: [ OK ] 0.23 sec.
2026-02-05 15:44:34 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.32 sec.
2026-02-05 15:44:34 01085_extract_all_empty: [ OK ] 0.22 sec.
2026-02-05 15:44:34 02896_union_distinct_http_format: [ OK ] 0.57 sec.
2026-02-05 15:44:34 01490_nullable_string_to_enum: [ OK ] 0.22 sec.
2026-02-05 15:44:34 01053_if_chain_check: [ OK ] 0.27 sec.
2026-02-05 15:44:34 00625_query_in_form_data: [ OK ] 0.52 sec.
2026-02-05 15:44:34 02456_aggregate_state_conversion: [ OK ] 0.17 sec.
2026-02-05 15:44:35 00753_with_with_single_alias: [ OK ] 0.17 sec.
2026-02-05 15:44:35 02234_column_function_short_circuit: [ OK ] 0.27 sec.
2026-02-05 15:44:35 01055_compact_parts_granularity: [ OK ] 1.67 sec.
2026-02-05 15:44:35 01950_aliases_bad_cast: [ OK ] 0.17 sec.
2026-02-05 15:44:35 00974_low_cardinality_cast: [ OK ] 0.22 sec.
2026-02-05 15:44:35 02833_starts_ends_with_utf8: [ OK ] 0.32 sec.
2026-02-05 15:44:35 00237_group_by_arrays: [ OK ] 0.22 sec.
2026-02-05 15:44:35 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.22 sec.
2026-02-05 15:44:37 00936_substring_utf8_non_const: [ OK ] 1.78 sec.
2026-02-05 15:44:38 02481_async_insert_race_long: [ OK ] 10.33 sec.
2026-02-05 15:44:38 01049_join_low_card_bug_long: [ OK ] 3.14 sec.
2026-02-05 15:44:38 02867_storage_set_tsan: [ OK ] 10.68 sec.
2026-02-05 15:44:38 02421_new_type_json_empty_parts: [ OK ] 11.03 sec.
2026-02-05 15:44:38 00754_distributed_optimize_skip_select_on_unused_shards_with_prewhere: [ OK ] 3.98 sec.
2026-02-05 15:44:38 03243_check_for_nullable_nothing_in_alter: [ OK ] 0.17 sec.
2026-02-05 15:44:38 02994_sanity_check_settings: [ OK ] 0.17 sec.
2026-02-05 15:44:38 00545_weird_aggregate_functions: [ OK ] 0.17 sec.
2026-02-05 15:44:38 03641_analyzer_issue_85834: [ OK ] 0.17 sec.
2026-02-05 15:44:38 01083_window_view_select: [ OK ] 1.43 sec.
2026-02-05 15:44:39 02020_exponential_smoothing_cross_block: [ OK ] 0.17 sec.
2026-02-05 15:44:39 02239_client_host_help: [ OK ] 0.52 sec.
2026-02-05 15:44:39 00900_parquet_time_to_ch_date_time: [ OK ] 0.92 sec.
2026-02-05 15:44:39 01214_point_in_Mecca: [ OK ] 0.77 sec.
2026-02-05 15:44:39 02680_datetime64_monotonic_check: [ OK ] 0.22 sec.
2026-02-05 15:44:39 02797_join_nested_lowcardinality_convert: [ OK ] 0.27 sec.
2026-02-05 15:44:39 02315_readonly_create_function: [ OK ] 0.57 sec.
2026-02-05 15:44:40 02560_tuple_format: [ OK ] 0.57 sec.
2026-02-05 15:44:40 01825_new_type_json_12: [ OK ] 1.57 sec.
2026-02-05 15:44:40 02206_clickhouse_local_use_database: [ OK ] 0.67 sec.
2026-02-05 15:44:40 01614_with_fill_with_limit: [ OK ] 0.22 sec.
2026-02-05 15:44:40 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.27 sec.
2026-02-05 15:44:40 02154_default_keyword_insert: [ OK ] 0.24 sec.
2026-02-05 15:44:40 00668_compare_arrays_silviucpp: [ OK ] 0.23 sec.
2026-02-05 15:44:40 02714_date_date32_in: [ OK ] 0.18 sec.
2026-02-05 15:44:40 03443_projection_sparse: [ OK ] 0.47 sec.
2026-02-05 15:44:41 02884_async_insert_native_protocol_4: [ OK ] 1.47 sec.
2026-02-05 15:44:41 00534_functions_bad_arguments10: [ OK ] 5.30 sec.
2026-02-05 15:44:41 01710_minmax_count_projection_count_nullable: [ OK ] 0.22 sec.
2026-02-05 15:44:41 00176_if_string_arrays: [ OK ] 0.17 sec.
2026-02-05 15:44:41 00375_shard_group_uniq_array_of_string: [ OK ] 2.08 sec.
2026-02-05 15:44:41 03203_variant_convert_field_to_type_bug: [ OK ] 0.19 sec.
2026-02-05 15:44:41 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.39 sec.
2026-02-05 15:44:41 00700_decimal_gathers: [ OK ] 0.22 sec.
2026-02-05 15:44:41 00587_union_all_type_conversions: [ OK ] 0.17 sec.
2026-02-05 15:44:41 00516_is_inf_nan: [ OK ] 0.18 sec.
2026-02-05 15:44:41 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.22 sec.
2026-02-05 15:44:41 02815_first_line: [ OK ] 0.27 sec.
2026-02-05 15:44:42 00576_nested_and_prewhere: [ OK ] 0.37 sec.
2026-02-05 15:44:42 02122_parallel_formatting_RowBinary: [ OK ] 1.48 sec.
2026-02-05 15:44:42 01151_storage_merge_filter_tables_by_virtual_column: [ OK ] 0.32 sec.
2026-02-05 15:44:42 02097_json_strings_deserialization: [ OK ] 1.48 sec.
2026-02-05 15:44:42 02459_materialized_view_default_value: [ OK ] 0.27 sec.
2026-02-05 15:44:42 02499_extract_key_value_pairs_multiple_input: [ OK ] 0.64 sec.
2026-02-05 15:44:43 02355_control_block_size_in_array_join: [ OK ] 0.28 sec.
2026-02-05 15:44:43 00175_partition_by_ignore: [ OK ] 0.18 sec.
2026-02-05 15:44:43 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.82 sec.
2026-02-05 15:44:43 01780_dict_get_or_null: [ OK ] 0.87 sec.
2026-02-05 15:44:43 02538_analyzer_create_table_as_select: [ OK ] 0.17 sec.
2026-02-05 15:44:43 00448_to_string_cut_to_zero: [ OK ] 0.17 sec.
2026-02-05 15:44:44 02788_current_schemas_function: [ OK ] 0.27 sec.
2026-02-05 15:44:44 01763_filter_push_down_bugs: [ OK ] 0.42 sec.
2026-02-05 15:44:44 02733_fix_distinct_in_order_bug_49622: [ OK ] 0.20 sec.
2026-02-05 15:44:44 00814_replicated_minimalistic_part_header_zookeeper: [ OK ] 2.78 sec.
2026-02-05 15:44:44 02456_summing_mt_lc: [ OK ] 0.27 sec.
2026-02-05 15:44:44 00098_f_union_all: [ OK ] 0.23 sec.
2026-02-05 15:44:45 00980_merge_alter_settings: [ OK ] 0.42 sec.
2026-02-05 15:44:45 02833_url_without_path_encoding: [ OK ] 0.77 sec.
2026-02-05 15:44:45 01701_if_tuple_segfault: [ OK ] 0.32 sec.
2026-02-05 15:44:45 02013_bloom_filter_hasAll: [ OK ] 0.34 sec.
2026-02-05 15:44:45 02386_analyzer_in_function_nested_subqueries: [ OK ] 0.17 sec.
2026-02-05 15:44:45 02592_avro_more_types: [ OK ] 0.88 sec.
2026-02-05 15:44:46 02560_agg_state_deserialization_hash_table_crash: [ OK ] 0.27 sec.
2026-02-05 15:44:46 00900_orc_arrow_parquet_maps: [ OK ] 2.88 sec.
2026-02-05 15:44:46 02519_monotonicity_fuzz: [ OK ] 0.27 sec.
2026-02-05 15:44:46 00167_settings_inside_query: [ OK ] 0.27 sec.
2026-02-05 15:44:47 01176_mysql_client_interactive: [ OK ] 1.73 sec.
2026-02-05 15:44:47 00619_union_highlite: [ OK ] 0.17 sec.
2026-02-05 15:44:47 03021_get_client_http_header: [ OK ] 0.92 sec.
2026-02-05 15:44:47 02896_multiple_OR: [ OK ] 0.22 sec.
2026-02-05 15:44:47 01621_sort_after_join_pipeline_stuck: [ OK ] 0.17 sec.
2026-02-05 15:44:47 00345_index_accurate_comparison: [ OK ] 0.27 sec.
2026-02-05 15:44:47 01326_hostname_alias: [ OK ] 0.17 sec.
2026-02-05 15:44:48 01960_lambda_precedence: [ OK ] 0.17 sec.
2026-02-05 15:44:48 03201_variant_null_map_subcolumn: [ OK ] 6.50 sec.
2026-02-05 15:44:48 01949_clickhouse_local_with_remote_localhost: [ OK ] 1.38 sec.
2026-02-05 15:44:48 01760_ddl_dictionary_use_current_database_name: [ OK ] 0.17 sec.
2026-02-05 15:44:48 02429_groupBitmap_chain_state: [ OK ] 0.27 sec.
2026-02-05 15:44:49 02006_client_test_hint_no_such_error_name: [ OK ] 0.62 sec.
2026-02-05 15:44:49 02577_analyzer_array_join_calc_twice: [ OK ] 0.17 sec.
2026-02-05 15:44:49 02911_add_index_and_materialize_index: [ OK ] 0.17 sec.
2026-02-05 15:44:49 00015_totals_having_constants: [ OK ] 0.17 sec.
2026-02-05 15:44:50 02403_big_http_chunk_size: [ OK ] 0.57 sec.
2026-02-05 15:44:50 00089_group_by_arrays_of_fixed: [ OK ] 0.17 sec.
2026-02-05 15:44:50 02963_single_value_destructor: [ OK ] 0.22 sec.
2026-02-05 15:44:50 00933_ttl_simple: [ OK ] 2.78 sec.
2026-02-05 15:44:51 02455_count_state_asterisk: [ OK ] 0.23 sec.
2026-02-05 15:44:51 01719_join_timezone: [ OK ] 0.22 sec.
2026-02-05 15:44:51 02286_parallel_final: [ OK ] 3.48 sec.
2026-02-05 15:44:51 01549_low_cardinality_mv_fuzz: [ OK ] 0.23 sec.
2026-02-05 15:44:51 01735_join_get_low_card_fix: [ OK ] 0.17 sec.
2026-02-05 15:44:51 00900_orc_arrow_parquet_nested: [ OK ] 3.49 sec.
2026-02-05 15:44:51 00549_join_use_nulls: [ OK ] 0.22 sec.
2026-02-05 15:44:51 00210_insert_select_extremes_http: [ OK ] 0.53 sec.
2026-02-05 15:44:52 02375_pretty_formats: [ OK ] 0.27 sec.
2026-02-05 15:44:52 00158_buffer_and_nonexistent_table: [ OK ] 0.27 sec.
2026-02-05 15:44:52 01491_nested_multiline_comments: [ OK ] 0.17 sec.
2026-02-05 15:44:52 02710_allow_suspicious_indices: [ OK ] 0.32 sec.
2026-02-05 15:44:52 02875_merge_engine_set_index: [ OK ] 1.27 sec.
2026-02-05 15:44:53 00752_low_cardinality_permute: [ OK ] 0.27 sec.
2026-02-05 15:44:53 01825_type_json_sparse: [ OK ] 0.32 sec.
2026-02-05 15:44:53 00695_pretty_max_column_pad_width: [ OK ] 0.17 sec.
2026-02-05 15:44:53 03680_loop_table_function_access_check: [ OK ] 1.28 sec.
2026-02-05 15:44:53 01034_JSONCompactEachRow: [ OK ] 0.48 sec.
2026-02-05 15:44:53 02148_cast_type_parsing: [ OK ] 0.17 sec.
2026-02-05 15:44:53 01391_join_on_dict_crash: [ OK ] 0.22 sec.
2026-02-05 15:44:54 03210_json_type_alter_add_column: [ OK ] 0.62 sec.
2026-02-05 15:44:54 00025_implicitly_used_subquery_column: [ OK ] 0.22 sec.
2026-02-05 15:44:54 02560_null_as_default: [ OK ] 0.22 sec.
2026-02-05 15:44:54 02118_deserialize_whole_text: [ OK ] 3.24 sec.
2026-02-05 15:44:54 01867_fix_storage_memory_mutation: [ OK ] 0.24 sec.
2026-02-05 15:44:54 00980_skip_unused_shards_without_sharding_key: [ OK ] 0.18 sec.
2026-02-05 15:44:54 00277_array_filter: [ OK ] 0.17 sec.
2026-02-05 15:44:54 02169_fix_view_offset_limit_setting: [ OK ] 0.22 sec.
2026-02-05 15:44:54 02864_restore_table_with_broken_part: [ OK ] 1.33 sec.
2026-02-05 15:44:54 00930_arrayIntersect: [ OK ] 0.32 sec.
2026-02-05 15:44:55 03214_inconsistent_formatting_of_codecs_statistics: [ OK ] 0.57 sec.
2026-02-05 15:44:55 01486_json_array_output: [ OK ] 0.17 sec.
2026-02-05 15:44:55 01732_union_and_union_all: [ OK ] 0.17 sec.
2026-02-05 15:44:55 02899_use_default_format_on_http_exception: [ OK ] 0.62 sec.
2026-02-05 15:44:55 01668_test_toMonth_mysql_dialect: [ OK ] 0.17 sec.
2026-02-05 15:44:56 01057_http_compression_prefer_brotli: [ OK ] 1.03 sec.
2026-02-05 15:44:56 01086_regexp_input_format_skip_unmatched: [ OK ] 1.13 sec.
2026-02-05 15:44:56 01715_background_checker_blather_zookeeper_long: [ OK ] 10.31 sec.
2026-02-05 15:44:56 02126_fix_filelog: [ OK ] 1.17 sec.
2026-02-05 15:44:56 03158_dynamic_type_from_variant: [ OK ] 0.22 sec.
2026-02-05 15:44:56 01277_alter_rename_column_constraint: [ OK ] 0.47 sec.
2026-02-05 15:44:56 00279_quantiles_permuted_args: [ OK ] 0.17 sec.
2026-02-05 15:44:57 02241_array_first_last_or_null: [ OK ] 0.28 sec.
2026-02-05 15:44:57 00870_t64_codec: [ OK ] 1.28 sec.
2026-02-05 15:44:57 01882_total_rows_approx: [ OK ] 1.63 sec.
2026-02-05 15:44:58 00686_client_exit_code: [ OK ] 0.58 sec.
2026-02-05 15:44:58 01508_format_regexp_raw: [ OK ] 0.87 sec.
2026-02-05 15:44:58 00940_order_by_read_in_order_query_plan: [ OK ] 1.23 sec.
2026-02-05 15:44:58 02893_trash_optimization: [ OK ] 0.22 sec.
2026-02-05 15:44:58 01925_map_populate_series_on_map: [ OK ] 0.38 sec.
2026-02-05 15:44:59 01536_fuzz_cast: [ OK ] 0.17 sec.
2026-02-05 15:44:59 00165_transform_non_const_default: [ OK ] 0.22 sec.
2026-02-05 15:44:59 01903_csvwithnames_subset_of_columns: [ OK ] 27.25 sec.
2026-02-05 15:45:00 00087_math_functions: [ OK ] 1.02 sec.
2026-02-05 15:45:00 02316_values_table_func_bug: [ OK ] 0.18 sec.
2026-02-05 15:45:00 01714_alter_drop_version: [ OK ] 0.22 sec.
2026-02-05 15:45:00 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.17 sec.
2026-02-05 15:45:01 02008_test_union_distinct_in_subquery: [ OK ] 0.32 sec.
2026-02-05 15:45:01 02255_broken_parts_chain_on_start: [ OK ] 3.08 sec.
2026-02-05 15:45:01 01213_alter_rename_column_zookeeper_long: [ OK ] 2.64 sec.
2026-02-05 15:45:01 02134_async_inserts_formats: [ OK ] 6.20 sec.
2026-02-05 15:45:01 00122_join_with_subquery_with_subquery: [ OK ] 0.24 sec.
2026-02-05 15:45:01 02833_std_alias: [ OK ] 0.22 sec.
2026-02-05 15:45:02 02812_subquery_operators: [ OK ] 0.32 sec.
2026-02-05 15:45:02 02752_is_null_priority: [ OK ] 0.23 sec.
2026-02-05 15:45:02 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.57 sec.
2026-02-05 15:45:02 02212_cte_and_table_alias: [ OK ] 0.22 sec.
2026-02-05 15:45:02 01777_map_populate_series_ubsan: [ OK ] 0.19 sec.
2026-02-05 15:45:02 02012_changed_enum_type_non_replicated: [ OK ] 0.22 sec.
2026-02-05 15:45:02 02162_array_first_last_index: [ OK ] 0.27 sec.
2026-02-05 15:45:02 01948_heredoc: [ OK ] 0.22 sec.
2026-02-05 15:45:02 02956_format_constexpr: [ OK ] 0.17 sec.
2026-02-05 15:45:02 02540_duplicate_primary_key: [ OK ] 0.17 sec.
2026-02-05 15:45:02 01186_conversion_to_nullable: [ OK ] 0.23 sec.
2026-02-05 15:45:03 00536_int_exp: [ OK ] 0.22 sec.
2026-02-05 15:45:03 00498_bitwise_aggregate_functions: [ OK ] 0.23 sec.
2026-02-05 15:45:03 02990_variant_where_cond: [ OK ] 0.28 sec.
2026-02-05 15:45:03 00849_multiple_comma_join_2: [ OK ] 0.57 sec.
2026-02-05 15:45:04 02560_count_digits: [ OK ] 0.27 sec.
2026-02-05 15:45:04 02956_rocksdb_bulk_sink: [ OK ] 7.65 sec.
2026-02-05 15:45:04 01358_lc_parquet: [ OK ] 3.24 sec.
2026-02-05 15:45:04 02565_update_empty_nested: [ OK ] 0.28 sec.
2026-02-05 15:45:04 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.27 sec.
2026-02-05 15:45:05 02151_invalid_setting_with_hints_in_query: [ OK ] 0.67 sec.
2026-02-05 15:45:05 01897_jit_aggregation_function_avg_weighted_long: [ OK ] 0.87 sec.
2026-02-05 15:45:05 01043_dictionary_attribute_properties_values: [ OK ] 0.22 sec.
2026-02-05 15:45:05 01041_h3_is_valid: [ OK ] 0.24 sec.
2026-02-05 15:45:05 03033_analyzer_merge_engine_filter_push_down: [ OK ] 0.28 sec.
2026-02-05 15:45:05 00980_crash_nullable_decimal: [ OK ] 0.22 sec.
2026-02-05 15:45:05 02516_projections_with_rollup: [ OK ] 2.43 sec.
2026-02-05 15:45:05 01606_merge_from_wide_to_compact: [ OK ] 0.43 sec.
2026-02-05 15:45:06 02751_query_log_test_partitions: [ OK ] 0.57 sec.
2026-02-05 15:45:06 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.58 sec.
2026-02-05 15:45:06 02416_json_object_inference: [ OK ] 0.17 sec.
2026-02-05 15:45:06 00462_json_true_false_literals: [ OK ] 0.22 sec.
2026-02-05 15:45:06 02047_alias_for_table_and_database_name: [ OK ] 0.22 sec.
2026-02-05 15:45:06 00636_partition_key_parts_pruning: [ OK ] 3.94 sec.
2026-02-05 15:45:07 03133_help_message_verbosity: [ OK ] 0.62 sec.
2026-02-05 15:45:07 00955_complex_prepared_statements: [ OK ] 1.88 sec.
2026-02-05 15:45:08 02884_parallel_window_functions_bug: [ OK ] 0.47 sec.
2026-02-05 15:45:08 02207_s3_content_type: [ OK ] 1.52 sec.
2026-02-05 15:45:08 00331_final_and_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:45:08 00503_cast_const_nullable: [ OK ] 0.22 sec.
2026-02-05 15:45:08 01881_join_on_conditions_hash: [ OK ] 1.02 sec.
2026-02-05 15:45:08 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.27 sec.
2026-02-05 15:45:08 02111_global_context_temporary_tables: [ OK ] 0.17 sec.
2026-02-05 15:45:08 02713_ip4_uint_compare: [ OK ] 0.17 sec.
2026-02-05 15:45:08 01422_map_skip_null: [ OK ] 0.22 sec.
2026-02-05 15:45:09 00411_merge_tree_where_const_in_set: [ OK ] 0.27 sec.
2026-02-05 15:45:09 00860_unknown_identifier_bug: [ OK ] 0.22 sec.
2026-02-05 15:45:09 02100_replaceRegexpAll_bug: [ OK ] 0.27 sec.
2026-02-05 15:45:09 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 1.07 sec.
2026-02-05 15:45:09 01622_multiple_ttls: [ OK ] 0.22 sec.
2026-02-05 15:45:10 02015_shard_crash_clang_12_build: [ OK ] 31.43 sec.
2026-02-05 15:45:10 03157_negative_positional_arguments_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:45:10 03015_parser_shortcut_lexer_errors: [ OK ] 0.52 sec.
2026-02-05 15:45:10 01436_storage_merge_with_join_push_down: [ OK ] 0.22 sec.
2026-02-05 15:45:10 01852_map_combinator: [ OK ] 0.37 sec.
2026-02-05 15:45:10 01825_type_json_order_by: [ OK ] 0.17 sec.
2026-02-05 15:45:10 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.22 sec.
2026-02-05 15:45:11 03303_alias_inverse_order: [ OK ] 0.17 sec.
2026-02-05 15:45:11 03038_nested_dynamic_merges_wide_vertical: [ OK ] 2.43 sec.
2026-02-05 15:45:11 03033_create_as_copies_comment: [ OK ] 0.17 sec.
2026-02-05 15:45:11 02504_regexp_dictionary_ua_parser: [ OK ] 1.72 sec.
2026-02-05 15:45:11 00725_ipv4_ipv6_domains: [ OK ] 0.27 sec.
2026-02-05 15:45:11 02841_group_array_sorted: [ OK ] 0.57 sec.
2026-02-05 15:45:11 02559_ip_types_bloom: [ OK ] 0.17 sec.
2026-02-05 15:45:11 01515_force_data_skipping_indices: [ OK ] 0.27 sec.
2026-02-05 15:45:11 02131_row_policies_combination: [ OK ] 0.27 sec.
2026-02-05 15:45:11 03041_recursive_cte_postgres_7: [ OK ] 0.27 sec.
2026-02-05 15:45:11 00701_join_default_strictness: [ OK ] 0.22 sec.
2026-02-05 15:45:12 01783_parallel_formatting_memory: [ OK ] 0.47 sec.
2026-02-05 15:45:12 00341_squashing_insert_select2: [ OK ] 0.27 sec.
2026-02-05 15:45:12 02539_generate_random_map: [ OK ] 0.17 sec.
2026-02-05 15:45:12 00447_foreach_modifier: [ OK ] 0.22 sec.
2026-02-05 15:45:12 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.22 sec.
2026-02-05 15:45:12 02100_multiple_hosts_command_line_set_ssl: [ OK ] 31.08 sec.
2026-02-05 15:45:12 01281_join_with_prewhere_fix: [ OK ] 0.22 sec.
2026-02-05 15:45:12 03217_filtering_in_storage_merge: [ OK ] 0.22 sec.
2026-02-05 15:45:12 00065_shard_float_literals_formatting: [ OK ] 0.17 sec.
2026-02-05 15:45:12 03165_string_functions_with_token_text_indexes: [ OK ] 0.47 sec.
2026-02-05 15:45:12 03195_group_concat_deserialization_fix: [ OK ] 0.22 sec.
2026-02-05 15:45:12 00950_default_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:45:13 02989_mysql_transaction_test: [ OK ] 0.47 sec.
2026-02-05 15:45:13 01544_fromModifiedJulianDay: [ OK ] 0.32 sec.
2026-02-05 15:45:13 02155_create_table_w_timezone: [ OK ] 0.17 sec.
2026-02-05 15:45:13 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.17 sec.
2026-02-05 15:45:13 00934_is_valid_utf8: [ OK ] 0.67 sec.
2026-02-05 15:45:14 02023_transform_or_to_in: [ OK ] 0.27 sec.
2026-02-05 15:45:14 01710_projection_materialize_with_missing_columns: [ OK ] 0.22 sec.
2026-02-05 15:45:14 02044_url_glob_parallel: [ OK ] 2.58 sec.
2026-02-05 15:45:14 01067_join_null: [ OK ] 0.17 sec.
2026-02-05 15:45:14 00206_empty_array_to_single: [ OK ] 0.22 sec.
2026-02-05 15:45:14 00068_empty_tiny_log: [ OK ] 0.17 sec.
2026-02-05 15:45:14 02125_fix_storage_filelog: [ OK ] 0.13 sec.
2026-02-05 15:45:14 01077_mutations_index_consistency: [ OK ] 1.87 sec.
2026-02-05 15:45:15 02130_parse_quoted_null: [ OK ] 2.48 sec.
2026-02-05 15:45:15 01414_mutations_and_errors: [ OK ] 0.27 sec.
2026-02-05 15:45:15 00688_low_cardinality_alter_add_column: [ OK ] 0.22 sec.
2026-02-05 15:45:15 02997_fix_datetime64_scale_conversion: [ OK ] 0.82 sec.
2026-02-05 15:45:16 02476_query_parameters_insert: [ OK ] 0.22 sec.
2026-02-05 15:45:17 02712_bool_better_exception_message: [ OK ] 1.12 sec.
2026-02-05 15:45:17 02428_parameterized_view: [ OK ] 12.06 sec.
2026-02-05 15:45:17 00570_empty_array_is_const: [ OK ] 0.17 sec.
2026-02-05 15:45:18 01602_temporary_table_in_system_tables: [ OK ] 0.17 sec.
2026-02-05 15:45:18 02935_http_content_type_with_http_headers_progress: [ OK ] 4.99 sec.
2026-02-05 15:45:18 02149_read_in_order_fixed_prefix: [ OK ] 0.47 sec.
2026-02-05 15:45:18 01630_simple_aggregate_all_functions_in_aggregating_merge_tree: [ OK ] 3.59 sec.
2026-02-05 15:45:18 02381_arrow_dict_to_lc: [ OK ] 0.52 sec.
2026-02-05 15:45:18 02115_map_contains_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:45:18 01710_projection_optimize_group_by_function_keys: [ OK ] 0.17 sec.
2026-02-05 15:45:18 01418_query_scope_constants_and_remote: [ OK ] 0.22 sec.
2026-02-05 15:45:19 02941_projections_external_aggregation: [ OK ] 0.47 sec.
2026-02-05 15:45:19 01631_date_overflow_as_partition_key: [ OK ] 0.17 sec.
2026-02-05 15:45:19 01430_modify_sample_by_zookeeper_long: [ OK ] 0.57 sec.
2026-02-05 15:45:19 01071_http_header_exception_code: [ OK ] 0.47 sec.
2026-02-05 15:45:19 00316_rounding_functions_and_empty_block: [ OK ] 0.17 sec.
2026-02-05 15:45:20 01892_jit_aggregation_function_any_last_long: [ OK ] 0.67 sec.
2026-02-05 15:45:20 02355_control_block_size_in_aggregator: [ OK ] 0.17 sec.
2026-02-05 15:45:20 03214_count_distinct_null_key_memory_leak: [ OK ] 1.72 sec.
2026-02-05 15:45:21 03088_analyzer_ambiguous_column_multi_call: [ OK ] 0.17 sec.
2026-02-05 15:45:21 00507_array_no_params: [ OK ] 0.77 sec.
2026-02-05 15:45:21 03154_recursive_cte_distributed: [ OK ] 0.32 sec.
2026-02-05 15:45:21 02525_range_hashed_dictionary_update_field: [ OK ] 6.24 sec.
2026-02-05 15:45:21 02267_special_operator_parse_alias_check: [ OK ] 0.32 sec.
2026-02-05 15:45:21 01410_nullable_key_and_index_negate_cond: [ OK ] 0.27 sec.
2026-02-05 15:45:21 00389_concat_operator: [ OK ] 0.12 sec.
2026-02-05 15:45:21 02870_move_partition_to_volume_io_throttling: [ OK ] 4.69 sec.
2026-02-05 15:45:21 02245_s3_virtual_columns: [ OK ] 0.22 sec.
2026-02-05 15:45:22 03168_inconsistent_ast_formatting: [ OK ] 0.12 sec.
2026-02-05 15:45:22 00079_defaulted_columns: [ OK ] 0.32 sec.
2026-02-05 15:45:22 01764_prefer_column_name_to_alias: [ OK ] 0.42 sec.
2026-02-05 15:45:22 00969_columns_clause: [ OK ] 0.27 sec.
2026-02-05 15:45:22 02725_alias_with_restricted_keywords: [ OK ] 0.12 sec.
2026-02-05 15:45:23 02021_exponential_sum: [ OK ] 1.57 sec.
2026-02-05 15:45:23 00502_custom_partitioning_local: [ OK ] 0.52 sec.
2026-02-05 15:45:23 00019_shard_quantiles_totals_distributed: [ OK ] 0.22 sec.
2026-02-05 15:45:23 00433_ifnull: [ OK ] 0.22 sec.
2026-02-05 15:45:23 03061_analyzer_alias_as_right_key_in_join: [ OK ] 0.17 sec.
2026-02-05 15:45:23 03031_low_cardinality_logical_error: [ OK ] 0.17 sec.
2026-02-05 15:45:23 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.77 sec.
2026-02-05 15:45:24 02124_insert_deduplication_token: [ OK ] 0.22 sec.
2026-02-05 15:45:24 01932_remote_sharding_key_column: [ OK ] 0.22 sec.
2026-02-05 15:45:24 02681_group_array_too_large_size: [ OK ] 0.12 sec.
2026-02-05 15:45:24 02125_low_cardinality_int256: [ OK ] 0.22 sec.
2026-02-05 15:45:24 03201_sumIf_to_countIf_return_type: [ OK ] 0.17 sec.
2026-02-05 15:45:24 00997_trim: [ OK ] 0.47 sec.
2026-02-05 15:45:24 02340_parts_refcnt_mergetree: [ OK ] 2.32 sec.
2026-02-05 15:45:25 00369_int_div_of_float: [ OK ] 0.17 sec.
2026-02-05 15:45:25 01052_compression_buffer_overrun: [ OK ] 0.47 sec.
2026-02-05 15:45:25 01555_or_fill: [ OK ] 0.27 sec.
2026-02-05 15:45:25 02402_merge_engine_with_view: [ OK ] 0.22 sec.
2026-02-05 15:45:25 02532_json_missing_named_tuple_elements: [ OK ] 1.37 sec.
2026-02-05 15:45:25 00320_between: [ OK ] 0.17 sec.
2026-02-05 15:45:26 02233_set_enable_with_statement_cte_perf: [ OK ] 0.67 sec.
2026-02-05 15:45:26 00804_rollup_with_having: [ OK ] 0.22 sec.
2026-02-05 15:45:26 01664_ntoa_aton_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:45:26 00966_invalid_json_must_not_parse: [ OK ] 0.17 sec.
2026-02-05 15:45:26 00482_subqueries_and_aliases: [ OK ] 0.17 sec.
2026-02-05 15:45:26 02982_unambiguous_alter_commands: [ OK ] 0.17 sec.
2026-02-05 15:45:26 01753_max_uri_size: [ OK ] 0.47 sec.
2026-02-05 15:45:26 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.42 sec.
2026-02-05 15:45:27 01471_with_format: [ OK ] 0.17 sec.
2026-02-05 15:45:27 02184_hash_functions_and_ip_types: [ OK ] 0.17 sec.
2026-02-05 15:45:27 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.17 sec.
2026-02-05 15:45:27 02014_storage_merge_order_by: [ OK ] 0.32 sec.
2026-02-05 15:45:27 01880_remote_ipv6: [ OK ] 0.27 sec.
2026-02-05 15:45:27 02044_exists_operator: [ OK ] 0.17 sec.
2026-02-05 15:45:28 01281_sum_nullable: [ OK ] 0.17 sec.
2026-02-05 15:45:28 00938_template_input_format: [ OK ] 2.73 sec.
2026-02-05 15:45:29 00727_concat: [ OK ] 0.42 sec.
2026-02-05 15:45:29 02124_insert_deduplication_token_materialized_views: [ OK ] 1.07 sec.
2026-02-05 15:45:30 02371_select_projection_normal_agg: [ OK ] 2.58 sec.
2026-02-05 15:45:30 02271_replace_partition_many_tables: [ OK ] 30.38 sec.
2026-02-05 15:45:30 00464_sort_all_constant_columns: [ OK ] 0.12 sec.
2026-02-05 15:45:30 02514_database_replicated_no_arguments_for_rmt: [ OK ] 1.52 sec.
2026-02-05 15:45:30 02887_mutations_subcolumns: [ OK ] 0.42 sec.
2026-02-05 15:45:30 01925_jit_aggregation_function_count_long: [ OK ] 0.22 sec.
2026-02-05 15:45:30 02703_row_policies_for_database_combination: [ OK ] 0.72 sec.
2026-02-05 15:45:31 00505_secure: [ OK ] 0.97 sec.
2026-02-05 15:45:32 02025_dictionary_array_nested_map: [ OK ] 0.17 sec.
2026-02-05 15:45:32 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 1.72 sec.
2026-02-05 15:45:33 02585_query_status_deadlock: [ OK ] 11.30 sec.
2026-02-05 15:45:33 02920_rename_column_of_skip_indices: [ OK ] 0.17 sec.
2026-02-05 15:45:33 01950_kill_large_group_by_query: [ OK ] 1.07 sec.
2026-02-05 15:45:33 01825_replacing_vertical_merge: [ OK ] 0.32 sec.
2026-02-05 15:45:34 02151_hash_table_sizes_stats_distributed: [ OK ] 18.79 sec.
2026-02-05 15:45:34 03031_distinguish_bool_and_int_in_settings: [ OK ] 0.27 sec.
2026-02-05 15:45:34 02151_http_s_structure_set_eof: [ OK ] 1.43 sec.
2026-02-05 15:45:35 01920_not_chain_format: [ OK ] 0.17 sec.
2026-02-05 15:45:35 00672_arrayDistinct: [ OK ] 0.17 sec.
2026-02-05 15:45:35 03273_dictionary_rbac: [ OK ] 1.27 sec.
2026-02-05 15:45:35 00453_top_k: [ OK ] 0.17 sec.
2026-02-05 15:45:35 02740_hashed_dictionary_load_factor_smoke: [ OK ] 0.47 sec.
2026-02-05 15:45:35 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.27 sec.
2026-02-05 15:45:35 02472_segfault_expression_parser: [ OK ] 0.12 sec.
2026-02-05 15:45:36 02915_lazy_loading_of_base_backups: [ OK ] 1.82 sec.
2026-02-05 15:45:36 02889_parts_columns_filenames: [ OK ] 0.22 sec.
2026-02-05 15:45:36 01755_shard_pruning_with_literal: [ OK ] 0.22 sec.
2026-02-05 15:45:36 00500_point_in_polygon_bug: [ OK ] 0.22 sec.
2026-02-05 15:45:36 00050_any_left_join: [ OK ] 0.17 sec.
2026-02-05 15:45:36 01349_mutation_datetime_key: [ OK ] 0.22 sec.
2026-02-05 15:45:37 00907_set_index_with_nullable_and_low_cardinality: [ OK ] 0.47 sec.
2026-02-05 15:45:37 02681_final_excessive_reading_bug: [ OK ] 1.27 sec.
2026-02-05 15:45:37 01570_aggregator_combinator_simple_state: [ OK ] 0.27 sec.
2026-02-05 15:45:37 03007_column_nullable_uninitialzed_value: [ OK ] 0.12 sec.
2026-02-05 15:45:37 03248_with_fill_string_crash: [ OK ] 0.22 sec.
2026-02-05 15:45:37 00263_merge_aggregates_and_overflow: [ OK ] 0.17 sec.
2026-02-05 15:45:38 03036_clamp: [ OK ] 0.22 sec.
2026-02-05 15:45:38 02536_delta_gorilla_corruption: [ OK ] 0.97 sec.
2026-02-05 15:45:38 01411_from_unixtime: [ OK ] 0.22 sec.
2026-02-05 15:45:38 02353_isnullable: [ OK ] 0.22 sec.
2026-02-05 15:45:38 01548_uncomparable_columns_in_keys: [ OK ] 0.17 sec.
2026-02-05 15:45:38 01592_length_map: [ OK ] 0.17 sec.
2026-02-05 15:45:38 02697_alter_dependencies: [ OK ] 0.32 sec.
2026-02-05 15:45:38 02966_float32_promotion: [ OK ] 0.17 sec.
2026-02-05 15:45:39 01356_wrong_filter-type_bug: [ OK ] 0.17 sec.
2026-02-05 15:45:39 01030_storage_url_syntax: [ OK ] 33.19 sec.
2026-02-05 15:45:39 01710_query_log_with_projection_info: [ OK ] 0.37 sec.
2026-02-05 15:45:39 02562_with_fill_nullable: [ OK ] 0.17 sec.
2026-02-05 15:45:39 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.17 sec.
2026-02-05 15:45:39 00653_monotonic_integer_cast: [ OK ] 0.22 sec.
2026-02-05 15:45:40 01509_dictionary_preallocate: [ OK ] 0.57 sec.
2026-02-05 15:45:40 02185_range_hashed_dictionary_open_ranges: [ OK ] 0.27 sec.
2026-02-05 15:45:40 02183_array_tuple_literals_remote: [ OK ] 0.32 sec.
2026-02-05 15:45:41 01249_flush_interactive: [ OK ] 10.40 sec.
2026-02-05 15:45:41 02680_lc_null_as_default: [ OK ] 0.17 sec.
2026-02-05 15:45:41 01782_field_oom: [ OK ] 1.37 sec.
2026-02-05 15:45:41 02456_alter-nullable-column-bag-2: [ OK ] 0.22 sec.
2026-02-05 15:45:41 01505_trivial_count_with_partition_predicate: [ OK ] 0.32 sec.
2026-02-05 15:45:41 02707_keeper_map_delete_update_strict: [ OK ] 0.27 sec.
2026-02-05 15:45:41 02251_last_day_of_month: [ OK ] 0.22 sec.
2026-02-05 15:45:41 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.22 sec.
2026-02-05 15:45:41 02458_relax_too_many_parts: [ OK ] 0.32 sec.
2026-02-05 15:45:41 01754_cluster_all_replicas_shard_num: [ OK ] 0.27 sec.
2026-02-05 15:45:42 00458_merge_type_cast: [ OK ] 0.52 sec.
2026-02-05 15:45:48 01825_type_json_ghdata_insert_select: [ OK ] 9.56 sec.
2026-02-05 15:45:50 02703_max_local_write_bandwidth: [ OK ] 8.26 sec.
2026-02-05 15:45:50 00534_functions_bad_arguments6: [ OK ] 7.92 sec.
2026-02-05 15:45:50 01852_s2_get_neighbours: [ OK ] 0.27 sec.
2026-02-05 15:45:50 00916_join_using_duplicate_columns: [ OK ] 0.27 sec.
2026-02-05 15:45:51 00800_low_cardinality_join: [ OK ] 0.43 sec.
2026-02-05 15:45:52 02513_parquet_orc_arrow_nullable_schema_inference: [ OK ] 2.18 sec.
2026-02-05 15:45:52 01131_max_rows_to_sort: [ OK ] 0.24 sec.
2026-02-05 15:45:52 01002_alter_nullable_adaptive_granularity_long: [ OK ] 10.91 sec.
2026-02-05 15:45:53 02941_variant_type_4: [ OK ] 16.57 sec.
2026-02-05 15:45:53 02383_analyzer_merge_tree_self_join: [ OK ] 0.42 sec.
2026-02-05 15:45:53 00813_parse_date_time_best_effort_more: [ OK ] 0.22 sec.
2026-02-05 15:45:53 02498_analyzer_settings_push_down: [ OK ] 0.38 sec.
2026-02-05 15:45:53 01085_regexp_input_format: [ OK ] 2.19 sec.
2026-02-05 15:45:53 02662_first_last_value: [ OK ] 0.27 sec.
2026-02-05 15:45:54 02699_polygons_sym_difference_total: [ OK ] 0.23 sec.
2026-02-05 15:45:54 00990_hasToken_and_tokenbf: [ OK ] 0.58 sec.
2026-02-05 15:45:54 00974_bitmapContains_with_primary_key: [ OK ] 0.32 sec.
2026-02-05 15:45:54 02129_skip_quoted_fields: [ OK ] 6.38 sec.
2026-02-05 15:45:54 00625_summing_merge_tree_merge: [ OK ] 1.18 sec.
2026-02-05 15:45:55 02769_compare_functions_nan: [ OK ] 0.43 sec.
2026-02-05 15:45:55 01109_inflating_cross_join: [ OK ] 0.27 sec.
2026-02-05 15:45:55 01798_uniq_theta_sketch: [ OK ] 0.93 sec.
2026-02-05 15:45:55 03215_view_with_recursive: [ OK ] 0.32 sec.
2026-02-05 15:45:55 00406_tuples_with_nulls: [ OK ] 0.18 sec.
2026-02-05 15:45:55 03215_analyzer_materialized_constants_bug: [ OK ] 0.28 sec.
2026-02-05 15:45:55 01096_array_reduce_in_ranges: [ OK ] 0.18 sec.
2026-02-05 15:45:55 01652_ttl_old_syntax: [ OK ] 0.19 sec.
2026-02-05 15:45:55 03069_analyzer_with_alias_in_array_join: [ OK ] 0.17 sec.
2026-02-05 15:45:55 02263_format_insert_settings: [ OK ] 2.74 sec.
2026-02-05 15:45:55 02864_filtered_url_with_globs: [ OK ] 0.22 sec.
2026-02-05 15:45:55 00256_reverse: [ OK ] 0.18 sec.
2026-02-05 15:45:55 02662_sparse_columns_mutations_1: [ OK ] 0.32 sec.
2026-02-05 15:45:55 01815_with_mergeable_state_after_aggregation_and_limit: [ OK ] 0.63 sec.
2026-02-05 15:45:55 01073_show_tables_not_like: [ OK ] 0.27 sec.
2026-02-05 15:45:56 01498_alter_column_storage_memory: [ OK ] 0.22 sec.
2026-02-05 15:45:56 00456_alter_nullable: [ OK ] 0.27 sec.
2026-02-05 15:45:56 02381_parseDateTime64BestEffortUS: [ OK ] 0.22 sec.
2026-02-05 15:45:56 03205_json_syntax: [ OK ] 0.37 sec.
2026-02-05 15:45:56 03096_update_non_indexed_columns: [ OK ] 0.33 sec.
2026-02-05 15:45:56 01396_negative_datetime_saturate_to_zero: [ OK ] 0.30 sec.
2026-02-05 15:45:57 01275_alter_rename_column_default_expr: [ OK ] 0.51 sec.
2026-02-05 15:45:57 02772_s3_crash: [ OK ] 0.29 sec.
2026-02-05 15:45:57 01034_move_partition_from_table_zookeeper: [ OK ] 38.23 sec.
2026-02-05 15:45:57 00938_test_retention_function: [ OK ] 0.28 sec.
2026-02-05 15:45:57 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.98 sec.
2026-02-05 15:45:57 00023_agg_select_agg_subquery: [ OK ] 0.24 sec.
2026-02-05 15:45:57 02865_tcp_proxy_query_packet_validation: [ OK ] 1.13 sec.
2026-02-05 15:45:58 02536_system_sync_file_cache: [ OK ] 0.53 sec.
2026-02-05 15:45:58 01720_country_intersection: [ OK ] 3.00 sec.
2026-02-05 15:45:59 00011_array_join_alias: [ OK ] 0.25 sec.
2026-02-05 15:45:59 02810_row_binary_with_defaults: [ OK ] 0.22 sec.
2026-02-05 15:45:59 01926_union_all_schmak: [ OK ] 0.22 sec.
2026-02-05 15:45:59 00419_show_sql_queries: [ OK ] 1.72 sec.
2026-02-05 15:45:59 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 3.96 sec.
2026-02-05 15:45:59 02049_clickhouse_local_merge_tree: [ OK ] 1.30 sec.
2026-02-05 15:46:00 01012_serialize_array_memory_usage: [ OK ] 0.33 sec.
2026-02-05 15:46:00 02043_query_obfuscator_embedded_dictionaries: [ OK ] 0.63 sec.
2026-02-05 15:46:00 00653_running_difference: [ OK ] 0.39 sec.
2026-02-05 15:46:01 02006_use_constants_in_with_and_select: [ OK ] 0.30 sec.
2026-02-05 15:46:01 00965_shard_unresolvable_addresses: [ OK ] 32.16 sec.
2026-02-05 15:46:01 00974_fix_join_on: [ OK ] 0.53 sec.
2026-02-05 15:46:01 00830_join_overwrite: [ OK ] 0.33 sec.
2026-02-05 15:46:02 00441_nulls_in: [ OK ] 0.36 sec.
2026-02-05 15:46:02 01305_array_join_prewhere_in_subquery: [ OK ] 0.22 sec.
2026-02-05 15:46:02 01630_simple_aggregate_all_functions_in_summing_merge_tree: [ OK ] 4.48 sec.
2026-02-05 15:46:02 02480_analyzer_alias_nullptr: [ OK ] 0.17 sec.
2026-02-05 15:46:02 02521_analyzer_array_join_crash: [ OK ] 0.28 sec.
2026-02-05 15:46:02 03164_early_constant_folding_analyzer: [ OK ] 0.27 sec.
2026-02-05 15:46:03 03290_final_replacing: [ OK ] 0.27 sec.
2026-02-05 15:46:03 01142_join_lc_and_nullable_in_key: [ OK ] 0.47 sec.
2026-02-05 15:46:03 02128_apply_lambda_parsing: [ OK ] 0.23 sec.
2026-02-05 15:46:03 02286_function_wyhash: [ OK ] 0.22 sec.
2026-02-05 15:46:03 02841_not_ready_set_bug: [ OK ] 2.05 sec.
2026-02-05 15:46:03 02912_group_array_sample: [ OK ] 0.22 sec.
2026-02-05 15:46:04 00170_lower_upper_utf8: [ OK ] 0.58 sec.
2026-02-05 15:46:05 02931_rewrite_sum_column_and_constant: [ OK ] 1.18 sec.
2026-02-05 15:46:05 02722_log_profile_events: [ OK ] 0.23 sec.
2026-02-05 15:46:05 00990_hasToken: [ OK ] 1.63 sec.
2026-02-05 15:46:05 01710_projection_row_policy: [ OK ] 0.27 sec.
2026-02-05 15:46:05 00874_issue_3495: [ OK ] 0.23 sec.
2026-02-05 15:46:06 00357_to_string_complex_types: [ OK ] 0.22 sec.
2026-02-05 15:46:06 02997_insert_select_too_many_parts_multithread: [ SKIPPED ] 0.00 sec.
2026-02-05 15:46:06 Reason: disabled
2026-02-05 15:46:06 01156_pcg_deserialization: [ OK ] 6.45 sec.
2026-02-05 15:46:06 02515_aggregate_functions_statistics: [ OK ] 0.32 sec.
2026-02-05 15:46:06 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.37 sec.
2026-02-05 15:46:06 01825_new_type_json_missed_values: [ OK ] 0.82 sec.
2026-02-05 15:46:06 02932_non_ready_set_stuck: [ OK ] 0.17 sec.
2026-02-05 15:46:06 01277_buffer_column_order: [ OK ] 0.32 sec.
2026-02-05 15:46:06 01655_window_functions_bug: [ OK ] 0.22 sec.
2026-02-05 15:46:07 03033_with_fill_interpolate: [ OK ] 0.22 sec.
2026-02-05 15:46:07 01665_substring_ubsan: [ OK ] 0.23 sec.
2026-02-05 15:46:07 01070_h3_get_base_cell: [ OK ] 0.27 sec.
2026-02-05 15:46:07 01709_inactive_parts_to_throw_insert: [ OK ] 0.34 sec.
2026-02-05 15:46:07 02560_analyzer_materialized_view: [ OK ] 0.50 sec.
2026-02-05 15:46:08 03053_analyzer_join_alias: [ OK ] 0.36 sec.
2026-02-05 15:46:08 01120_join_constants: [ OK ] 0.35 sec.
2026-02-05 15:46:08 01485_256_bit_multiply: [ OK ] 0.89 sec.
2026-02-05 15:46:08 02354_numeric_literals_with_underscores: [ OK ] 0.22 sec.
2026-02-05 15:46:08 02403_ttl_column_multiple_times: [ OK ] 0.28 sec.
2026-02-05 15:46:08 03003_functions_to_subcolumns_final: [ OK ] 0.27 sec.
2026-02-05 15:46:08 00700_decimal_math: [ OK ] 0.38 sec.
2026-02-05 15:46:08 01475_mutation_with_if: [ OK ] 0.43 sec.
2026-02-05 15:46:09 02812_bug_with_unused_join_columns: [ OK ] 0.24 sec.
2026-02-05 15:46:09 01477_lc_in_merge_join_left_key: [ OK ] 0.73 sec.
2026-02-05 15:46:09 02771_parallel_replicas_analyzer: [ OK ] 0.53 sec.
2026-02-05 15:46:09 03003_count_asterisk_filter: [ OK ] 0.23 sec.
2026-02-05 15:46:09 02005_log_formatted_queries: [ OK ] 0.34 sec.
2026-02-05 15:46:10 02923_cte_equality_disjunction: [ OK ] 0.23 sec.
2026-02-05 15:46:10 00144_empty_regexp: [ OK ] 0.17 sec.
2026-02-05 15:46:11 02004_intersect_except_distinct_operators: [ OK ] 0.87 sec.
2026-02-05 15:46:11 00098_3_union_all: [ OK ] 0.27 sec.
2026-02-05 15:46:11 01891_partition_by_uuid: [ OK ] 0.22 sec.
2026-02-05 15:46:12 02563_progress_when_no_rows_from_prewhere: [ OK ] 0.47 sec.
2026-02-05 15:46:12 01732_alters_bad_conversions: [ OK ] 0.34 sec.
2026-02-05 15:46:13 00572_aggregation_by_empty_set: [ OK ] 0.28 sec.
2026-02-05 15:46:13 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.22 sec.
2026-02-05 15:46:13 01055_compact_parts_1: [ OK ] 0.31 sec.
2026-02-05 15:46:13 02538_nullable_array_tuple_timeseries: [ OK ] 0.17 sec.
2026-02-05 15:46:13 02703_jit_external_aggregation: [ OK ] 13.99 sec.
2026-02-05 15:46:14 01505_distributed_local_type_conversion_enum: [ OK ] 0.32 sec.
2026-02-05 15:46:14 02706_kolmogorov_smirnov_test_scipy: [ OK ] 5.10 sec.
2026-02-05 15:46:14 02916_replication_protocol_wait_for_part: [ OK ] 10.50 sec.
2026-02-05 15:46:14 02517_union_columns_order: [ OK ] 0.22 sec.
2026-02-05 15:46:14 01660_join_or_inner: [ OK ] 0.37 sec.
2026-02-05 15:46:14 00272_union_all_and_in_subquery: [ OK ] 0.22 sec.
2026-02-05 15:46:14 01070_template_empty_file: [ OK ] 0.17 sec.
2026-02-05 15:46:15 02943_variant_type_with_different_local_and_global_order: [ OK ] 15.31 sec.
2026-02-05 15:46:15 01244_optimize_distributed_group_by_sharding_key: [ OK ] 0.98 sec.
2026-02-05 15:46:16 02731_zero_objects_in_metadata: [ OK ] 1.59 sec.
2026-02-05 15:46:16 00980_full_join_crash_fancyqlx: [ OK ] 0.22 sec.
2026-02-05 15:46:16 02457_bz2_concatenated: [ OK ] 0.84 sec.
2026-02-05 15:46:16 02541_lightweight_delete_on_cluster: [ OK ] 0.32 sec.
2026-02-05 15:46:17 02149_schema_inference_formats_with_schema_2: [ OK ] 19.51 sec.
2026-02-05 15:46:17 02293_http_header_full_summary_without_progress: [ OK ] 1.47 sec.
2026-02-05 15:46:17 02354_distributed_with_external_aggregation_memory_usage: [ OK ] 45.22 sec.
2026-02-05 15:46:17 01922_array_join_with_index: [ OK ] 0.17 sec.
2026-02-05 15:46:17 00069_date_arithmetic: [ OK ] 0.27 sec.
2026-02-05 15:46:17 00312_position_case_insensitive_utf8: [ OK ] 2.74 sec.
2026-02-05 15:46:17 01658_test_base64Encode_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:46:17 02803_backup_tmp_files: [ OK ] 1.02 sec.
2026-02-05 15:46:17 01896_jit_aggregation_function_if_long: [ OK ] 1.38 sec.
2026-02-05 15:46:17 01866_split_by_regexp: [ OK ] 0.22 sec.
2026-02-05 15:46:18 02190_current_metrics_query: [ OK ] 0.17 sec.
2026-02-05 15:46:18 02423_multidimensional_array_get_data_at: [ OK ] 0.17 sec.
2026-02-05 15:46:18 01700_point_in_polygon_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:46:18 00190_non_constant_array_of_constant_data: [ OK ] 0.47 sec.
2026-02-05 15:46:18 02481_prewhere_filtered_rows_div_by_zero: [ OK ] 0.27 sec.
2026-02-05 15:46:19 00990_request_splitting: [ OK ] 0.17 sec.
2026-02-05 15:46:19 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.73 sec.
2026-02-05 15:46:19 02679_explain_merge_tree_prewhere_row_policy: [ OK ] 0.22 sec.
2026-02-05 15:46:19 01201_read_single_thread_in_order: [ OK ] 1.88 sec.
2026-02-05 15:46:19 02131_used_row_policies_in_query_log: [ OK ] 0.58 sec.
2026-02-05 15:46:19 02375_rocksdb_with_filters: [ OK ] 2.38 sec.
2026-02-05 15:46:20 03031_tuple_elimination_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:46:20 00651_default_database_on_client_reconnect: [ OK ] 0.64 sec.
2026-02-05 15:46:20 03033_parts_splitter_bug_and_index_loading: [ OK ] 0.27 sec.
2026-02-05 15:46:20 01087_table_function_generate: [ OK ] 0.32 sec.
2026-02-05 15:46:20 01933_client_replxx_convert_history: [ OK ] 0.67 sec.
2026-02-05 15:46:20 01770_extended_range_3: [ OK ] 0.22 sec.
2026-02-05 15:46:20 02891_alter_update_adaptive_granularity: [ OK ] 0.22 sec.
2026-02-05 15:46:20 02661_read_from_archive_tzst: [ OK ] 6.77 sec.
2026-02-05 15:46:20 02920_capnp_protobuf_auto_schema_nested: [ OK ] 1.03 sec.
2026-02-05 15:46:20 00626_in_syntax: [ OK ] 0.27 sec.
2026-02-05 15:46:20 03109_ast_too_big: [ OK ] 0.22 sec.
2026-02-05 15:46:21 03093_reading_bug_with_parallel_replicas: [ OK ] 0.37 sec.
2026-02-05 15:46:21 01532_having_with_totals: [ OK ] 0.32 sec.
2026-02-05 15:46:21 03246_range_literal_replacement_works: [ OK ] 0.22 sec.
2026-02-05 15:46:21 00856_no_column_issue_4242: [ OK ] 0.22 sec.
2026-02-05 15:46:21 00963_startsWith_force_primary_key: [ OK ] 0.22 sec.
2026-02-05 15:46:21 02028_system_data_skipping_indices_size: [ OK ] 0.22 sec.
2026-02-05 15:46:21 02188_parser_dictionary_primary_key: [ OK ] 0.32 sec.
2026-02-05 15:46:21 02889_print_pretty_type_names: [ OK ] 0.22 sec.
2026-02-05 15:46:21 02965_projection_with_partition_pruning: [ OK ] 0.22 sec.
2026-02-05 15:46:21 01081_keywords_formatting: [ OK ] 0.17 sec.
2026-02-05 15:46:21 00825_protobuf_format_array_3dim: [ OK ] 1.28 sec.
2026-02-05 15:46:22 00014_select_from_table_with_nested: [ OK ] 0.27 sec.
2026-02-05 15:46:22 02521_aggregation_by_partitions: [ OK ] 5.24 sec.
2026-02-05 15:46:22 02818_memory_profiler_sample_min_max_allocation_size: [ OK ] 1.03 sec.
2026-02-05 15:46:23 02552_siphash128_reference: [ OK ] 1.07 sec.
2026-02-05 15:46:23 01895_jit_aggregation_function_avg_long: [ OK ] 0.92 sec.
2026-02-05 15:46:23 00161_rounding_functions: [ OK ] 0.32 sec.
2026-02-05 15:46:23 00335_bom: [ OK ] 0.58 sec.
2026-02-05 15:46:24 02817_group_array_moving_zero_window_size: [ OK ] 0.17 sec.
2026-02-05 15:46:24 00196_float32_formatting: [ OK ] 0.17 sec.
2026-02-05 15:46:24 02785_left_anti_join_bug: [ OK ] 0.22 sec.
2026-02-05 15:46:24 02012_compress_lz4: [ OK ] 0.72 sec.
2026-02-05 15:46:24 00073_merge_sorting_empty_array_joined: [ OK ] 0.18 sec.
2026-02-05 15:46:24 00098_h_union_all: [ OK ] 0.17 sec.
2026-02-05 15:46:24 03151_pmj_join_non_procssed_clash: [ OK ] 0.22 sec.
2026-02-05 15:46:24 03214_parsing_archive_name_file: [ OK ] 2.38 sec.
2026-02-05 15:46:25 01101_literal_column_clash: [ OK ] 0.22 sec.
2026-02-05 15:46:25 01509_parallel_quorum_and_merge_long: [ OK ] 3.43 sec.
2026-02-05 15:46:25 01070_h3_indexes_are_neighbors: [ OK ] 0.22 sec.
2026-02-05 15:46:25 02716_int256_arrayfunc: [ OK ] 0.27 sec.
2026-02-05 15:46:25 01074_h3_range_check: [ OK ] 0.29 sec.
2026-02-05 15:46:25 01410_nullable_key_and_index: [ OK ] 0.49 sec.
2026-02-05 15:46:25 02462_number_to_datetype: [ OK ] 0.22 sec.
2026-02-05 15:46:25 01318_alter_add_constraint_format: [ OK ] 0.47 sec.
2026-02-05 15:46:25 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.47 sec.
2026-02-05 15:46:25 03058_analyzer_ambiguous_columns: [ OK ] 0.22 sec.
2026-02-05 15:46:26 01269_create_with_null: [ OK ] 0.28 sec.
2026-02-05 15:46:26 00938_ipv6_cidr_range: [ OK ] 0.32 sec.
2026-02-05 15:46:26 02581_width_bucket: [ OK ] 0.42 sec.
2026-02-05 15:46:26 01580_column_const_comparision: [ OK ] 0.17 sec.
2026-02-05 15:46:26 01656_join_defaul_enum: [ OK ] 0.32 sec.
2026-02-05 15:46:26 02932_materialized_view_with_dropped_target_table_no_exception: [ OK ] 0.27 sec.
2026-02-05 15:46:26 03198_orc_read_time_zone: [ OK ] 1.07 sec.
2026-02-05 15:46:26 01781_token_extractor_buffer_overflow: [ OK ] 0.37 sec.
2026-02-05 15:46:26 01783_merge_engine_join_key_condition: [ OK ] 0.27 sec.
2026-02-05 15:46:26 02676_distinct_reading_in_order_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:46:27 00292_parser_tuple_element: [ OK ] 0.17 sec.
2026-02-05 15:46:27 02900_window_function_with_sparse_column: [ OK ] 0.27 sec.
2026-02-05 15:46:27 00567_parse_datetime_as_unix_timestamp: [ OK ] 0.22 sec.
2026-02-05 15:46:27 00043_summing_empty_part: [ OK ] 0.17 sec.
2026-02-05 15:46:28 01825_type_json_13: [ OK ] 1.42 sec.
2026-02-05 15:46:28 02250_hints_for_projections: [ OK ] 0.87 sec.
2026-02-05 15:46:28 02531_storage_join_null_44940: [ OK ] 0.27 sec.
2026-02-05 15:46:28 02160_special_functions: [ OK ] 0.27 sec.
2026-02-05 15:46:29 01006_ttl_with_default_2: [ OK ] 1.63 sec.
2026-02-05 15:46:29 01455_time_zones: [ OK ] 0.17 sec.
2026-02-05 15:46:29 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.17 sec.
2026-02-05 15:46:29 00975_sample_prewhere_distributed: [ OK ] 0.23 sec.
2026-02-05 15:46:29 00487_if_array_fixed_string: [ OK ] 0.17 sec.
2026-02-05 15:46:29 03211_nested_json_merges_small: [ OK ] 1.32 sec.
2026-02-05 15:46:29 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.22 sec.
2026-02-05 15:46:29 01912_bad_cast_join_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:46:29 02705_projection_and_ast_optimizations_bug: [ OK ] 0.23 sec.
2026-02-05 15:46:29 00120_join_and_group_by: [ OK ] 0.17 sec.
2026-02-05 15:46:30 00845_join_on_aliases: [ OK ] 0.32 sec.
2026-02-05 15:46:30 00411_long_accurate_number_comparison_int4: [ OK ] 3.99 sec.
2026-02-05 15:46:30 01706_optimize_normalize_count_variants: [ OK ] 0.23 sec.
2026-02-05 15:46:30 02050_clickhouse_client_local_exception: [ OK ] 0.57 sec.
2026-02-05 15:46:30 02962_parallel_window_functions_different_partitioning: [ OK ] 0.18 sec.
2026-02-05 15:46:30 01074_partial_revokes: [ OK ] 0.37 sec.
2026-02-05 15:46:31 01081_demangle: [ OK ] 0.17 sec.
2026-02-05 15:46:31 02784_connection_string: [ OK ] 9.96 sec.
2026-02-05 15:46:31 03018_external_with_complex_data_types: [ OK ] 0.64 sec.
2026-02-05 15:46:31 01083_cross_to_inner_with_in_bug: [ OK ] 0.22 sec.
2026-02-05 15:46:31 00461_default_value_of_argument_type: [ OK ] 0.18 sec.
2026-02-05 15:46:31 00408_http_keep_alive: [ OK ] 0.57 sec.
2026-02-05 15:46:31 03199_json_extract_dynamic: [ OK ] 0.37 sec.
2026-02-05 15:46:31 01254_array_of_unnamed_tuples: [ OK ] 0.22 sec.
2026-02-05 15:46:32 01019_materialized_view_select_extra_columns: [ OK ] 0.27 sec.
2026-02-05 15:46:32 01771_datetime64_no_time_part: [ OK ] 0.32 sec.
2026-02-05 15:46:32 02365_multisearch_random_tests: [ OK ] 2.54 sec.
2026-02-05 15:46:33 00937_template_output_format: [ OK ] 0.97 sec.
2026-02-05 15:46:33 03037_dynamic_merges_1_vertical_wide_merge_tree: [ OK ] 2.93 sec.
2026-02-05 15:46:33 03205_column_type_check: [ OK ] 0.18 sec.
2026-02-05 15:46:33 00719_parallel_ddl_table: [ OK ] 11.76 sec.
2026-02-05 15:46:33 01103_optimize_drop_race_zookeeper: [ OK ] 15.58 sec.
2026-02-05 15:46:33 02352_lightweight_delete: [ OK ] 1.28 sec.
2026-02-05 15:46:33 03196_max_intersections_arena_crash: [ OK ] 0.17 sec.
2026-02-05 15:46:33 03217_datetime64_constant_to_ast: [ OK ] 0.17 sec.
2026-02-05 15:46:33 01739_index_hint: [ OK ] 0.27 sec.
2026-02-05 15:46:33 00919_histogram_merge: [ OK ] 0.17 sec.
2026-02-05 15:46:33 02347_rank_corr_nan: [ OK ] 0.17 sec.
2026-02-05 15:46:33 02246_flatten_tuple: [ OK ] 0.22 sec.
2026-02-05 15:46:33 01047_nullable_rand: [ OK ] 0.22 sec.
2026-02-05 15:46:33 02905_system_logs_hostname: [ OK ] 0.32 sec.
2026-02-05 15:46:33 01478_not_equi-join_on: [ OK ] 0.17 sec.
2026-02-05 15:46:34 00582_not_aliasing_functions: [ OK ] 0.17 sec.
2026-02-05 15:46:34 01473_event_time_microseconds: [ OK ] 2.28 sec.
2026-02-05 15:46:34 02813_any_value: [ OK ] 0.17 sec.
2026-02-05 15:46:34 01411_xor_itai_shirav: [ OK ] 0.17 sec.
2026-02-05 15:46:34 01681_bloom_filter_nullable_column: [ OK ] 0.32 sec.
2026-02-05 15:46:34 01021_only_tuple_columns: [ OK ] 0.32 sec.
2026-02-05 15:46:34 00266_shard_global_subquery_and_aliases: [ OK ] 0.17 sec.
2026-02-05 15:46:34 02906_flatten_only_true_nested: [ OK ] 0.17 sec.
2026-02-05 15:46:34 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.27 sec.
2026-02-05 15:46:34 02029_orc_low_cardinality: [ OK ] 0.87 sec.
2026-02-05 15:46:35 01669_test_toYear_mysql_dialect: [ OK ] 0.12 sec.
2026-02-05 15:46:35 02908_alter_column_alias: [ OK ] 0.12 sec.
2026-02-05 15:46:35 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 0.77 sec.
2026-02-05 15:46:35 03231_pr_duplicate_announcement_2: [ OK ] 0.27 sec.
2026-02-05 15:46:35 01409_topK_merge: [ OK ] 0.17 sec.
2026-02-05 15:46:35 03210_fix_single_value_data_assertion: [ OK ] 0.32 sec.
2026-02-05 15:46:35 02831_regexp_analyze_recursion: [ OK ] 0.22 sec.
2026-02-05 15:46:35 00646_url_engine: [ OK ] 1.17 sec.
2026-02-05 15:46:35 01825_new_type_json_add_column: [ OK ] 0.32 sec.
2026-02-05 15:46:35 02674_and_consistency: [ OK ] 0.17 sec.
2026-02-05 15:46:35 01030_concatenate_equal_fixed_strings: [ OK ] 0.17 sec.
2026-02-05 15:46:35 02814_order_by_tuple_window_function: [ OK ] 0.12 sec.
2026-02-05 15:46:36 00763_create_query_as_table_engine_bug: [ OK ] 0.22 sec.
2026-02-05 15:46:36 01428_nullable_asof_join: [ OK ] 0.27 sec.
2026-02-05 15:46:36 02212_h3_get_pentagon_indexes: [ OK ] 0.22 sec.
2026-02-05 15:46:36 02584_compressor_codecs: [ OK ] 0.87 sec.
2026-02-05 15:46:36 00518_extract_all_and_empty_matches: [ OK ] 0.12 sec.
2026-02-05 15:46:36 00599_create_view_with_subquery: [ OK ] 0.17 sec.
2026-02-05 15:46:36 01424_parse_date_time_bad_date: [ OK ] 0.17 sec.
2026-02-05 15:46:36 02249_insert_select_from_input_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:46:36 01602_insert_into_table_function_cluster: [ OK ] 0.27 sec.
2026-02-05 15:46:36 00933_alter_ttl: [ OK ] 0.32 sec.
2026-02-05 15:46:36 02908_table_ttl_dependency: [ OK ] 0.77 sec.
2026-02-05 15:46:36 02394_every_profile_event_must_have_documentation: [ OK ] 0.12 sec.
2026-02-05 15:46:37 02503_join_switch_alias_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:46:37 01034_sample_final_distributed: [ OK ] 0.67 sec.
2026-02-05 15:46:37 01866_aggregate_function_interval_length_sum: [ OK ] 0.27 sec.
2026-02-05 15:46:37 01038_array_of_unnamed_tuples: [ OK ] 0.17 sec.
2026-02-05 15:46:37 00534_functions_bad_arguments13: [ OK ] 5.23 sec.
2026-02-05 15:46:37 02098_date32_comparison: [ OK ] 0.22 sec.
2026-02-05 15:46:37 01009_global_array_join_names: [ OK ] 0.17 sec.
2026-02-05 15:46:37 02128_cast_nullable: [ OK ] 0.17 sec.
2026-02-05 15:46:37 01773_case_sensitive_version: [ OK ] 0.17 sec.
2026-02-05 15:46:37 01441_array_combinator: [ OK ] 0.17 sec.
2026-02-05 15:46:38 03033_hive_text_read_variable_fields: [ OK ] 0.97 sec.
2026-02-05 15:46:38 01391_limit_overflow: [ OK ] 0.17 sec.
2026-02-05 15:46:38 00974_full_outer_join: [ OK ] 0.17 sec.
2026-02-05 15:46:38 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.22 sec.
2026-02-05 15:46:38 02179_map_cast_to_array: [ OK ] 0.22 sec.
2026-02-05 15:46:38 02306_window_move_row_number_fix: [ OK ] 0.17 sec.
2026-02-05 15:46:38 01010_pm_join_all_join_bug: [ OK ] 0.17 sec.
2026-02-05 15:46:38 01021_create_as_select: [ OK ] 0.17 sec.
2026-02-05 15:46:38 00421_storage_merge__table_index: [ OK ] 5.48 sec.
2026-02-05 15:46:38 01592_window_functions: [ OK ] 0.27 sec.
2026-02-05 15:46:39 00327_summing_composite_nested: [ OK ] 0.32 sec.
2026-02-05 15:46:39 02184_ipv6_cast_test: [ OK ] 0.22 sec.
2026-02-05 15:46:39 01925_merge_prewhere_table: [ OK ] 0.22 sec.
2026-02-05 15:46:39 00962_visit_param_various: [ OK ] 0.27 sec.
2026-02-05 15:46:39 03129_cte_with_final: [ OK ] 0.22 sec.
2026-02-05 15:46:39 01410_full_join_and_null_predicates: [ OK ] 0.32 sec.
2026-02-05 15:46:39 01710_projection_additional_filters: [ OK ] 0.32 sec.
2026-02-05 15:46:40 01906_lc_in_bug: [ OK ] 0.37 sec.
2026-02-05 15:46:40 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 1.47 sec.
2026-02-05 15:46:40 01442_merge_detach_attach_long: [ OK ] 31.10 sec.
2026-02-05 15:46:41 02177_issue_31009_pt2: [ OK ] 3.73 sec.
2026-02-05 15:46:41 01520_client_print_query_id: [ OK ] 0.62 sec.
2026-02-05 15:46:41 01661_extract_all_groups_throw_fast: [ OK ] 1.58 sec.
2026-02-05 15:46:41 01710_projection_group_by_order_by: [ OK ] 0.12 sec.
2026-02-05 15:46:41 03040_dynamic_type_alters_1_memory: [ OK ] 0.32 sec.
2026-02-05 15:46:41 02382_join_and_filtering_set: [ OK ] 0.22 sec.
2026-02-05 15:46:41 03210_variant_with_aggregate_function_type: [ OK ] 0.22 sec.
2026-02-05 15:46:41 01144_multiword_data_types: [ OK ] 0.17 sec.
2026-02-05 15:46:41 00399_group_uniq_array_date_datetime: [ OK ] 0.22 sec.
2026-02-05 15:46:41 01825_type_json_11: [ OK ] 1.32 sec.
2026-02-05 15:46:42 02375_stack_trace_no_addresses: [ OK ] 0.82 sec.
2026-02-05 15:46:42 01576_alias_column_rewrite: [ OK ] 0.42 sec.
2026-02-05 15:46:42 00816_join_column_names_sarg: [ OK ] 0.22 sec.
2026-02-05 15:46:42 02693_multiple_joins_in: [ OK ] 0.17 sec.
2026-02-05 15:46:42 02146_mv_non_phys: [ OK ] 0.17 sec.
2026-02-05 15:46:42 01737_move_order_key_to_prewhere_select_final: [ OK ] 0.27 sec.
2026-02-05 15:46:42 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.22 sec.
2026-02-05 15:46:43 01825_type_json_in_other_types: [ OK ] 1.72 sec.
2026-02-05 15:46:43 02443_detach_attach_partition: [ OK ] 6.79 sec.
2026-02-05 15:46:43 01091_query_profiler_does_not_hang: [ OK ] 0.33 sec.
2026-02-05 15:46:43 02943_order_by_all: [ OK ] 0.44 sec.
2026-02-05 15:46:43 03126_column_not_under_group_by: [ OK ] 0.12 sec.
2026-02-05 15:46:43 02518_parquet_arrow_orc_boolean_value: [ OK ] 0.87 sec.
2026-02-05 15:46:43 01833_test_collation_alvarotuso: [ OK ] 0.17 sec.
2026-02-05 15:46:43 02512_array_join_name_resolution: [ OK ] 0.17 sec.
2026-02-05 15:46:44 00753_distributed_system_columns_and_system_tables: [ OK ] 0.22 sec.
2026-02-05 15:46:44 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.22 sec.
2026-02-05 15:46:44 02384_analyzer_dict_get_join_get: [ OK ] 0.27 sec.
2026-02-05 15:46:44 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.22 sec.
2026-02-05 15:46:44 01323_redundant_functions_in_order_by: [ OK ] 0.32 sec.
2026-02-05 15:46:44 02327_try_infer_integers_schema_inference: [ OK ] 0.27 sec.
2026-02-05 15:46:44 02158_proportions_ztest_cmp: [ OK ] 1.87 sec.
2026-02-05 15:46:44 02668_column_block_number: [ OK ] 0.22 sec.
2026-02-05 15:46:44 02029_test_options_requests: [ OK ] 0.42 sec.
2026-02-05 15:46:44 02986_leftpad_fixedstring: [ OK ] 0.17 sec.
2026-02-05 15:46:44 03151_redundant_distinct_with_window: [ OK ] 0.22 sec.
2026-02-05 15:46:44 02125_lz4_compression_bug_CSV: [ OK ] 2.98 sec.
2026-02-05 15:46:44 01621_bar_nan_arguments: [ OK ] 0.17 sec.
2026-02-05 15:46:45 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.27 sec.
2026-02-05 15:46:45 02179_degrees_radians: [ OK ] 0.22 sec.
2026-02-05 15:46:45 02411_legacy_geobase: [ OK ] 0.27 sec.
2026-02-05 15:46:45 02997_projections_formatting: [ OK ] 0.17 sec.
2026-02-05 15:46:45 01352_generate_random_overflow: [ OK ] 0.17 sec.
2026-02-05 15:46:45 02250_lots_of_columns_in_csv_with_names: [ OK ] 0.97 sec.
2026-02-05 15:46:45 02907_http_exception_json_bug: [ OK ] 0.47 sec.
2026-02-05 15:46:45 02771_log_faminy_truncate_count: [ OK ] 0.22 sec.
2026-02-05 15:46:45 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.62 sec.
2026-02-05 15:46:45 02996_analyzer_prewhere_projection: [ OK ] 0.17 sec.
2026-02-05 15:46:45 01533_distinct_nullable_uuid: [ OK ] 0.22 sec.
2026-02-05 15:46:46 02896_cyclic_aliases_crash: [ OK ] 0.22 sec.
2026-02-05 15:46:46 01008_materialized_view_henyihanwobushi: [ OK ] 0.27 sec.
2026-02-05 15:46:46 03003_analyzer_setting: [ OK ] 0.12 sec.
2026-02-05 15:46:46 00973_uniq_non_associativity: [ OK ] 0.62 sec.
2026-02-05 15:46:46 03013_position_const_start_pos: [ OK ] 0.17 sec.
2026-02-05 15:46:46 00483_reading_from_array_structure: [ OK ] 0.22 sec.
2026-02-05 15:46:46 01400_join_get_with_multi_keys: [ OK ] 0.17 sec.
2026-02-05 15:46:46 02100_alter_scalar_circular_deadlock: [ OK ] 0.22 sec.
2026-02-05 15:46:46 01514_input_format_csv_enum_as_number_setting: [ OK ] 0.18 sec.
2026-02-05 15:46:46 01851_clear_column_referenced_by_mv: [ OK ] 0.22 sec.
2026-02-05 15:46:47 02193_async_insert_tcp_client_1: [ OK ] 0.42 sec.
2026-02-05 15:46:47 00752_low_cardinality_lambda_argument: [ OK ] 0.22 sec.
2026-02-05 15:46:48 02760_dictionaries_memory: [ OK ] 8.04 sec.
2026-02-05 15:46:48 01866_datetime64_cmp_with_constant: [ OK ] 0.27 sec.
2026-02-05 15:46:48 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.32 sec.
2026-02-05 15:46:49 02972_to_string_nullable_timezone: [ OK ] 0.17 sec.
2026-02-05 15:46:49 01407_lambda_arrayJoin: [ OK ] 0.17 sec.
2026-02-05 15:46:49 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.17 sec.
2026-02-05 15:46:49 01375_storage_file_write_prefix_tsv_with_names: [ OK ] 0.17 sec.
2026-02-05 15:46:50 02982_comments_in_system_tables: [ OK ] 0.72 sec.
2026-02-05 15:46:50 02231_buffer_aggregate_states_leak: [ OK ] 4.88 sec.
2026-02-05 15:46:51 02771_ignore_data_skipping_indices: [ OK ] 0.27 sec.
2026-02-05 15:46:52 02500_remove_redundant_distinct_analyzer: [ OK ] 5.29 sec.
2026-02-05 15:46:52 01655_plan_optimizations_optimize_read_in_window_order_long: [ OK ] 6.39 sec.
2026-02-05 15:46:53 00751_hashing_ints: [ OK ] 0.17 sec.
2026-02-05 15:46:53 01683_codec_encrypted: [ OK ] 0.17 sec.
2026-02-05 15:46:53 02723_zookeeper_name: [ OK ] 0.27 sec.
2026-02-05 15:46:53 00516_modulo: [ OK ] 0.17 sec.
2026-02-05 15:46:53 03143_prewhere_profile_events: [ OK ] 3.03 sec.
2026-02-05 15:46:53 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.22 sec.
2026-02-05 15:46:53 02995_preliminary_filters_duplicated_columns: [ OK ] 0.17 sec.
2026-02-05 15:46:53 01601_custom_tld: [ OK ] 0.32 sec.
2026-02-05 15:46:54 02493_analyzer_table_functions_untuple: [ OK ] 0.23 sec.
2026-02-05 15:46:54 01354_order_by_tuple_collate_const: [ OK ] 0.17 sec.
2026-02-05 15:46:54 03003_codec_multiple_buffer_overflow: [ OK ] 0.47 sec.
2026-02-05 15:46:54 03048_not_found_column_xxx_in_block: [ OK ] 0.22 sec.
2026-02-05 15:46:54 00600_create_temporary_table_if_not_exists: [ OK ] 0.12 sec.
2026-02-05 15:46:55 02013_emptystring_cast: [ OK ] 0.72 sec.
2026-02-05 15:46:56 01812_basic_auth_http_server: [ OK ] 3.38 sec.
2026-02-05 15:46:56 01086_odbc_roundtrip: [ OK ] 11.70 sec.
2026-02-05 15:46:56 03015_peder1001: [ OK ] 0.23 sec.
2026-02-05 15:46:56 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.22 sec.
2026-02-05 15:46:56 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.22 sec.
2026-02-05 15:46:57 02016_agg_empty_result_bug_28880: [ OK ] 0.17 sec.
2026-02-05 15:46:57 02572_query_views_log_background_thread: [ OK ] 10.55 sec.
2026-02-05 15:46:57 02021_create_database_with_comment: [ OK ] 1.62 sec.
2026-02-05 15:46:57 02526_merge_join_int_decimal: [ OK ] 0.27 sec.
2026-02-05 15:46:57 01700_system_zookeeper_path_in: [ OK ] 0.27 sec.
2026-02-05 15:46:57 01565_query_loop_after_client_error: [ OK ] 0.57 sec.
2026-02-05 15:46:57 00702_join_with_using: [ OK ] 0.22 sec.
2026-02-05 15:46:57 03155_analyzer_interpolate: [ OK ] 0.17 sec.
2026-02-05 15:46:57 01939_network_receive_bytes_metrics: [ OK ] 0.97 sec.
2026-02-05 15:46:57 02809_has_token: [ OK ] 0.13 sec.
2026-02-05 15:46:58 03038_ambiguous_column: [ OK ] 0.22 sec.
2026-02-05 15:46:58 02231_hierarchical_dictionaries_constant: [ OK ] 0.32 sec.
2026-02-05 15:46:59 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 1.42 sec.
2026-02-05 15:46:59 02877_optimize_read_in_order_from_view: [ OK ] 1.42 sec.
2026-02-05 15:46:59 03129_low_cardinality_nullable_non_first_primary_key: [ OK ] 0.17 sec.
2026-02-05 15:47:00 02591_protobuf_nested_arrays: [ OK ] 0.52 sec.
2026-02-05 15:47:00 01710_projection_array_join: [ OK ] 0.17 sec.
2026-02-05 15:47:00 02023_storage_filelog: [ OK ] 2.98 sec.
2026-02-05 15:47:00 00825_protobuf_format_persons: [ OK ] 3.73 sec.
2026-02-05 15:47:01 02366_decimal_agg_state_conversion: [ OK ] 0.22 sec.
2026-02-05 15:47:01 00527_totals_having_nullable: [ OK ] 0.17 sec.
2026-02-05 15:47:01 00551_parse_or_null: [ OK ] 0.17 sec.
2026-02-05 15:47:01 01853_s2_cells_intersect: [ OK ] 0.17 sec.
2026-02-05 15:47:01 00386_has_column_in_table: [ OK ] 0.32 sec.
2026-02-05 15:47:01 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:47:01 02703_max_local_read_bandwidth: [ OK ] 24.37 sec.
2026-02-05 15:47:01 00515_enhanced_time_zones: [ OK ] 0.57 sec.
2026-02-05 15:47:02 03033_virtual_column_override: [ OK ] 0.22 sec.
2026-02-05 15:47:02 00714_create_temporary_table_with_in_clause: [ OK ] 0.22 sec.
2026-02-05 15:47:02 02477_age: [ OK ] 0.32 sec.
2026-02-05 15:47:02 00017_in_subquery_with_empty_result: [ OK ] 0.17 sec.
2026-02-05 15:47:02 03044_array_join_columns_in_nested_table: [ OK ] 0.22 sec.
2026-02-05 15:47:02 02994_libarchive_compression: [ OK ] 2.88 sec.
2026-02-05 15:47:03 01825_type_json_1: [ OK ] 0.37 sec.
2026-02-05 15:47:03 00104_totals_having_mode: [ OK ] 0.27 sec.
2026-02-05 15:47:03 02353_explain_ast_optimize: [ OK ] 0.17 sec.
2026-02-05 15:47:03 02380_analyzer_join_sample: [ OK ] 0.22 sec.
2026-02-05 15:47:03 00546_shard_tuple_element_formatting: [ OK ] 0.17 sec.
2026-02-05 15:47:04 01293_optimize_final_force: [ OK ] 30.38 sec.
2026-02-05 15:47:04 02884_parallel_window_functions: [ OK ] 0.92 sec.
2026-02-05 15:47:04 02834_client_yaml_configs: [ OK ] 0.67 sec.
2026-02-05 15:47:05 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.27 sec.
2026-02-05 15:47:05 01425_default_value_of_type_name: [ OK ] 0.17 sec.
2026-02-05 15:47:05 02353_simdjson_buffer_overflow: [ OK ] 3.18 sec.
2026-02-05 15:47:05 02875_json_array_as_string: [ OK ] 0.17 sec.
2026-02-05 15:47:05 03001_block_offset_column_2: [ OK ] 0.22 sec.
2026-02-05 15:47:05 01070_h3_to_children: [ OK ] 0.22 sec.
2026-02-05 15:47:05 01942_create_table_with_sample: [ OK ] 0.17 sec.
2026-02-05 15:47:05 02122_parallel_formatting_TSKV: [ OK ] 1.52 sec.
2026-02-05 15:47:06 01014_function_repeat_corner_cases: [ OK ] 0.22 sec.
2026-02-05 15:47:06 03132_sqlancer_union_all: [ OK ] 0.23 sec.
2026-02-05 15:47:06 02477_fuse_quantiles: [ OK ] 0.22 sec.
2026-02-05 15:47:06 03290_final_collapsing: [ OK ] 0.27 sec.
2026-02-05 15:47:06 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.22 sec.
2026-02-05 15:47:06 02670_constant_skip_index: [ OK ] 0.22 sec.
2026-02-05 15:47:06 01039_test_setting_parse: [ OK ] 0.17 sec.
2026-02-05 15:47:06 03010_file_log_large_poll_batch_size: [ OK ] 0.17 sec.
2026-02-05 15:47:06 00255_array_concat_string: [ OK ] 0.22 sec.
2026-02-05 15:47:06 02366_kql_func_ip: [ OK ] 0.77 sec.
2026-02-05 15:47:07 01308_polygon_area: [ OK ] 0.22 sec.
2026-02-05 15:47:07 00664_cast_from_string_to_nullable: [ OK ] 0.17 sec.
2026-02-05 15:47:07 02943_variant_read_subcolumns: [ OK ] 5.18 sec.
2026-02-05 15:47:07 01085_simdjson_uint64: [ OK ] 0.17 sec.
2026-02-05 15:47:07 02042_map_get_non_const_key: [ OK ] 0.17 sec.
2026-02-05 15:47:07 01084_regexp_empty: [ OK ] 0.22 sec.
2026-02-05 15:47:08 00825_protobuf_format_skipped_column_in_nested: [ OK ] 1.18 sec.
2026-02-05 15:47:08 01059_storage_file_compression: [ OK ] 8.45 sec.
2026-02-05 15:47:09 02995_index_2: [ OK ] 6.04 sec.
2026-02-05 15:47:09 01825_new_type_json_multiple_files: [ OK ] 2.12 sec.
2026-02-05 15:47:09 02116_interactive_hello: [ OK ] 0.57 sec.
2026-02-05 15:47:09 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.12 sec.
2026-02-05 15:47:09 02389_dashboard: [ OK ] 0.42 sec.
2026-02-05 15:47:10 02354_vector_search_bugs: [ OK ] 0.42 sec.
2026-02-05 15:47:10 01888_bloom_filter_hasAny: [ OK ] 0.27 sec.
2026-02-05 15:47:10 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.37 sec.
2026-02-05 15:47:10 02812_from_to_utc_timestamp: [ OK ] 1.22 sec.
2026-02-05 15:47:10 03130_analyzer_self_join_group_by: [ OK ] 0.22 sec.
2026-02-05 15:47:10 02970_generate_series: [ OK ] 0.17 sec.
2026-02-05 15:47:10 02536_replace_with_nonconst_needle_and_replacement: [ OK ] 0.52 sec.
2026-02-05 15:47:10 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.17 sec.
2026-02-05 15:47:10 03099_analyzer_multi_join: [ OK ] 0.17 sec.
2026-02-05 15:47:10 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.22 sec.
2026-02-05 15:47:10 02793_implicit_pretty_format_settings: [ OK ] 0.62 sec.
2026-02-05 15:47:11 01412_optimize_deduplicate_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:11 01852_multiple_joins_with_union_join: [ OK ] 0.22 sec.
2026-02-05 15:47:11 02906_force_optimize_projection_name: [ OK ] 0.32 sec.
2026-02-05 15:47:11 02165_h3_exact_edge_length_rads: [ OK ] 0.22 sec.
2026-02-05 15:47:11 02228_merge_tree_insert_memory_usage: [ OK ] 0.77 sec.
2026-02-05 15:47:11 01854_s2_cap_union: [ OK ] 0.22 sec.
2026-02-05 15:47:12 01936_three_parts_identifiers_in_wrong_places: [ OK ] 0.22 sec.
2026-02-05 15:47:12 01433_hex_float: [ OK ] 0.17 sec.
2026-02-05 15:47:12 01677_bit_float: [ OK ] 0.22 sec.
2026-02-05 15:47:12 02761_ddl_initial_query_id: [ OK ] 1.42 sec.
2026-02-05 15:47:12 02480_client_option_print_num_processed_rows: [ OK ] 1.22 sec.
2026-02-05 15:47:12 02815_range_dict_no_direct_join: [ OK ] 0.17 sec.
2026-02-05 15:47:13 03230_json_alias_new_old_types: [ OK ] 0.17 sec.
2026-02-05 15:47:13 03149_variant_pop_back_typo: [ OK ] 0.17 sec.
2026-02-05 15:47:13 02021_h3_is_pentagon: [ OK ] 0.17 sec.
2026-02-05 15:47:14 01528_clickhouse_local_prepare_parts: [ OK ] 2.23 sec.
2026-02-05 15:47:15 02486_truncate_and_unexpected_parts: [ OK ] 1.48 sec.
2026-02-05 15:47:15 00940_order_by_read_in_order: [ OK ] 0.42 sec.
2026-02-05 15:47:15 02293_part_log_has_merge_reason: [ OK ] 2.43 sec.
2026-02-05 15:47:15 02458_key_condition_not_like_prefix: [ OK ] 0.22 sec.
2026-02-05 15:47:15 03208_uniq_with_empty_tuple: [ OK ] 0.17 sec.
2026-02-05 15:47:15 02805_distributed_queries_timeouts: [ OK ] 24.30 sec.
2026-02-05 15:47:15 01376_array_fill_empty: [ OK ] 0.17 sec.
2026-02-05 15:47:15 03107_ill_formed_select_in_materialized_view: [ OK ] 0.17 sec.
2026-02-05 15:47:15 01903_correct_block_size_prediction_with_default: [ OK ] 8.79 sec.
2026-02-05 15:47:16 01502_bar_overflow: [ OK ] 0.27 sec.
2026-02-05 15:47:16 02916_dictionary_access: [ OK ] 0.87 sec.
2026-02-05 15:47:16 02477_invalid_reads: [ OK ] 0.57 sec.
2026-02-05 15:47:16 02567_and_consistency: [ OK ] 0.27 sec.
2026-02-05 15:47:16 02100_now64_types_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:16 01621_summap_check_types: [ OK ] 0.17 sec.
2026-02-05 15:47:16 02050_client_profile_events: [ OK ] 6.49 sec.
2026-02-05 15:47:16 01372_wrong_order_by_removal: [ OK ] 0.17 sec.
2026-02-05 15:47:16 01526_max_untracked_memory: [ OK ] 1.37 sec.
2026-02-05 15:47:16 02962_indexHint_rpn_construction: [ OK ] 0.22 sec.
2026-02-05 15:47:16 00765_locate: [ OK ] 0.27 sec.
2026-02-05 15:47:16 02030_capnp_format: [ OK ] 10.00 sec.
2026-02-05 15:47:16 02795_full_join_assert_cast: [ OK ] 0.17 sec.
2026-02-05 15:47:16 00022_func_higher_order_and_constants: [ OK ] 0.17 sec.
2026-02-05 15:47:17 01246_extractAllGroupsVertical: [ OK ] 0.27 sec.
2026-02-05 15:47:17 00521_multidimensional: [ OK ] 0.32 sec.
2026-02-05 15:47:17 02399_merge_tree_mutate_in_partition: [ OK ] 0.22 sec.
2026-02-05 15:47:17 00921_datetime64_basic: [ OK ] 0.42 sec.
2026-02-05 15:47:17 02915_analyzer_fuzz_5: [ OK ] 0.27 sec.
2026-02-05 15:47:17 02457_datediff_via_unix_epoch: [ OK ] 0.17 sec.
2026-02-05 15:47:17 02122_parallel_formatting_JSON: [ OK ] 1.77 sec.
2026-02-05 15:47:17 02192_comment: [ OK ] 0.17 sec.
2026-02-05 15:47:17 03033_cte_numbers_memory: [ OK ] 0.17 sec.
2026-02-05 15:47:17 01040_distributed_background_insert_batch_inserts: [ OK ] 0.32 sec.
2026-02-05 15:47:17 03167_boom_filter_index_with_map: [ OK ] 0.67 sec.
2026-02-05 15:47:17 02480_suspicious_lowcard_in_key: [ OK ] 0.22 sec.
2026-02-05 15:47:17 01408_range_overflow: [ OK ] 0.22 sec.
2026-02-05 15:47:18 01269_alias_type_differs: [ OK ] 0.17 sec.
2026-02-05 15:47:18 01213_alter_table_rename_nested: [ OK ] 0.27 sec.
2026-02-05 15:47:18 00098_6_union_all: [ OK ] 0.17 sec.
2026-02-05 15:47:18 02711_trim_aliases: [ OK ] 0.12 sec.
2026-02-05 15:47:18 03009_range_dict_get_or_default: [ OK ] 0.22 sec.
2026-02-05 15:47:18 00252_shard_global_in_aggregate_function: [ OK ] 0.17 sec.
2026-02-05 15:47:18 01079_reinterpret_as_fixed_string: [ OK ] 0.17 sec.
2026-02-05 15:47:18 01720_constraints_complex_types: [ OK ] 0.22 sec.
2026-02-05 15:47:18 01202_array_auc_special: [ OK ] 0.27 sec.
2026-02-05 15:47:18 03152_dynamic_type_simple: [ OK ] 0.27 sec.
2026-02-05 15:47:18 03118_analyzer_multi_join_prewhere: [ OK ] 0.17 sec.
2026-02-05 15:47:18 02815_empty_subquery_nullable_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:19 02154_dictionary_get_http_json: [ OK ] 1.22 sec.
2026-02-05 15:47:19 02097_remove_sample_by: [ OK ] 0.27 sec.
2026-02-05 15:47:19 02345_implicit_transaction: [ OK ] 0.57 sec.
2026-02-05 15:47:19 02922_respect_nulls_Nullable: [ OK ] 0.22 sec.
2026-02-05 15:47:19 02737_arrayJaccardIndex: [ OK ] 0.32 sec.
2026-02-05 15:47:19 01702_toDateTime_from_string_clamping: [ OK ] 0.22 sec.
2026-02-05 15:47:19 00959_format_with_different_aliases: [ OK ] 0.52 sec.
2026-02-05 15:47:19 00451_left_array_join_and_constants: [ OK ] 0.17 sec.
2026-02-05 15:47:19 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.17 sec.
2026-02-05 15:47:19 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.17 sec.
2026-02-05 15:47:20 00270_views_query_processing_stage: [ OK ] 0.22 sec.
2026-02-05 15:47:20 02534_parquet_fixed_binary_array: [ OK ] 1.69 sec.
2026-02-05 15:47:20 01076_json_each_row_array: [ OK ] 0.82 sec.
2026-02-05 15:47:20 02999_scalar_subqueries_bug_1: [ OK ] 0.17 sec.
2026-02-05 15:47:21 02784_parallel_replicas_automatic_decision: [ OK ] 3.88 sec.
2026-02-05 15:47:21 03036_dynamic_read_subcolumns_wide_merge_tree: [ OK ] 1.92 sec.
2026-02-05 15:47:21 02517_avro_bool_type: [ OK ] 0.57 sec.
2026-02-05 15:47:21 00436_fixed_string_16_comparisons: [ OK ] 0.22 sec.
2026-02-05 15:47:21 02811_primary_key_in_columns: [ OK ] 0.37 sec.
2026-02-05 15:47:21 01357_result_rows: [ OK ] 0.32 sec.
2026-02-05 15:47:21 02763_jit_compare_functions_nan: [ OK ] 0.22 sec.
2026-02-05 15:47:22 03033_analyzer_parametrized_view_alias: [ OK ] 0.17 sec.
2026-02-05 15:47:22 01812_has_generic: [ OK ] 0.17 sec.
2026-02-05 15:47:22 01872_initial_query_start_time: [ OK ] 1.17 sec.
2026-02-05 15:47:22 02891_array_shingles: [ OK ] 0.32 sec.
2026-02-05 15:47:22 02985_if_over_big_int_decimal: [ OK ] 0.17 sec.
2026-02-05 15:47:22 00395_nullable: [ OK ] 2.43 sec.
2026-02-05 15:47:23 01550_create_map_type: [ OK ] 0.67 sec.
2026-02-05 15:47:23 01126_month_partitioning_consistent_code: [ OK ] 0.17 sec.
2026-02-05 15:47:23 02242_case_insensitive_nested: [ OK ] 1.77 sec.
2026-02-05 15:47:24 02140_clickhouse_local_queries_file_table: [ OK ] 0.57 sec.
2026-02-05 15:47:24 01497_extract_all_groups_empty_match: [ OK ] 0.17 sec.
2026-02-05 15:47:24 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.48 sec.
2026-02-05 15:47:24 00225_join_duplicate_columns: [ OK ] 0.17 sec.
2026-02-05 15:47:24 02122_parallel_formatting_PrettySpace: [ OK ] 2.23 sec.
2026-02-05 15:47:24 03197_fix_parse_mysql_iso_date: [ OK ] 0.22 sec.
2026-02-05 15:47:24 01698_fix_toMinute: [ OK ] 0.22 sec.
2026-02-05 15:47:24 03206_json_parsing_and_formatting: [ OK ] 2.38 sec.
2026-02-05 15:47:25 01268_procfs_metrics: [ OK ] 0.67 sec.
2026-02-05 15:47:25 01940_point_in_polygon_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:47:26 02983_empty_map_hasToken: [ OK ] 0.27 sec.
2026-02-05 15:47:26 02558_system_processes_elapsed: [ OK ] 2.48 sec.
2026-02-05 15:47:26 02096_totals_global_in_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:27 01825_type_json_ghdata: [ OK ] 2.88 sec.
2026-02-05 15:47:27 01419_merge_tree_settings_sanity_check: [ OK ] 0.22 sec.
2026-02-05 15:47:27 03155_datasketches_ubsan: [ OK ] 0.12 sec.
2026-02-05 15:47:27 02751_text_formats_bad_nullable_parsing: [ OK ] 1.47 sec.
2026-02-05 15:47:27 00444_join_use_nulls: [ OK ] 0.23 sec.
2026-02-05 15:47:27 02270_errors_in_files_s3: [ OK ] 0.82 sec.
2026-02-05 15:47:27 01821_to_date_time_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:47:27 02845_prewhere_preserve_column: [ OK ] 0.17 sec.
2026-02-05 15:47:27 00004_shard_format_ast_and_remote_table: [ OK ] 0.17 sec.
2026-02-05 15:47:28 02046_remote_table_function_named_collections: [ OK ] 0.22 sec.
2026-02-05 15:47:28 02994_inconsistent_formatting: [ OK ] 0.17 sec.
2026-02-05 15:47:28 02207_subseconds_intervals: [ OK ] 0.37 sec.
2026-02-05 15:47:28 01765_tehran_dst: [ OK ] 0.22 sec.
2026-02-05 15:47:28 02767_into_outfile_extensions_msan: [ OK ] 0.52 sec.
2026-02-05 15:47:28 02465_limit_trivial_max_rows_to_read: [ OK ] 0.27 sec.
2026-02-05 15:47:28 00578_merge_table_sampling: [ OK ] 0.22 sec.
2026-02-05 15:47:29 00485_http_insert_format: [ OK ] 0.97 sec.
2026-02-05 15:47:29 00094_union_race_conditions_5: [ OK ] 4.38 sec.
2026-02-05 15:47:29 01846_null_as_default_for_insert_select: [ OK ] 0.27 sec.
2026-02-05 15:47:29 02475_analyzer_subquery_compound_expression: [ OK ] 0.17 sec.
2026-02-05 15:47:29 03166_optimize_row_order_during_insert: [ OK ] 0.22 sec.
2026-02-05 15:47:29 02366_kql_extend: [ OK ] 0.22 sec.
2026-02-05 15:47:29 01825_type_json_9: [ OK ] 0.22 sec.
2026-02-05 15:47:30 02703_row_policies_for_asterisk: [ OK ] 0.57 sec.
2026-02-05 15:47:30 00805_round_down: [ OK ] 0.27 sec.
2026-02-05 15:47:30 03036_dynamic_read_shared_subcolumns_wide_merge_tree: [ OK ] 6.09 sec.
2026-02-05 15:47:30 02867_null_lc_in_bug: [ OK ] 0.22 sec.
2026-02-05 15:47:31 02708_parallel_replicas_not_found_column: [ OK ] 0.17 sec.
2026-02-05 15:47:31 00055_join_two_numbers: [ OK ] 0.17 sec.
2026-02-05 15:47:31 02122_parallel_formatting_Pretty: [ OK ] 2.53 sec.
2026-02-05 15:47:31 02157_line_as_string_output_format: [ OK ] 0.17 sec.
2026-02-05 15:47:31 01300_polygon_convex_hull: [ OK ] 0.17 sec.
2026-02-05 15:47:32 02239_bzip2_bug: [ OK ] 2.63 sec.
2026-02-05 15:47:33 00838_unique_index: [ OK ] 1.92 sec.
2026-02-05 15:47:33 02136_kill_scalar_queries: [ OK ] 0.82 sec.
2026-02-05 15:47:33 00171_shard_array_of_tuple_remote: [ OK ] 0.22 sec.
2026-02-05 15:47:35 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ OK ] 40.79 sec.
2026-02-05 15:47:35 01560_ttl_remove_empty_parts: [ OK ] 4.04 sec.
2026-02-05 15:47:35 02154_parser_backtracking: [ OK ] 2.13 sec.
2026-02-05 15:47:36 00643_cast_zookeeper_long: [ OK ] 0.22 sec.
2026-02-05 15:47:36 02008_aliased_column_distributed_bug: [ OK ] 0.22 sec.
2026-02-05 15:47:36 00465_nullable_default: [ OK ] 0.17 sec.
2026-02-05 15:47:36 00962_enumNotExect: [ OK ] 0.22 sec.
2026-02-05 15:47:37 01636_nullable_fuzz2: [ OK ] 0.28 sec.
2026-02-05 15:47:37 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.22 sec.
2026-02-05 15:47:37 02764_index_analysis_fix: [ OK ] 0.22 sec.
2026-02-05 15:47:37 02577_keepermap_delete_update: [ OK ] 0.27 sec.
2026-02-05 15:47:38 02250_insert_select_from_file_schema_inference: [ OK ] 0.22 sec.
2026-02-05 15:47:38 02165_auto_format_by_file_extension: [ OK ] 4.53 sec.
2026-02-05 15:47:38 01654_test_writer_block_sequence: [ OK ] 22.13 sec.
2026-02-05 15:47:38 02482_value_block_parsing: [ OK ] 0.62 sec.
2026-02-05 15:47:38 01557_field_infinite_convert_to_number: [ OK ] 0.17 sec.
2026-02-05 15:47:38 02105_backslash_letter_commands: [ OK ] 0.57 sec.
2026-02-05 15:47:38 02113_format_row_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:39 02517_uuid_parsing: [ OK ] 0.20 sec.
2026-02-05 15:47:39 01250_fixed_string_comparison: [ OK ] 0.17 sec.
2026-02-05 15:47:39 02923_explain_expired_context: [ OK ] 0.17 sec.
2026-02-05 15:47:39 02003_memory_limit_in_client: [ OK ] 4.18 sec.
2026-02-05 15:47:39 03064_analyzer_named_subqueries: [ OK ] 0.22 sec.
2026-02-05 15:47:39 03160_dynamic_type_agg: [ OK ] 0.17 sec.
2026-02-05 15:47:39 01604_explain_ast_of_nonselect_query: [ OK ] 0.28 sec.
2026-02-05 15:47:39 02535_analyzer_group_by_use_nulls: [ OK ] 0.38 sec.
2026-02-05 15:47:40 00964_bloom_index_string_functions: [ OK ] 4.68 sec.
2026-02-05 15:47:40 01125_generate_random_qoega: [ OK ] 0.38 sec.
2026-02-05 15:47:40 01699_timezoneOffset: [ OK ] 0.42 sec.
2026-02-05 15:47:40 01665_merge_tree_min_for_concurrent_read: [ OK ] 0.17 sec.
2026-02-05 15:47:40 00254_tuple_extremes: [ OK ] 0.22 sec.
2026-02-05 15:47:40 01499_json_named_tuples: [ OK ] 0.17 sec.
2026-02-05 15:47:40 02587_csv_big_numbers_inference: [ OK ] 0.17 sec.
2026-02-05 15:47:40 00398_url_functions: [ OK ] 0.82 sec.
2026-02-05 15:47:41 01054_cache_dictionary_bunch_update: [ OK ] 11.15 sec.
2026-02-05 15:47:41 01343_min_bytes_to_use_mmap_io: [ OK ] 0.28 sec.
2026-02-05 15:47:41 02154_bitmap_contains: [ OK ] 0.22 sec.
2026-02-05 15:47:41 02891_rename_table_without_keyword: [ OK ] 0.27 sec.
2026-02-05 15:47:41 00652_mutations_default_database: [ OK ] 0.87 sec.
2026-02-05 15:47:41 00002_system_numbers: [ OK ] 0.17 sec.
2026-02-05 15:47:41 01558_ttest_scipy: [ OK ] 2.37 sec.
2026-02-05 15:47:41 03167_fancy_quotes_off_by_one: [ OK ] 0.17 sec.
2026-02-05 15:47:41 02828_create_as_table_function_rename: [ OK ] 0.17 sec.
2026-02-05 15:47:41 00698_validate_array_sizes_for_nested_kshvakov: [ OK ] 0.17 sec.
2026-02-05 15:47:41 02267_jsonlines_ndjson_format: [ OK ] 0.17 sec.
2026-02-05 15:47:41 02863_interpolate_subquery: [ OK ] 0.17 sec.
2026-02-05 15:47:41 01299_alter_merge_tree: [ OK ] 0.17 sec.
2026-02-05 15:47:42 00119_storage_join: [ OK ] 0.17 sec.
2026-02-05 15:47:42 00299_stripe_log_multiple_inserts: [ OK ] 0.32 sec.
2026-02-05 15:47:42 02461_welch_t_test_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:47:42 02417_repeat_input_commands: [ OK ] 0.57 sec.
2026-02-05 15:47:42 00950_test_double_delta_codec: [ OK ] 0.37 sec.
2026-02-05 15:47:42 01681_hyperscan_debug_assertion: [ OK ] 0.62 sec.
2026-02-05 15:47:43 01774_tuple_null_in: [ OK ] 0.17 sec.
2026-02-05 15:47:43 01710_projections_group_by_no_key: [ OK ] 0.17 sec.
2026-02-05 15:47:43 01796_Log_rwlock_ub: [ OK ] 0.22 sec.
2026-02-05 15:47:43 01626_cnf_fuzz_long: [ OK ] 14.42 sec.
2026-02-05 15:47:43 00192_least_greatest: [ OK ] 0.17 sec.
2026-02-05 15:47:43 01458_count_digits: [ OK ] 0.17 sec.
2026-02-05 15:47:44 01416_clear_column_pk: [ OK ] 0.27 sec.
2026-02-05 15:47:44 03146_asof_join_ddb_merge_long: [ OK ] 5.03 sec.
2026-02-05 15:47:44 03038_nested_dynamic_merges_compact_vertical: [ OK ] 2.28 sec.
2026-02-05 15:47:44 02149_read_in_order_fixed_prefix_negative: [ OK ] 1.63 sec.
2026-02-05 15:47:44 03208_inconsistent_formatting_of_not_subquery: [ OK ] 0.47 sec.
2026-02-05 15:47:44 02916_set_formatting: [ OK ] 0.17 sec.
2026-02-05 15:47:44 01511_format_readable_timedelta: [ OK ] 0.12 sec.
2026-02-05 15:47:44 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.17 sec.
2026-02-05 15:47:44 00321_pk_set: [ OK ] 0.22 sec.
2026-02-05 15:47:44 00429_point_in_ellipses: [ OK ] 0.17 sec.
2026-02-05 15:47:44 02869_parallel_replicas_read_from_several: [ OK ] 0.32 sec.
2026-02-05 15:47:44 02725_null_group_key_with_rollup: [ OK ] 0.22 sec.
2026-02-05 15:47:44 01674_clickhouse_client_query_param_cte: [ OK ] 0.52 sec.
2026-02-05 15:47:44 02319_no_columns_in_row_level_filter: [ OK ] 0.57 sec.
2026-02-05 15:47:44 03015_optimize_final_rmt: [ OK ] 3.93 sec.
2026-02-05 15:47:44 01521_max_length_alias: [ OK ] 0.17 sec.
2026-02-05 15:47:45 03271_dynamic_variant_in_min_max: [ OK ] 0.27 sec.
2026-02-05 15:47:45 03173_forbid_qualify: [ OK ] 0.27 sec.
2026-02-05 15:47:45 01746_lc_values_format_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:45 02554_fix_grouping_sets_predicate_push_down: [ OK ] 0.22 sec.
2026-02-05 15:47:45 00027_simple_argMinArray: [ OK ] 0.12 sec.
2026-02-05 15:47:45 00440_nulls_merge_tree: [ OK ] 0.22 sec.
2026-02-05 15:47:45 02874_analysis_of_variance_overflow: [ OK ] 0.17 sec.
2026-02-05 15:47:45 02424_pod_array_overflow: [ OK ] 0.12 sec.
2026-02-05 15:47:45 02017_bit_shift_left_for_string_integer: [ OK ] 0.52 sec.
2026-02-05 15:47:45 02842_filesystem_cache_validate_path: [ OK ] 0.17 sec.
2026-02-05 15:47:46 00823_capnproto_input: [ OK ] 1.02 sec.
2026-02-05 15:47:46 01906_h3_to_geo: [ OK ] 0.27 sec.
2026-02-05 15:47:46 00553_invalid_nested_name: [ OK ] 0.17 sec.
2026-02-05 15:47:46 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.37 sec.
2026-02-05 15:47:46 02901_parallel_replicas_rollup: [ OK ] 2.13 sec.
2026-02-05 15:47:48 00965_set_index_string_functions: [ OK ] 1.87 sec.
2026-02-05 15:47:49 00632_aggregation_window_funnel: [ OK ] 0.72 sec.
2026-02-05 15:47:49 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 3.83 sec.
2026-02-05 15:47:50 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.47 sec.
2026-02-05 15:47:50 02884_async_insert_native_protocol_2: [ OK ] 5.99 sec.
2026-02-05 15:47:50 01246_least_greatest_generic: [ OK ] 0.27 sec.
2026-02-05 15:47:50 00064_negate_bug: [ OK ] 0.12 sec.
2026-02-05 15:47:50 00507_sumwithoverflow: [ OK ] 0.22 sec.
2026-02-05 15:47:50 00612_union_query_with_subquery: [ OK ] 0.17 sec.
2026-02-05 15:47:50 02818_parameterized_view_with_cte_multiple_usage: [ OK ] 0.17 sec.
2026-02-05 15:47:50 00380_client_break_at_exception_in_batch_mode: [ OK ] 0.47 sec.
2026-02-05 15:47:51 02676_to_decimal_string: [ OK ] 0.32 sec.
2026-02-05 15:47:51 02354_array_lowcardinality: [ OK ] 0.22 sec.
2026-02-05 15:47:51 02896_dwarf_format: [ OK ] 4.83 sec.
2026-02-05 15:47:51 02960_alter_table_part_query_parameter: [ OK ] 0.22 sec.
2026-02-05 15:47:51 02841_not_ready_set_constraints: [ OK ] 0.22 sec.
2026-02-05 15:47:51 03168_read_in_order_buffering_2: [ OK ] 2.12 sec.
2026-02-05 15:47:51 01746_extract_text_from_html: [ OK ] 0.27 sec.
2026-02-05 15:47:51 01440_big_int_shift: [ OK ] 0.12 sec.
2026-02-05 15:47:51 02521_cannot_find_column_in_projection: [ OK ] 0.17 sec.
2026-02-05 15:47:51 02918_analyzer_to_ast_crash: [ OK ] 0.17 sec.
2026-02-05 15:47:51 00358_from_string_complex_types: [ OK ] 0.17 sec.
2026-02-05 15:47:52 00834_kill_mutation_replicated_zookeeper: [ OK ] 35.80 sec.
2026-02-05 15:47:52 00311_array_primary_key: [ OK ] 0.22 sec.
2026-02-05 15:47:52 02845_group_by_constant_keys: [ OK ] 0.32 sec.
2026-02-05 15:47:52 01666_lcm_ubsan: [ OK ] 0.22 sec.
2026-02-05 15:47:52 01825_new_type_json_ghdata_insert_select: [ OK ] 6.14 sec.
2026-02-05 15:47:52 02845_join_on_cond_sparse: [ OK ] 0.17 sec.
2026-02-05 15:47:52 00761_lower_utf8_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:52 00538_datediff: [ OK ] 0.37 sec.
2026-02-05 15:47:53 00714_alter_uuid: [ OK ] 0.27 sec.
2026-02-05 15:47:53 01475_read_subcolumns_2: [ OK ] 0.32 sec.
2026-02-05 15:47:53 02044_url_glob_parallel_connection_refused: [ OK ] 11.46 sec.
2026-02-05 15:47:54 01083_functional_index_in_mergetree: [ OK ] 0.32 sec.
2026-02-05 15:47:54 02864_statistics_usage: [ OK ] 0.32 sec.
2026-02-05 15:47:54 01583_parallel_parsing_exception_with_offset: [ OK ] 2.23 sec.
2026-02-05 15:47:54 00974_primary_key_for_lowCardinality: [ OK ] 1.52 sec.
2026-02-05 15:47:54 02752_custom_separated_ignore_spaces_bug: [ OK ] 0.17 sec.
2026-02-05 15:47:54 01344_alter_enum_partition_key: [ OK ] 0.27 sec.
2026-02-05 15:47:54 02560_quantile_min_max: [ OK ] 0.22 sec.
2026-02-05 15:47:54 02789_reading_from_s3_with_connection_pool: [ OK ] 3.58 sec.
2026-02-05 15:47:54 01674_htm_xml_coarse_parse: [ OK ] 0.22 sec.
2026-02-05 15:47:54 02862_sorted_distinct_sparse_fix: [ OK ] 0.22 sec.
2026-02-05 15:47:54 03006_correct_revoke_for_partial_rights: [ OK ] 1.83 sec.
2026-02-05 15:47:55 02807_lower_utf8_msan: [ OK ] 0.17 sec.
2026-02-05 15:47:55 01298_alter_merge: [ OK ] 0.22 sec.
2026-02-05 15:47:55 03095_msan_uuid_string_to_num: [ OK ] 0.17 sec.
2026-02-05 15:47:55 02343_analyzer_lambdas: [ OK ] 0.42 sec.
2026-02-05 15:47:55 02899_distributed_limit_by: [ OK ] 0.42 sec.
2026-02-05 15:47:55 02911_arrow_large_list: [ OK ] 0.57 sec.
2026-02-05 15:47:55 01917_distinct_on: [ OK ] 0.17 sec.
2026-02-05 15:47:56 01001_rename_merge_race_condition: [ OK ] 10.85 sec.
2026-02-05 15:47:56 02326_settings_changes_system_table: [ OK ] 0.17 sec.
2026-02-05 15:47:56 02006_todatetime64_from_string: [ OK ] 0.17 sec.
2026-02-05 15:47:56 02136_scalar_progress: [ OK ] 0.42 sec.
2026-02-05 15:47:56 02345_partial_sort_transform_optimization: [ OK ] 0.22 sec.
2026-02-05 15:47:56 02954_analyzer_fuzz_i57086: [ OK ] 0.17 sec.
2026-02-05 15:47:56 03151_dynamic_type_scale_max_types: [ OK ] 0.27 sec.
2026-02-05 15:47:56 00712_prewhere_with_missing_columns: [ OK ] 0.22 sec.
2026-02-05 15:47:56 02962_max_joined_block_rows: [ OK ] 0.22 sec.
2026-02-05 15:47:56 02406_try_read_datetime64_bug: [ OK ] 0.25 sec.
2026-02-05 15:47:57 02735_system_zookeeper_connection: [ OK ] 0.23 sec.
2026-02-05 15:47:57 02129_window_functions_disable_optimizations: [ OK ] 0.22 sec.
2026-02-05 15:47:57 03010_sum_to_to_count_if_nullable: [ OK ] 0.22 sec.
2026-02-05 15:47:57 01825_type_json_in_array: [ OK ] 0.27 sec.
2026-02-05 15:47:57 02457_insert_select_progress_http: [ OK ] 0.52 sec.
2026-02-05 15:47:57 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.27 sec.
2026-02-05 15:47:57 01039_mergetree_exec_time: [ OK ] 1.28 sec.
2026-02-05 15:47:58 03229_empty_tuple_in_array: [ OK ] 0.22 sec.
2026-02-05 15:47:58 01332_join_type_syntax_position: [ OK ] 0.28 sec.
2026-02-05 15:47:58 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.12 sec.
2026-02-05 15:47:58 01300_svg: [ OK ] 0.37 sec.
2026-02-05 15:47:58 01360_division_overflow: [ OK ] 0.22 sec.
2026-02-05 15:47:58 02521_tsv_csv_custom_header_detection: [ OK ] 6.99 sec.
2026-02-05 15:47:58 02914_t64_buffer_overflow: [ OK ] 0.48 sec.
2026-02-05 15:47:58 02265_limit_push_down_over_window_functions_bug: [ OK ] 1.03 sec.
2026-02-05 15:47:58 03014_msan_parse_date_time: [ OK ] 0.13 sec.
2026-02-05 15:47:59 02180_group_by_lowcardinality: [ OK ] 0.17 sec.
2026-02-05 15:47:59 02464_decimal_scale_buffer_overflow: [ OK ] 0.17 sec.
2026-02-05 15:47:59 02552_client_format_settings: [ OK ] 0.17 sec.
2026-02-05 15:47:59 01287_max_execution_speed: [ OK ] 4.24 sec.
2026-02-05 15:47:59 02992_all_columns_should_have_comment: [ OK ] 0.42 sec.
2026-02-05 15:47:59 02888_system_tables_with_inaccessible_table_function: [ OK ] 0.27 sec.
2026-02-05 15:47:59 03093_bug37909_query_does_not_finish: [ OK ] 0.42 sec.
2026-02-05 15:47:59 00021_sorting_arrays: [ OK ] 0.27 sec.
2026-02-05 15:47:59 02969_mysql_cast_type_aliases: [ OK ] 0.47 sec.
2026-02-05 15:48:00 02731_auto_convert_dictionary_layout_to_complex_by_complex_keys: [ OK ] 0.37 sec.
2026-02-05 15:48:00 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.28 sec.
2026-02-05 15:48:00 02001_compress_output_file: [ OK ] 0.83 sec.
2026-02-05 15:48:00 01012_show_tables_limit: [ OK ] 0.23 sec.
2026-02-05 15:48:00 02295_GROUP_BY_AggregateFunction: [ OK ] 0.33 sec.
2026-02-05 15:48:00 01915_json_extract_raw_string: [ OK ] 0.22 sec.
2026-02-05 15:48:00 00702_join_on_dups: [ OK ] 0.58 sec.
2026-02-05 15:48:00 02189_join_type_conversion: [ OK ] 0.22 sec.
2026-02-05 15:48:01 00724_insert_values_datetime_conversion: [ OK ] 0.23 sec.
2026-02-05 15:48:01 00944_ml_test: [ OK ] 0.24 sec.
2026-02-05 15:48:01 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.28 sec.
2026-02-05 15:48:01 02242_if_then_else_null_bug: [ OK ] 0.22 sec.
2026-02-05 15:48:01 02421_type_json_empty_parts: [ OK ] 9.50 sec.
2026-02-05 15:48:01 02374_regexp_replace: [ OK ] 0.17 sec.
2026-02-05 15:48:01 01042_h3_k_ring: [ OK ] 0.27 sec.
2026-02-05 15:48:01 00008_array_join: [ OK ] 0.17 sec.
2026-02-05 15:48:02 02845_parquet_odd_decimals: [ OK ] 1.22 sec.
2026-02-05 15:48:02 03145_unicode_quotes: [ OK ] 0.24 sec.
2026-02-05 15:48:02 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.17 sec.
2026-02-05 15:48:02 01664_array_slice_ubsan: [ OK ] 0.22 sec.
2026-02-05 15:48:02 00653_verification_monotonic_data_load: [ OK ] 7.40 sec.
2026-02-05 15:48:02 01750_parsing_exception: [ OK ] 0.89 sec.
2026-02-05 15:48:02 01540_verbatim_partition_pruning: [ OK ] 0.32 sec.
2026-02-05 15:48:02 02900_limit_by_query_stage: [ OK ] 1.07 sec.
2026-02-05 15:48:02 02898_parallel_replicas_custom_key_final: [ OK ] 0.27 sec.
2026-02-05 15:48:03 02737_sql_auto_is_null: [ OK ] 0.32 sec.
2026-02-05 15:48:03 01259_combinator_distinct: [ OK ] 0.37 sec.
2026-02-05 15:48:03 02969_analyzer_eliminate_injective_functions: [ OK ] 0.22 sec.
2026-02-05 15:48:03 02513_date_string_comparison: [ OK ] 0.63 sec.
2026-02-05 15:48:03 02935_parallel_replicas_settings: [ OK ] 0.67 sec.
2026-02-05 15:48:03 01036_union_different_columns: [ OK ] 0.12 sec.
2026-02-05 15:48:03 01355_defaultValueOfArgumentType_bug: [ OK ] 0.23 sec.
2026-02-05 15:48:03 01423_if_nullable_cond: [ OK ] 0.17 sec.
2026-02-05 15:48:03 02718_array_fold: [ OK ] 0.42 sec.
2026-02-05 15:48:03 02532_analyzer_aggregation_with_rollup: [ OK ] 0.22 sec.
2026-02-05 15:48:03 00044_sorting_by_string_descending: [ OK ] 0.22 sec.
2026-02-05 15:48:03 00052_all_left_join: [ OK ] 0.17 sec.
2026-02-05 15:48:03 02475_bad_cast_low_cardinality_to_string_bug: [ OK ] 0.12 sec.
2026-02-05 15:48:04 01037_polygon_dicts_correctness_fast: [ OK ] 8.64 sec.
2026-02-05 15:48:04 02233_HTTP_ranged: [ OK ] 1.22 sec.
2026-02-05 15:48:04 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.32 sec.
2026-02-05 15:48:04 00159_whitespace_in_columns_list: [ OK ] 0.32 sec.
2026-02-05 15:48:04 02238_lz4_bug: [ OK ] 5.33 sec.
2026-02-05 15:48:04 00304_http_external_data: [ OK ] 0.57 sec.
2026-02-05 15:48:04 02833_local_udf_options: [ OK ] 0.67 sec.
2026-02-05 15:48:04 00721_force_by_identical_result_after_merge_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:48:04 01073_bad_alter_partition: [ OK ] 0.27 sec.
2026-02-05 15:48:04 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.22 sec.
2026-02-05 15:48:04 03115_alias_exists_column: [ OK ] 0.17 sec.
2026-02-05 15:48:04 00278_insert_already_sorted: [ OK ] 0.47 sec.
2026-02-05 15:48:04 00751_default_databasename_for_view: [ OK ] 0.32 sec.
2026-02-05 15:48:05 02810_convert_uuid_to_uint128: [ OK ] 0.27 sec.
2026-02-05 15:48:05 01655_plan_optimizations_merge_filters: [ OK ] 0.32 sec.
2026-02-05 15:48:05 00627_recursive_alias: [ OK ] 0.32 sec.
2026-02-05 15:48:05 01134_max_rows_to_group_by: [ OK ] 0.32 sec.
2026-02-05 15:48:05 02715_or_null: [ OK ] 0.12 sec.
2026-02-05 15:48:05 03130_nested_type: [ OK ] 0.62 sec.
2026-02-05 15:48:05 01398_in_tuple_func: [ OK ] 0.22 sec.
2026-02-05 15:48:05 01097_pre_limit: [ OK ] 0.17 sec.
2026-02-05 15:48:05 01046_trivial_count_query_distributed: [ OK ] 0.22 sec.
2026-02-05 15:48:05 02894_ast_depth_check: [ OK ] 0.67 sec.
2026-02-05 15:48:05 01831_max_streams: [ OK ] 0.22 sec.
2026-02-05 15:48:05 01453_fixsed_string_sort: [ OK ] 0.42 sec.
2026-02-05 15:48:05 01710_projection_optimize_aggregators_of_group_by_keys: [ OK ] 0.37 sec.
2026-02-05 15:48:05 01818_case_float_value_fangyc: [ OK ] 0.12 sec.
2026-02-05 15:48:06 01276_alter_rename_column_materialized_expr: [ OK ] 0.37 sec.
2026-02-05 15:48:06 01505_pipeline_executor_UAF: [ OK ] 7.74 sec.
2026-02-05 15:48:06 01746_long_zlib_http_compression_json_format: [ OK ] 0.72 sec.
2026-02-05 15:48:06 00457_log_tinylog_stripelog_nullable: [ OK ] 0.42 sec.
2026-02-05 15:48:06 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:48:06 02187_insert_values_with_mv: [ OK ] 0.87 sec.
2026-02-05 15:48:06 01554_interpreter_integer_float: [ OK ] 0.22 sec.
2026-02-05 15:48:06 03075_analyzer_subquery_alias: [ OK ] 0.17 sec.
2026-02-05 15:48:06 02273_full_sort_join: [ OK ] 4.50 sec.
2026-02-05 15:48:06 02163_operators: [ OK ] 0.17 sec.
2026-02-05 15:48:06 03205_hashing_empty_tuples: [ OK ] 0.28 sec.
2026-02-05 15:48:07 02481_i43247_ubsan_in_minmaxany: [ OK ] 0.17 sec.
2026-02-05 15:48:08 02752_space_function: [ OK ] 1.54 sec.
2026-02-05 15:48:08 00028_shard_big_agg_aj_distributed: [ OK ] 1.83 sec.
2026-02-05 15:48:08 01753_mutate_table_predicated_with_table: [ OK ] 1.98 sec.
2026-02-05 15:48:08 01480_binary_operator_monotonicity: [ OK ] 1.88 sec.
2026-02-05 15:48:08 01070_h3_to_string: [ OK ] 0.12 sec.
2026-02-05 15:48:08 01506_buffer_table_alter_block_structure_2: [ OK ] 0.17 sec.
2026-02-05 15:48:09 01653_tuple_hamming_distance_2: [ OK ] 0.27 sec.
2026-02-05 15:48:09 03173_set_transformed_partition_pruning: [ OK ] 3.33 sec.
2026-02-05 15:48:09 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.17 sec.
2026-02-05 15:48:09 01285_date_datetime_key_condition: [ OK ] 0.22 sec.
2026-02-05 15:48:09 01413_truncate_without_table_keyword: [ OK ] 0.17 sec.
2026-02-05 15:48:10 02210_processors_profile_log_2: [ OK ] 1.17 sec.
2026-02-05 15:48:10 02476_fix_cast_parser_bug: [ OK ] 0.12 sec.
2026-02-05 15:48:10 01460_mark_inclusion_search_crash: [ OK ] 0.92 sec.
2026-02-05 15:48:10 01472_obfuscator_uuid: [ OK ] 1.78 sec.
2026-02-05 15:48:10 02242_subcolumns_sizes: [ OK ] 0.37 sec.
2026-02-05 15:48:10 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.17 sec.
2026-02-05 15:48:10 02480_interval_casting_and_subquery: [ OK ] 0.22 sec.
2026-02-05 15:48:11 01721_join_implicit_cast_long: [ OK ] 2.58 sec.
2026-02-05 15:48:12 02911_backup_restore_keeper_map: [ OK ] 8.24 sec.
2026-02-05 15:48:13 01712_no_adaptive_granularity_vertical_merge: [ OK ] 1.57 sec.
2026-02-05 15:48:13 01168_mutations_isolation: [ OK ] 7.89 sec.
2026-02-05 15:48:13 01890_cross_join_explain_crash: [ OK ] 0.17 sec.
2026-02-05 15:48:13 02137_mv_into_join: [ OK ] 0.27 sec.
2026-02-05 15:48:13 02500_prevent_drop_nested_if_empty_part: [ OK ] 0.27 sec.
2026-02-05 15:48:13 01932_null_valid_identifier: [ OK ] 0.17 sec.
2026-02-05 15:48:13 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.17 sec.
2026-02-05 15:48:13 02576_predicate_push_down_sorting_fix: [ OK ] 0.17 sec.
2026-02-05 15:48:13 00534_functions_bad_arguments9: [ OK ] 4.63 sec.
2026-02-05 15:48:13 02861_filter_pushdown_const_bug: [ OK ] 0.27 sec.
2026-02-05 15:48:13 02316_literal_no_octal: [ OK ] 0.17 sec.
2026-02-05 15:48:13 00108_shard_totals_after_having: [ OK ] 0.32 sec.
2026-02-05 15:48:14 02119_sumcount: [ OK ] 0.42 sec.
2026-02-05 15:48:14 02366_kql_summarize: [ OK ] 0.49 sec.
2026-02-05 15:48:14 02101_avro_union_index_out_of_boundary: [ OK ] 0.77 sec.
2026-02-05 15:48:14 00632_get_sample_block_cache: [ OK ] 3.33 sec.
2026-02-05 15:48:14 02540_date_column_consistent_insert_behaviour: [ OK ] 0.37 sec.
2026-02-05 15:48:14 02421_explain_subquery: [ OK ] 0.42 sec.
2026-02-05 15:48:14 03035_internal_functions_direct_call: [ OK ] 0.23 sec.
2026-02-05 15:48:14 01326_build_id: [ OK ] 0.17 sec.
2026-02-05 15:48:14 00909_ngram_distance: [ OK ] 0.72 sec.
2026-02-05 15:48:15 02139_MV_with_scalar_subquery: [ OK ] 0.27 sec.
2026-02-05 15:48:15 03215_grant_current_grants: [ OK ] 1.42 sec.
2026-02-05 15:48:15 00754_alter_modify_column_partitions: [ OK ] 0.37 sec.
2026-02-05 15:48:15 01106_const_fixed_string_like: [ OK ] 0.22 sec.
2026-02-05 15:48:15 01010_pmj_one_row_blocks: [ OK ] 0.67 sec.
2026-02-05 15:48:15 03072_analyzer_missing_columns_from_subquery: [ OK ] 0.17 sec.
2026-02-05 15:48:15 01518_select_in_null: [ OK ] 0.52 sec.
2026-02-05 15:48:15 01016_simhash_minhash_ppc: [ SKIPPED ] 0.00 sec.
2026-02-05 15:48:15 Reason: not running for current build
2026-02-05 15:48:16 01521_global_in_prewhere_15792: [ OK ] 0.27 sec.
2026-02-05 15:48:16 00085_visible_width_of_tuple_of_dates: [ OK ] 0.17 sec.
2026-02-05 15:48:16 02816_clickhouse_local_table_name_expressions: [ OK ] 5.23 sec.
2026-02-05 15:48:16 00979_quantileExcatExclusive_and_Inclusive: [ OK ] 0.17 sec.
2026-02-05 15:48:16 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.27 sec.
2026-02-05 15:48:16 00838_system_tables_drop_table_race: [ OK ] 2.08 sec.
2026-02-05 15:48:16 03167_transactions_are_really_disabled: [ OK ] 0.47 sec.
2026-02-05 15:48:16 01114_alter_modify_compact_parts: [ OK ] 0.38 sec.
2026-02-05 15:48:16 00146_summing_merge_tree_nested_map: [ OK ] 0.73 sec.
2026-02-05 15:48:17 02366_direct_dictionary_dict_has: [ OK ] 0.32 sec.
2026-02-05 15:48:17 02343_group_by_use_nulls_distributed: [ OK ] 0.52 sec.
2026-02-05 15:48:17 00844_join_lightee2: [ OK ] 0.27 sec.
2026-02-05 15:48:17 02661_read_from_archive_zip: [ OK ] 6.86 sec.
2026-02-05 15:48:17 01599_multiline_input_and_singleline_comments: [ OK ] 1.29 sec.
2026-02-05 15:48:17 02810_async_insert_dedup_replicated_collapsing: [ OK ] 10.82 sec.
2026-02-05 15:48:17 01513_ilike_like_cache: [ OK ] 0.17 sec.
2026-02-05 15:48:18 02841_join_filter_set_sparse: [ OK ] 0.22 sec.
2026-02-05 15:48:18 03096_text_log_format_string_args_not_empty: [ OK ] 0.68 sec.
2026-02-05 15:48:18 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.53 sec.
2026-02-05 15:48:18 00652_replicated_mutations_default_database_zookeeper: [ OK ] 1.08 sec.
2026-02-05 15:48:18 02405_pmj_issue_40335: [ OK ] 0.17 sec.
2026-02-05 15:48:18 02479_if_with_null_and_cullable_const: [ OK ] 0.17 sec.
2026-02-05 15:48:18 02506_date_time64_floating_point_negative_value: [ OK ] 0.18 sec.
2026-02-05 15:48:18 02017_order_by_with_fill_redundant_functions: [ OK ] 0.17 sec.
2026-02-05 15:48:18 03129_format_row_json_http: [ OK ] 0.42 sec.
2026-02-05 15:48:19 01355_alter_column_with_order: [ OK ] 0.22 sec.
2026-02-05 15:48:19 02293_h3_hex_ring: [ OK ] 0.32 sec.
2026-02-05 15:48:19 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.22 sec.
2026-02-05 15:48:19 01406_carriage_return_in_tsv_csv: [ OK ] 1.17 sec.
2026-02-05 15:48:19 01184_long_insert_values_huge_strings: [ OK ] 4.24 sec.
2026-02-05 15:48:19 02418_aggregate_combinators: [ OK ] 0.32 sec.
2026-02-05 15:48:20 03094_grouparraysorted_memory: [ OK ] 3.13 sec.
2026-02-05 15:48:20 00116_storage_set: [ OK ] 0.27 sec.
2026-02-05 15:48:20 01015_random_constant: [ OK ] 0.17 sec.
2026-02-05 15:48:20 03254_parquet_bool_native_reader: [ OK ] 0.72 sec.
2026-02-05 15:48:20 00534_functions_bad_arguments3: [ OK ] 5.45 sec.
2026-02-05 15:48:20 02000_map_full_text_bloom_filter_index: [ OK ] 0.57 sec.
2026-02-05 15:48:20 03085_analyzer_alias_column_group_by: [ OK ] 0.17 sec.
2026-02-05 15:48:20 02022_array_full_text_bloom_filter_index: [ OK ] 0.27 sec.
2026-02-05 15:48:20 01493_alter_remove_wrong_default: [ OK ] 0.17 sec.
2026-02-05 15:48:21 01734_datetime64_from_float: [ OK ] 0.32 sec.
2026-02-05 15:48:21 01893_jit_aggregation_function_min_long: [ OK ] 0.72 sec.
2026-02-05 15:48:21 00637_sessions_in_http_interface_and_settings: [ OK ] 0.42 sec.
2026-02-05 15:48:21 02911_system_symbols: [ OK ] 0.37 sec.
2026-02-05 15:48:22 01474_custom_null_tsv: [ OK ] 0.97 sec.
2026-02-05 15:48:22 01672_test_toSecond_mysql_dialect: [ OK ] 0.12 sec.
2026-02-05 15:48:22 02457_parse_date_time_best_effort: [ OK ] 0.27 sec.
2026-02-05 15:48:22 02124_insert_deduplication_token_multiple_blocks_replica: [ OK ] 2.27 sec.
2026-02-05 15:48:22 00974_query_profiler: [ OK ] 4.63 sec.
2026-02-05 15:48:23 00168_buffer_defaults: [ OK ] 0.22 sec.
2026-02-05 15:48:23 00955_test_final_mark_use: [ OK ] 1.52 sec.
2026-02-05 15:48:23 01634_sum_map_nulls: [ OK ] 0.22 sec.
2026-02-05 15:48:23 00466_comments_in_keyword: [ OK ] 0.17 sec.
2026-02-05 15:48:23 01753_system_zookeeper_query_param_path_long: [ OK ] 0.83 sec.
2026-02-05 15:48:24 02507_to_unix_timestamp_overflow: [ OK ] 0.12 sec.
2026-02-05 15:48:24 01825_new_type_json_13: [ OK ] 1.32 sec.
2026-02-05 15:48:24 01072_drop_temporary_table_with_same_name: [ OK ] 0.17 sec.
2026-02-05 15:48:24 02001_join_on_const_bs_long: [ OK ] 0.42 sec.
2026-02-05 15:48:25 02483_password_reset: [ OK ] 0.67 sec.
2026-02-05 15:48:25 02313_multiple_limits: [ OK ] 0.22 sec.
2026-02-05 15:48:25 03165_distinct_with_window_func_crash: [ OK ] 0.17 sec.
2026-02-05 15:48:25 01560_monotonicity_check_multiple_args_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:25 00952_basic_constraints: [ OK ] 2.32 sec.
2026-02-05 15:48:26 03203_count_with_non_deterministic_function: [ OK ] 0.17 sec.
2026-02-05 15:48:26 00519_create_as_select_from_temporary_table: [ OK ] 0.17 sec.
2026-02-05 15:48:26 02511_complex_literals_as_aggregate_function_parameters: [ OK ] 0.17 sec.
2026-02-05 15:48:26 00592_union_all_different_aliases: [ OK ] 0.17 sec.
2026-02-05 15:48:26 01016_index_tuple_field_type: [ OK ] 0.27 sec.
2026-02-05 15:48:26 02155_read_in_order_max_rows_to_read: [ OK ] 0.22 sec.
2026-02-05 15:48:26 02765_queries_with_subqueries_profile_events: [ OK ] 4.38 sec.
2026-02-05 15:48:27 01932_alter_index_with_order: [ OK ] 0.22 sec.
2026-02-05 15:48:27 01088_benchmark_query_id: [ OK ] 0.82 sec.
2026-02-05 15:48:27 03033_set_index_in: [ OK ] 0.32 sec.
2026-02-05 15:48:27 00136_duplicate_order_by_elems: [ OK ] 0.17 sec.
2026-02-05 15:48:27 01440_big_int_least_greatest: [ OK ] 0.17 sec.
2026-02-05 15:48:27 01046_materialized_view_with_join_over_distributed: [ OK ] 0.22 sec.
2026-02-05 15:48:27 02099_tsv_raw_format_1: [ OK ] 6.59 sec.
2026-02-05 15:48:27 00608_uniq_array: [ OK ] 0.17 sec.
2026-02-05 15:48:27 03000_minmax_index_first: [ OK ] 0.22 sec.
2026-02-05 15:48:27 02866_size_of_marks_skip_idx_explain: [ OK ] 0.22 sec.
2026-02-05 15:48:28 02888_attach_partition_from_different_tables: [ OK ] 0.27 sec.
2026-02-05 15:48:28 00700_decimal_with_default_precision_and_scale: [ OK ] 0.17 sec.
2026-02-05 15:48:28 02916_local_insert_into_function: [ OK ] 0.52 sec.
2026-02-05 15:48:28 01825_type_json_18: [ OK ] 0.22 sec.
2026-02-05 15:48:28 00280_hex_escape_sequence: [ OK ] 0.22 sec.
2026-02-05 15:48:28 02995_index_6: [ OK ] 8.39 sec.
2026-02-05 15:48:28 02790_client_max_opening_fd: [ OK ] 0.52 sec.
2026-02-05 15:48:28 02478_factorial: [ OK ] 0.27 sec.
2026-02-05 15:48:28 02319_timeslots_dt64: [ OK ] 0.27 sec.
2026-02-05 15:48:29 02096_sample_by_tuple: [ OK ] 0.17 sec.
2026-02-05 15:48:29 03251_unaligned_window_function_state: [ OK ] 0.17 sec.
2026-02-05 15:48:29 02561_with_fill_date_datetime_incompatible: [ OK ] 0.12 sec.
2026-02-05 15:48:29 02932_analyzer_rewrite_sum_column_and_constant: [ OK ] 0.82 sec.
2026-02-05 15:48:29 00603_system_parts_nonexistent_database: [ OK ] 0.12 sec.
2026-02-05 15:48:29 01883_grouping_sets_crash: [ OK ] 0.22 sec.
2026-02-05 15:48:29 00975_json_hang: [ OK ] 0.32 sec.
2026-02-05 15:48:29 01778_test_LowCardinality_FixedString_pk: [ OK ] 0.22 sec.
2026-02-05 15:48:29 03145_asof_join_ddb_inequalities: [ OK ] 0.27 sec.
2026-02-05 15:48:29 02504_regexp_dictionary_table_source: [ OK ] 0.42 sec.
2026-02-05 15:48:30 02908_Npy_files_caching: [ OK ] 1.17 sec.
2026-02-05 15:48:31 02893_bad_sample_view: [ OK ] 0.13 sec.
2026-02-05 15:48:31 00678_murmurhash: [ OK ] 0.22 sec.
2026-02-05 15:48:31 01506_ttl_same_with_order_by: [ OK ] 0.32 sec.
2026-02-05 15:48:31 02240_protobuflist_format_persons: [ OK ] 3.23 sec.
2026-02-05 15:48:31 00609_distributed_with_case_when_then: [ OK ] 0.22 sec.
2026-02-05 15:48:31 02311_normalize_utf8_constant: [ OK ] 0.12 sec.
2026-02-05 15:48:32 00743_limit_by_not_found_column: [ OK ] 0.22 sec.
2026-02-05 15:48:32 02023_parser_number_binary_literal: [ OK ] 0.22 sec.
2026-02-05 15:48:32 02560_window_ntile: [ OK ] 0.27 sec.
2026-02-05 15:48:32 02801_transform_nullable: [ OK ] 0.17 sec.
2026-02-05 15:48:32 03123_analyzer_dist_join_CTE: [ OK ] 0.17 sec.
2026-02-05 15:48:32 01323_if_with_nulls: [ OK ] 0.22 sec.
2026-02-05 15:48:32 01013_hex_decimal: [ OK ] 0.17 sec.
2026-02-05 15:48:33 01753_fix_clickhouse_format: [ OK ] 0.62 sec.
2026-02-05 15:48:33 01443_merge_truncate_long: [ OK ] 15.74 sec.
2026-02-05 15:48:33 00701_context_use_after_free: [ OK ] 0.17 sec.
2026-02-05 15:48:33 02716_parquet_invalid_date32: [ OK ] 0.72 sec.
2026-02-05 15:48:33 03143_asof_join_ddb_long: [ OK ] 6.59 sec.
2026-02-05 15:48:33 01774_case_sensitive_connection_id: [ OK ] 0.12 sec.
2026-02-05 15:48:33 02026_arrayDifference_const: [ OK ] 0.17 sec.
2026-02-05 15:48:33 01118_is_constant: [ OK ] 0.17 sec.
2026-02-05 15:48:33 02343_analyzer_lambdas_issue_36677: [ OK ] 0.17 sec.
2026-02-05 15:48:34 00901_joint_entropy: [ OK ] 0.17 sec.
2026-02-05 15:48:34 02789_set_index_nullable_condition_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:34 02177_merge_optimize_aggregation_in_order: [ OK ] 0.22 sec.
2026-02-05 15:48:34 00948_format_in_with_single_element: [ OK ] 0.67 sec.
2026-02-05 15:48:34 03067_analyzer_complex_alias_join: [ OK ] 0.17 sec.
2026-02-05 15:48:34 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.42 sec.
2026-02-05 15:48:34 02015_division_by_nullable: [ OK ] 0.37 sec.
2026-02-05 15:48:35 02158_proportions_ztest: [ OK ] 0.22 sec.
2026-02-05 15:48:35 03352_distinct_sorted_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:35 01691_parser_data_type_exponential: [ OK ] 1.42 sec.
2026-02-05 15:48:35 01526_initial_query_id: [ OK ] 0.92 sec.
2026-02-05 15:48:36 02048_parallel_reading_from_infile: [ OK ] 0.82 sec.
2026-02-05 15:48:36 02006_test_positional_arguments: [ OK ] 0.42 sec.
2026-02-05 15:48:36 02473_multistep_prewhere: [ OK ] 12.06 sec.
2026-02-05 15:48:36 00836_numbers_table_function_zero: [ OK ] 0.22 sec.
2026-02-05 15:48:36 02012_get_server_port: [ OK ] 0.22 sec.
2026-02-05 15:48:36 00942_mv_rename_table: [ OK ] 0.17 sec.
2026-02-05 15:48:36 01016_input_null_as_default: [ OK ] 3.73 sec.
2026-02-05 15:48:36 03035_max_insert_threads_support: [ OK ] 0.62 sec.
2026-02-05 15:48:36 01321_aggregate_functions_of_group_by_keys: [ OK ] 0.77 sec.
2026-02-05 15:48:37 00098_1_union_all: [ OK ] 0.22 sec.
2026-02-05 15:48:37 03013_hop_infinite_loop: [ OK ] 0.12 sec.
2026-02-05 15:48:37 00523_aggregate_functions_in_group_array: [ OK ] 0.17 sec.
2026-02-05 15:48:37 01671_test_toQuarter_mysql_dialect: [ OK ] 0.12 sec.
2026-02-05 15:48:37 01456_min_negative_decimal_formatting: [ OK ] 0.12 sec.
2026-02-05 15:48:37 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.27 sec.
2026-02-05 15:48:37 02564_read_in_order_final_desc: [ OK ] 0.22 sec.
2026-02-05 15:48:37 01527_materialized_view_stack_overflow: [ OK ] 0.67 sec.
2026-02-05 15:48:37 03156_group_concat: [ OK ] 0.37 sec.
2026-02-05 15:48:37 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.22 sec.
2026-02-05 15:48:38 02872_null_as_default_nested: [ OK ] 2.62 sec.
2026-02-05 15:48:38 01675_data_type_coroutine: [ OK ] 8.94 sec.
2026-02-05 15:48:39 01552_impl_aggfunc_cloneresize: [ OK ] 0.17 sec.
2026-02-05 15:48:39 01452_normalized_query_hash: [ OK ] 0.17 sec.
2026-02-05 15:48:39 02520_group_array_last: [ OK ] 0.32 sec.
2026-02-05 15:48:39 02802_with_cube_with_totals: [ OK ] 0.17 sec.
2026-02-05 15:48:39 00915_tuple_orantius: [ OK ] 0.12 sec.
2026-02-05 15:48:40 02993_values_escape_quote: [ OK ] 0.17 sec.
2026-02-05 15:48:40 01710_aggregate_projections: [ OK ] 2.18 sec.
2026-02-05 15:48:40 02834_remote_session_log: [ OK ] 2.73 sec.
2026-02-05 15:48:40 01016_uniqCombined64: [ OK ] 0.57 sec.
2026-02-05 15:48:40 03199_unbin_buffer_overflow: [ OK ] 3.58 sec.
2026-02-05 15:48:40 02535_analyzer_limit_offset: [ OK ] 0.12 sec.
2026-02-05 15:48:40 01764_table_function_dictionary: [ OK ] 0.22 sec.
2026-02-05 15:48:41 00141_parse_timestamp_as_datetime: [ OK ] 0.22 sec.
2026-02-05 15:48:41 02456_async_inserts_logs: [ OK ] 11.50 sec.
2026-02-05 15:48:41 02027_arrayCumSumNonNegative_const: [ OK ] 0.17 sec.
2026-02-05 15:48:41 02352_lightweight_delete_on_replicated_merge_tree: [ OK ] 0.87 sec.
2026-02-05 15:48:41 01312_case_insensitive_regexp: [ OK ] 0.17 sec.
2026-02-05 15:48:41 00153_transform: [ OK ] 0.22 sec.
2026-02-05 15:48:41 02990_format_not_precedence: [ OK ] 0.17 sec.
2026-02-05 15:48:41 00571_non_exist_database_when_create_materializ_view: [ OK ] 0.22 sec.
2026-02-05 15:48:41 02212_h3_get_res0_indexes: [ OK ] 0.12 sec.
2026-02-05 15:48:41 01323_bad_arg_in_arithmetic_operations: [ OK ] 0.17 sec.
2026-02-05 15:48:41 01051_window_view_parser_hop: [ OK ] 0.42 sec.
2026-02-05 15:48:41 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.12 sec.
2026-02-05 15:48:41 03247_materialized_view_select_intersect: [ OK ] 0.17 sec.
2026-02-05 15:48:41 02705_grouping_keys_equal_keys: [ OK ] 0.17 sec.
2026-02-05 15:48:42 01019_alter_materialized_view_query: [ OK ] 0.22 sec.
2026-02-05 15:48:42 00048_b_stored_aggregates_merge: [ OK ] 0.27 sec.
2026-02-05 15:48:42 02003_bug_from_23515: [ OK ] 0.17 sec.
2026-02-05 15:48:42 01182_materialized_view_different_structure: [ OK ] 0.42 sec.
2026-02-05 15:48:42 02000_default_from_default_empty_column: [ OK ] 0.17 sec.
2026-02-05 15:48:42 03172_http_content_encoding: [ OK ] 2.07 sec.
2026-02-05 15:48:42 01389_filter_by_virtual_columns: [ OK ] 0.17 sec.
2026-02-05 15:48:42 01633_limit_fuzz: [ OK ] 0.22 sec.
2026-02-05 15:48:43 02916_joinget_dependency: [ OK ] 0.83 sec.
2026-02-05 15:48:43 02808_aliases_inside_case: [ OK ] 0.17 sec.
2026-02-05 15:48:44 03237_create_table_select_as_with_recursive: [ OK ] 0.17 sec.
2026-02-05 15:48:44 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 1.52 sec.
2026-02-05 15:48:44 02160_h3_hex_area_Km2: [ OK ] 0.17 sec.
2026-02-05 15:48:44 01031_pmj_new_any_semi_join: [ OK ] 0.27 sec.
2026-02-05 15:48:44 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.17 sec.
2026-02-05 15:48:45 02941_variant_type_alters: [ OK ] 7.64 sec.
2026-02-05 15:48:45 01316_create_user_syntax_hilite: [ OK ] 0.42 sec.
2026-02-05 15:48:45 02733_distinct: [ OK ] 0.17 sec.
2026-02-05 15:48:45 01040_dictionary_invalidate_query_switchover_long: [ OK ] 8.10 sec.
2026-02-05 15:48:46 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.22 sec.
2026-02-05 15:48:46 01117_greatest_least_case: [ OK ] 0.21 sec.
2026-02-05 15:48:46 02552_check_referential_table_dependencies: [ OK ] 0.22 sec.
2026-02-05 15:48:46 03062_analyzer_join_engine_missing_column: [ OK ] 0.17 sec.
2026-02-05 15:48:46 01799_long_uniq_theta_sketch: [ OK ] 1.97 sec.
2026-02-05 15:48:46 01431_finish_sorting_with_consts: [ OK ] 0.17 sec.
2026-02-05 15:48:46 01029_early_constant_folding: [ OK ] 0.17 sec.
2026-02-05 15:48:46 02369_analyzer_array_join_function: [ OK ] 0.27 sec.
2026-02-05 15:48:46 00240_replace_substring_loop: [ OK ] 0.47 sec.
2026-02-05 15:48:46 00932_array_intersect_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:47 01017_tuplehamming_distance: [ OK ] 0.17 sec.
2026-02-05 15:48:47 03153_dynamic_type_empty: [ OK ] 0.17 sec.
2026-02-05 15:48:47 00291_array_reduce: [ OK ] 0.17 sec.
2026-02-05 15:48:47 03040_dynamic_type_alters_2_wide_merge_tree: [ OK ] 0.42 sec.
2026-02-05 15:48:47 02240_asof_join_biginteger: [ OK ] 0.17 sec.
2026-02-05 15:48:47 02834_analyzer_with_statement_references: [ OK ] 0.17 sec.
2026-02-05 15:48:47 01548_create_table_compound_column_format: [ OK ] 0.47 sec.
2026-02-05 15:48:47 02931_client_fuzzy_search_crash: [ OK ] 6.49 sec.
2026-02-05 15:48:47 01906_partition_by_multiply_by_zero: [ OK ] 0.17 sec.
2026-02-05 15:48:47 01825_new_type_json_18: [ OK ] 0.22 sec.
2026-02-05 15:48:47 00995_order_by_with_fill: [ OK ] 0.27 sec.
2026-02-05 15:48:47 02674_trivial_count_analyzer: [ OK ] 0.27 sec.
2026-02-05 15:48:47 02999_scalar_subqueries_bug_2: [ OK ] 0.17 sec.
2026-02-05 15:48:48 02366_explain_query_tree: [ OK ] 0.22 sec.
2026-02-05 15:48:48 02293_compatibility_ignore_auto_increment_in_create_table: [ OK ] 0.32 sec.
2026-02-05 15:48:48 02780_final_streams_data_skipping_index: [ OK ] 0.27 sec.
2026-02-05 15:48:48 00529_orantius: [ OK ] 0.22 sec.
2026-02-05 15:48:49 03039_dynamic_aggregating_merge_tree: [ OK ] 7.09 sec.
2026-02-05 15:48:50 02871_clickhouse_client_restart_pager: [ OK ] 0.57 sec.
2026-02-05 15:48:50 03127_system_unload_primary_key_table: [ OK ] 2.57 sec.
2026-02-05 15:48:50 03203_system_numbers_limit_and_offset_simple: [ OK ] 0.17 sec.
2026-02-05 15:48:50 02813_seriesOutliersDetectTukey: [ OK ] 0.32 sec.
2026-02-05 15:48:50 01010_partial_merge_join_negative: [ OK ] 0.22 sec.
2026-02-05 15:48:50 01508_explain_header: [ OK ] 0.17 sec.
2026-02-05 15:48:51 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 2.93 sec.
2026-02-05 15:48:51 03010_virtual_memory_mappings_asynchronous_metrics: [ OK ] 0.17 sec.
2026-02-05 15:48:51 03223_nested_json_in_shared_data_merges: [ OK ] 0.37 sec.
2026-02-05 15:48:51 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.17 sec.
2026-02-05 15:48:51 02541_tuple_element_with_null: [ OK ] 0.17 sec.
2026-02-05 15:48:51 01874_select_from_trailing_whitespaces: [ OK ] 1.02 sec.
2026-02-05 15:48:51 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:48:51 01297_alter_distributed: [ OK ] 0.22 sec.
2026-02-05 15:48:52 03080_incorrect_join_with_merge: [ OK ] 0.22 sec.
2026-02-05 15:48:52 02995_index_1: [ OK ] 3.63 sec.
2026-02-05 15:48:52 02150_replace_regexp_all_empty_match: [ OK ] 0.12 sec.
2026-02-05 15:48:52 01051_new_any_join_engine: [ OK ] 0.32 sec.
2026-02-05 15:48:52 02812_large_varints: [ OK ] 0.17 sec.
2026-02-05 15:48:52 02245_s3_support_read_nested_column: [ OK ] 0.37 sec.
2026-02-05 15:48:52 02376_analyzer_in_function_subquery: [ OK ] 0.22 sec.
2026-02-05 15:48:52 00257_shard_no_aggregates_and_constant_keys: [ OK ] 0.27 sec.
2026-02-05 15:48:53 00720_combinations_of_aggregate_combinators: [ OK ] 0.17 sec.
2026-02-05 15:48:53 02363_mapupdate_improve: [ OK ] 0.22 sec.
2026-02-05 15:48:53 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.22 sec.
2026-02-05 15:48:53 01852_cast_operator_bad_cases: [ OK ] 2.07 sec.
2026-02-05 15:48:53 00990_function_current_user: [ OK ] 0.17 sec.
2026-02-05 15:48:53 00754_alter_modify_order_by: [ OK ] 0.27 sec.
2026-02-05 15:48:53 02891_input_csv_cr_end_of_line: [ OK ] 0.97 sec.
2026-02-05 15:48:53 02383_schema_inference_hints: [ OK ] 0.22 sec.
2026-02-05 15:48:54 00803_odbc_driver_2_format: [ OK ] 0.17 sec.
2026-02-05 15:48:54 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.17 sec.
2026-02-05 15:48:54 02017_columns_with_dot_2: [ OK ] 0.22 sec.
2026-02-05 15:48:54 00580_consistent_hashing_functions: [ OK ] 0.22 sec.
2026-02-05 15:48:54 02969_functions_to_subcolumns_if_null: [ OK ] 0.22 sec.
2026-02-05 15:48:54 01785_pmj_lc_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:54 03312_issue_74299: [ OK ] 0.22 sec.
2026-02-05 15:48:54 02553_type_object_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:48:54 02352_grouby_shadows_arg: [ OK ] 0.17 sec.
2026-02-05 15:48:54 00313_const_totals_extremes: [ OK ] 0.47 sec.
2026-02-05 15:48:55 03212_thousand_exceptions: [ OK ] 6.94 sec.
2026-02-05 15:48:55 01378_alter_rename_with_ttl_zookeeper: [ OK ] 0.27 sec.
2026-02-05 15:48:55 01442_h3kring_range_check: [ OK ] 0.22 sec.
2026-02-05 15:48:55 02518_delete_on_materialized_view: [ OK ] 0.22 sec.
2026-02-05 15:48:55 02265_cross_join_empty_list: [ OK ] 0.22 sec.
2026-02-05 15:48:55 02913_sum_map_state: [ OK ] 0.12 sec.
2026-02-05 15:48:55 03013_addDays_with_timezone: [ OK ] 0.17 sec.
2026-02-05 15:48:55 02366_kql_func_binary: [ OK ] 0.17 sec.
2026-02-05 15:48:55 00938_fix_rwlock_segfault_long: [ OK ] 13.56 sec.
2026-02-05 15:48:55 00685_output_format_json_escape_forward_slashes: [ OK ] 0.18 sec.
2026-02-05 15:48:55 01376_null_logical: [ OK ] 0.23 sec.
2026-02-05 15:48:55 01509_parallel_quorum_insert_no_replicas_long: [ OK ] 0.42 sec.
2026-02-05 15:48:55 02714_local_object_storage: [ OK ] 0.22 sec.
2026-02-05 15:48:56 00711_array_enumerate_variants: [ OK ] 0.12 sec.
2026-02-05 15:48:56 03215_key_condition_bug: [ OK ] 0.17 sec.
2026-02-05 15:48:56 01277_toUnixTimestamp64: [ OK ] 0.22 sec.
2026-02-05 15:48:56 00275_shard_quantiles_weighted: [ OK ] 0.27 sec.
2026-02-05 15:48:58 01825_type_json_schema_inference: [ OK ] 1.48 sec.
2026-02-05 15:48:58 02389_analyzer_nested_lambda: [ OK ] 2.02 sec.
2026-02-05 15:48:58 02353_partition_prune_nullable_key: [ OK ] 0.17 sec.
2026-02-05 15:48:58 03155_in_nested_subselects: [ OK ] 0.17 sec.
2026-02-05 15:48:58 01733_transform_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:48:58 00680_duplicate_columns_inside_union_all: [ OK ] 0.17 sec.
2026-02-05 15:48:59 02865_array_join_with_max_block_size: [ OK ] 0.37 sec.
2026-02-05 15:48:59 01280_null_in: [ OK ] 0.17 sec.
2026-02-05 15:48:59 01508_partition_pruning_long_2: [ OK ] 7.69 sec.
2026-02-05 15:48:59 00041_big_array_join: [ OK ] 0.27 sec.
2026-02-05 15:48:59 01825_type_json_field: [ OK ] 0.22 sec.
2026-02-05 15:49:00 01419_materialize_null: [ OK ] 0.17 sec.
2026-02-05 15:49:00 00725_join_on_bug_4: [ OK ] 0.22 sec.
2026-02-05 15:49:00 02479_analyzer_aggregation_crash: [ OK ] 0.17 sec.
2026-02-05 15:49:00 01030_storage_set_supports_read: [ OK ] 0.27 sec.
2026-02-05 15:49:00 02012_sha512_fixedstring: [ OK ] 0.17 sec.
2026-02-05 15:49:00 02766_bitshift_with_const_arguments: [ OK ] 0.22 sec.
2026-02-05 15:49:00 01284_escape_sequences_php_mysql_style: [ OK ] 0.17 sec.
2026-02-05 15:49:00 02149_external_schema_inference: [ OK ] 2.83 sec.
2026-02-05 15:49:00 02941_variant_type_1: [ OK ] 6.34 sec.
2026-02-05 15:49:00 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.12 sec.
2026-02-05 15:49:01 01100_split_by_string: [ OK ] 0.17 sec.
2026-02-05 15:49:01 00541_kahan_sum: [ OK ] 0.17 sec.
2026-02-05 15:49:01 01640_distributed_async_insert_compression: [ OK ] 0.22 sec.
2026-02-05 15:49:01 01062_pm_multiple_all_join_same_value: [ OK ] 0.22 sec.
2026-02-05 15:49:01 01926_date_date_time_supertype: [ OK ] 0.22 sec.
2026-02-05 15:49:01 00863_comma_join_in: [ OK ] 0.27 sec.
2026-02-05 15:49:01 02687_native_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:49:01 00096_aggregation_min_if: [ OK ] 1.02 sec.
2026-02-05 15:49:02 02372_now_in_block: [ OK ] 0.52 sec.
2026-02-05 15:49:02 01705_normalize_case_insensitive_function_names: [ OK ] 0.17 sec.
2026-02-05 15:49:02 01159_combinators_with_parameters: [ OK ] 0.32 sec.
2026-02-05 15:49:02 00984_materialized_view_to_columns: [ OK ] 0.22 sec.
2026-02-05 15:49:02 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.22 sec.
2026-02-05 15:49:02 03114_analyzer_cte_with_join: [ OK ] 0.17 sec.
2026-02-05 15:49:03 02815_no_throw_in_simple_queries: [ FAIL ] 1.22 sec.
2026-02-05 15:49:03 Reason: return code: 1
2026-02-05 15:49:03 send: spawn id exp3 not open
2026-02-05 15:49:03 while executing
2026-02-05 15:49:03 "send -- "exit\r""
2026-02-05 15:49:03 , result:
2026-02-05 15:49:03
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03
2026-02-05 15:49:03 stdout:
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03 Failed
2026-02-05 15:49:03
2026-02-05 15:49:03
2026-02-05 15:49:03 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 149628 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 19404667 --max_read_buffer_size 558318 --prefer_localhost_replica 1 --max_block_size 43244 --max_joined_block_size_rows 33335 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 53 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 19720260 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 684860112 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 11 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 2917142523 --min_compress_block_size 1242173 --max_compress_block_size 585063 --merge_tree_compact_parts_min_granules_to_multibuffer_read 105 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 9001060 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone America/Punta_Arenas --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.39 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 0 --max_parsing_threads 1 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0
2026-02-05 15:49:03
2026-02-05 15:49:03 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 453431 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 3476049097 --index_granularity_bytes 26812232 --merge_max_block_size 10238 --index_granularity 14120 --min_bytes_for_wide_part 847308003 --marks_compress_block_size 97983 --primary_key_compress_block_size 53634 --replace_long_file_name_to_hash 1 --max_file_name_length 112 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 257987524 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 1492748 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 397
2026-02-05 15:49:03
2026-02-05 15:49:03 Database: test_hg0x6lwl
2026-02-05 15:49:03 02835_nested_array_lowcardinality: [ OK ] 0.22 sec.
2026-02-05 15:49:03 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.17 sec.
2026-02-05 15:49:03 01596_null_as_default_nullable: [ OK ] 0.17 sec.
2026-02-05 15:49:03 01293_pretty_max_value_width: [ OK ] 0.22 sec.
2026-02-05 15:49:03 00557_remote_port: [ OK ] 1.67 sec.
2026-02-05 15:49:04 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.22 sec.
2026-02-05 15:49:04 01271_optimize_arithmetic_operations_in_aggr_func_long: [ OK ] 0.87 sec.
2026-02-05 15:49:04 00900_long_parquet_decimal: [ OK ] 9.10 sec.
2026-02-05 15:49:04 00660_optimize_final_without_partition: [ OK ] 0.22 sec.
2026-02-05 15:49:04 02225_hints_for_indeices: [ OK ] 1.07 sec.
2026-02-05 15:49:04 03005_input_function_in_join: [ OK ] 0.17 sec.
2026-02-05 15:49:04 02282_array_distance: [ OK ] 0.47 sec.
2026-02-05 15:49:04 00946_ml_test: [ OK ] 0.22 sec.
2026-02-05 15:49:04 02564_query_id_header: [ OK ] 0.72 sec.
2026-02-05 15:49:05 00612_http_max_query_size_for_distributed: [ OK ] 0.22 sec.
2026-02-05 15:49:05 01662_join_mixed: [ OK ] 0.17 sec.
2026-02-05 15:49:05 02887_byteswap: [ OK ] 0.37 sec.
2026-02-05 15:49:05 00926_geo_to_h3: [ OK ] 0.22 sec.
2026-02-05 15:49:05 03032_storage_memory_modify_settings: [ OK ] 0.37 sec.
2026-02-05 15:49:05 02723_jit_aggregation_bug_48120: [ OK ] 0.27 sec.
2026-02-05 15:49:05 01825_type_json_bools: [ OK ] 0.17 sec.
2026-02-05 15:49:05 01269_toStartOfSecond: [ OK ] 0.32 sec.
2026-02-05 15:49:05 01079_window_view_inner_table_memory_tumble: [ OK ] 1.22 sec.
2026-02-05 15:49:05 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.17 sec.
2026-02-05 15:49:06 02490_benchmark_max_consecutive_errors: [ OK ] 0.67 sec.
2026-02-05 15:49:06 02482_value_block_assert: [ OK ] 0.17 sec.
2026-02-05 15:49:06 03125_analyzer_CTE_two_joins: [ OK ] 0.17 sec.
2026-02-05 15:49:06 01291_geo_types: [ OK ] 0.17 sec.
2026-02-05 15:49:06 00481_create_view_for_null: [ OK ] 0.17 sec.
2026-02-05 15:49:06 02955_avro_format_zstd_encode_support: [ OK ] 0.27 sec.
2026-02-05 15:49:06 03173_parallel_replicas_join_bug: [ OK ] 0.77 sec.
2026-02-05 15:49:06 02998_projection_after_attach_partition: [ OK ] 0.22 sec.
2026-02-05 15:49:06 03004_json_named_tuples_inference_ambiguous_paths_as_string: [ OK ] 0.17 sec.
2026-02-05 15:49:06 00040_array_enumerate_uniq: [ OK ] 0.87 sec.
2026-02-05 15:49:06 02946_parallel_replicas_distributed: [ OK ] 0.22 sec.
2026-02-05 15:49:06 01663_test_toDate_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:49:06 01462_test_codec_on_alias: [ OK ] 0.17 sec.
2026-02-05 15:49:07 00537_quarters: [ OK ] 0.17 sec.
2026-02-05 15:49:07 00180_attach_materialized_view: [ OK ] 0.17 sec.
2026-02-05 15:49:07 01937_nested_chinese: [ OK ] 0.17 sec.
2026-02-05 15:49:07 02207_key_condition_floats: [ OK ] 0.22 sec.
2026-02-05 15:49:07 02552_inner_join_with_where_true: [ OK ] 0.22 sec.
2026-02-05 15:49:07 02149_schema_inference: [ OK ] 7.14 sec.
2026-02-05 15:49:07 01684_insert_specify_shard_id: [ OK ] 0.27 sec.
2026-02-05 15:49:07 00037_totals_limit: [ OK ] 0.17 sec.
2026-02-05 15:49:07 02131_skip_index_not_materialized: [ OK ] 0.22 sec.
2026-02-05 15:49:07 00142_parse_timestamp_as_datetime: [ OK ] 0.27 sec.
2026-02-05 15:49:08 02235_brotli_bug: [ OK ] 1.28 sec.
2026-02-05 15:49:08 02578_ipv4_codec_t64: [ OK ] 0.17 sec.
2026-02-05 15:49:09 02984_form_format: [ OK ] 1.17 sec.
2026-02-05 15:49:10 02783_date_predicate_optimizations: [ OK ] 0.93 sec.
2026-02-05 15:49:10 02047_log_family_data_file_sizes: [ OK ] 3.13 sec.
2026-02-05 15:49:10 02896_illegal_sampling: [ OK ] 0.17 sec.
2026-02-05 15:49:10 01603_read_with_backoff_bug: [ OK ] 15.21 sec.
2026-02-05 15:49:11 03039_dynamic_replacing_merge_tree: [ OK ] 4.89 sec.
2026-02-05 15:49:12 01276_random_string: [ OK ] 1.12 sec.
2026-02-05 15:49:12 03041_dynamic_type_check_table: [ OK ] 4.03 sec.
2026-02-05 15:49:12 00818_join_bug_4271: [ OK ] 0.33 sec.
2026-02-05 15:49:12 00470_identifiers_in_double_quotes: [ OK ] 0.23 sec.
2026-02-05 15:49:12 01346_array_join_mrxotey: [ OK ] 0.28 sec.
2026-02-05 15:49:12 00194_identity: [ OK ] 0.22 sec.
2026-02-05 15:49:12 01623_byte_size_const: [ OK ] 0.17 sec.
2026-02-05 15:49:12 02553_type_json_attach_partition: [ OK ] 0.22 sec.
2026-02-05 15:49:12 01825_new_type_json_6: [ OK ] 1.73 sec.
2026-02-05 15:49:12 01825_new_type_json_mutations: [ OK ] 0.32 sec.
2026-02-05 15:49:12 02963_remote_read_small_buffer_size_bug: [ OK ] 4.69 sec.
2026-02-05 15:49:12 02998_attach_partition_not_allowed_if_structure_differs_due_to_materialized_column: [ OK ] 0.22 sec.
2026-02-05 15:49:12 02514_tsv_zero_started_number: [ OK ] 0.17 sec.
2026-02-05 15:49:12 02874_infer_objects_as_named_tuples: [ OK ] 0.17 sec.
2026-02-05 15:49:12 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.22 sec.
2026-02-05 15:49:13 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.17 sec.
2026-02-05 15:49:13 03001_consider_lwd_when_merge: [ OK ] 0.27 sec.
2026-02-05 15:49:13 02324_map_combinator_bug: [ OK ] 0.27 sec.
2026-02-05 15:49:13 01533_quantile_deterministic_assert: [ OK ] 0.17 sec.
2026-02-05 15:49:13 01225_drop_dictionary_as_table: [ OK ] 0.17 sec.
2026-02-05 15:49:13 02495_parser_string_binary_literal: [ OK ] 1.02 sec.
2026-02-05 15:49:13 02515_tuple_lambda_parsing: [ OK ] 0.17 sec.
2026-02-05 15:49:14 02481_parquet_int_list_multiple_chunks: [ OK ] 1.37 sec.
2026-02-05 15:49:14 00926_adaptive_index_granularity_pk: [ OK ] 0.62 sec.
2026-02-05 15:49:14 00579_virtual_column_and_lazy: [ OK ] 0.32 sec.
2026-02-05 15:49:14 03169_modify_column_data_loss: [ OK ] 0.22 sec.
2026-02-05 15:49:14 01559_misplaced_codec_diagnostics: [ OK ] 0.12 sec.
2026-02-05 15:49:14 02907_backup_mv_with_no_source_table: [ OK ] 1.78 sec.
2026-02-05 15:49:14 01032_cityHash64_for_UUID: [ OK ] 0.27 sec.
2026-02-05 15:49:14 02136_scalar_read_rows_json: [ OK ] 0.67 sec.
2026-02-05 15:49:15 02366_cancel_write_into_file: [ OK ] 4.63 sec.
2026-02-05 15:49:15 00410_aggregation_combinators_with_arenas: [ OK ] 0.92 sec.
2026-02-05 15:49:15 00596_limit_on_expanded_ast: [ OK ] 0.62 sec.
2026-02-05 15:49:15 01070_h3_to_parent: [ OK ] 0.17 sec.
2026-02-05 15:49:16 01745_alter_delete_view: [ OK ] 0.28 sec.
2026-02-05 15:49:16 02932_idna: [ OK ] 0.74 sec.
2026-02-05 15:49:16 03102_prefer_column_name_to_alias: [ OK ] 0.22 sec.
2026-02-05 15:49:16 00388_enum_with_totals: [ OK ] 0.17 sec.
2026-02-05 15:49:16 00343_array_element_generic: [ OK ] 0.22 sec.
2026-02-05 15:49:16 01015_attach_part: [ OK ] 0.22 sec.
2026-02-05 15:49:16 03036_test_parquet_bloom_filter_push_down_ipv6: [ OK ] 1.52 sec.
2026-02-05 15:49:16 00427_alter_primary_key: [ OK ] 1.93 sec.
2026-02-05 15:49:16 02916_csv_infer_numbers_from_strings: [ OK ] 0.17 sec.
2026-02-05 15:49:16 01720_engine_file_empty_if_not_exists: [ OK ] 0.17 sec.
2026-02-05 15:49:16 00181_aggregate_functions_statistics_stable: [ OK ] 0.37 sec.
2026-02-05 15:49:17 02591_bson_long_tuple: [ OK ] 0.12 sec.
2026-02-05 15:49:17 01663_quantile_weighted_overflow: [ OK ] 0.18 sec.
2026-02-05 15:49:17 01324_if_transform_strings_to_enum: [ OK ] 0.17 sec.
2026-02-05 15:49:17 00532_topk_generic: [ OK ] 0.17 sec.
2026-02-05 15:49:17 02046_low_cardinality_parallel_group_by: [ OK ] 3.03 sec.
2026-02-05 15:49:17 01626_cnf_test: [ OK ] 0.17 sec.
2026-02-05 15:49:17 01109_sc0rp10_string_hash_map_zero_bytes: [ OK ] 0.17 sec.
2026-02-05 15:49:17 03164_create_as_default: [ OK ] 0.22 sec.
2026-02-05 15:49:17 03240_insert_select_named_tuple: [ OK ] 0.22 sec.
2026-02-05 15:49:17 03147_datetime64_constant_index_analysis: [ OK ] 0.22 sec.
2026-02-05 15:49:17 02734_big_int_from_float_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:49:17 02121_pager: [ OK ] 0.67 sec.
2026-02-05 15:49:18 01223_dist_on_dist: [ OK ] 0.62 sec.
2026-02-05 15:49:18 01296_codecs_bad_arguments: [ OK ] 0.22 sec.
2026-02-05 15:49:18 01158_zookeeper_log_long: [ OK ] 1.12 sec.
2026-02-05 15:49:18 01018_insert_multiple_blocks_with_defaults: [ OK ] 0.92 sec.
2026-02-05 15:49:18 02014_dict_get_nullable_key: [ OK ] 0.27 sec.
2026-02-05 15:49:18 01883_subcolumns_distributed: [ OK ] 0.27 sec.
2026-02-05 15:49:18 00604_shard_remote_and_columns_with_defaults: [ OK ] 0.37 sec.
2026-02-05 15:49:18 03151_external_cross_join: [ OK ] 1.22 sec.
2026-02-05 15:49:19 02868_distinct_to_count_optimization: [ OK ] 0.32 sec.
2026-02-05 15:49:19 00937_test_use_header_tsv: [ OK ] 2.27 sec.
2026-02-05 15:49:19 03204_index_hint_fuzzer: [ OK ] 0.17 sec.
2026-02-05 15:49:19 00138_table_aliases: [ OK ] 0.17 sec.
2026-02-05 15:49:19 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.32 sec.
2026-02-05 15:49:19 00800_function_java_hash_with_unsigined_types: [ OK ] 0.97 sec.
2026-02-05 15:49:19 01188_attach_table_from_path: [ OK ] 0.22 sec.
2026-02-05 15:49:20 00080_show_tables_and_system_tables: [ OK ] 0.32 sec.
2026-02-05 15:49:20 01518_cast_nullable_virtual_system_column: [ OK ] 0.17 sec.
2026-02-05 15:49:20 01957_heredoc_more: [ OK ] 0.12 sec.
2026-02-05 15:49:20 01710_minmax_count_projection: [ OK ] 0.62 sec.
2026-02-05 15:49:20 00953_constraints_operations: [ OK ] 1.82 sec.
2026-02-05 15:49:20 00879_cast_to_decimal_crash: [ OK ] 0.17 sec.
2026-02-05 15:49:20 02351_Map_combinator_dist: [ OK ] 0.27 sec.
2026-02-05 15:49:20 02487_create_index_normalize_functions: [ OK ] 0.17 sec.
2026-02-05 15:49:21 01009_insert_select_data_loss: [ OK ] 0.22 sec.
2026-02-05 15:49:21 00687_top_and_offset: [ OK ] 2.48 sec.
2026-02-05 15:49:21 00505_shard_secure: [ OK ] 1.32 sec.
2026-02-05 15:49:21 02842_vertical_merge_after_add_drop_column: [ OK ] 0.17 sec.
2026-02-05 15:49:21 02293_h3_distance: [ OK ] 0.32 sec.
2026-02-05 15:49:21 02955_analyzer_using_functional_args: [ OK ] 0.67 sec.
2026-02-05 15:49:21 01678_great_circle_angle: [ OK ] 0.17 sec.
2026-02-05 15:49:21 01559_aggregate_null_for_empty_fix: [ OK ] 0.27 sec.
2026-02-05 15:49:21 02479_analyzer_join_with_constants: [ OK ] 0.17 sec.
2026-02-05 15:49:21 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.12 sec.
2026-02-05 15:49:21 01160_table_dependencies: [ OK ] 7.99 sec.
2026-02-05 15:49:21 01585_fuzz_bits_with_bugfix: [ OK ] 0.17 sec.
2026-02-05 15:49:21 01582_distinct_subquery_groupby: [ OK ] 0.22 sec.
2026-02-05 15:49:21 00557_alter_null_storage_tables: [ OK ] 0.22 sec.
2026-02-05 15:49:21 00555_hasAll_hasAny: [ OK ] 0.32 sec.
2026-02-05 15:49:21 03010_view_prewhere_in: [ OK ] 0.17 sec.
2026-02-05 15:49:21 01142_with_ties_and_aliases: [ OK ] 0.22 sec.
2026-02-05 15:49:22 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.17 sec.
2026-02-05 15:49:22 02206_minimum_sample_size: [ OK ] 0.22 sec.
2026-02-05 15:49:22 03010_read_system_parts_table_test: [ OK ] 0.22 sec.
2026-02-05 15:49:22 02861_replacing_merge_tree_with_cleanup: [ OK ] 0.22 sec.
2026-02-05 15:49:22 00450_higher_order_and_nullable: [ OK ] 0.17 sec.
2026-02-05 15:49:22 02022_storage_filelog_one_file: [ OK ] 1.27 sec.
2026-02-05 15:49:22 01016_macros: [ OK ] 0.17 sec.
2026-02-05 15:49:22 01925_test_group_by_const_consistency: [ OK ] 0.22 sec.
2026-02-05 15:49:22 00583_limit_by_expressions: [ OK ] 0.22 sec.
2026-02-05 15:49:22 02460_prewhere_row_level_policy: [ OK ] 0.17 sec.
2026-02-05 15:49:22 01381_for_each_with_states: [ OK ] 0.22 sec.
2026-02-05 15:49:22 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 0.82 sec.
2026-02-05 15:49:23 02136_scalar_subquery_metrics: [ OK ] 0.43 sec.
2026-02-05 15:49:23 02481_pk_analysis_with_enum_to_string: [ OK ] 0.27 sec.
2026-02-05 15:49:23 02163_shard_num: [ OK ] 0.22 sec.
2026-02-05 15:49:23 03033_from_unixtimestamp_joda_by_int64: [ OK ] 0.12 sec.
2026-02-05 15:49:23 00392_enum_nested_alter: [ OK ] 0.32 sec.
2026-02-05 15:49:23 01093_cyclic_defaults_filimonov: [ OK ] 0.17 sec.
2026-02-05 15:49:23 02689_meaningless_data_types: [ OK ] 0.22 sec.
2026-02-05 15:49:23 02859_replicated_db_name_zookeeper: [ OK ] 1.27 sec.
2026-02-05 15:49:24 00099_join_many_blocks_segfault: [ OK ] 0.12 sec.
2026-02-05 15:49:24 01710_projections_in_distributed_query: [ OK ] 0.22 sec.
2026-02-05 15:49:24 02668_column_block_number_with_projections: [ OK ] 0.22 sec.
2026-02-05 15:49:24 01507_multiversion_storage_for_storagememory: [ OK ] 0.22 sec.
2026-02-05 15:49:24 02101_empty_as_default_and_omitted_fields: [ OK ] 2.93 sec.
2026-02-05 15:49:24 00794_materialized_view_with_column_defaults: [ OK ] 0.22 sec.
2026-02-05 15:49:24 00364_java_style_denormals: [ OK ] 0.22 sec.
2026-02-05 15:49:24 02559_nested_multiple_levels_default: [ OK ] 0.17 sec.
2026-02-05 15:49:25 01592_toUnixTimestamp_Date: [ OK ] 0.17 sec.
2026-02-05 15:49:25 00937_format_schema_rows_template: [ OK ] 1.27 sec.
2026-02-05 15:49:25 02461_alter_update_respect_part_column_type_bug: [ OK ] 2.73 sec.
2026-02-05 15:49:25 02452_check_low_cardinality: [ OK ] 0.27 sec.
2026-02-05 15:49:25 01064_array_auc: [ OK ] 0.22 sec.
2026-02-05 15:49:25 01888_read_int_safe: [ OK ] 0.27 sec.
2026-02-05 15:49:25 02307_join_get_array_null: [ OK ] 0.17 sec.
2026-02-05 15:49:25 01293_external_sorting_limit_bug: [ OK ] 0.17 sec.
2026-02-05 15:49:25 00979_yandex_consistent_hash_fpe: [ OK ] 0.17 sec.
2026-02-05 15:49:25 00416_pocopatch_progress_in_http_headers: [ OK ] 0.57 sec.
2026-02-05 15:49:26 02482_insert_into_dist_race: [ OK ] 0.22 sec.
2026-02-05 15:49:26 01318_map_add_map_subtract: [ OK ] 0.37 sec.
2026-02-05 15:49:26 02899_indexing_by_space_filling_curves: [ OK ] 0.42 sec.
2026-02-05 15:49:26 00411_long_accurate_number_comparison_float: [ OK ] 1.59 sec.
2026-02-05 15:49:26 02564_date_format: [ OK ] 0.22 sec.
2026-02-05 15:49:26 02421_formats_with_totals_and_extremes: [ OK ] 0.27 sec.
2026-02-05 15:49:27 02950_obfuscator_keywords_more: [ OK ] 0.42 sec.
2026-02-05 15:49:27 01611_constant_folding_subqueries: [ OK ] 0.17 sec.
2026-02-05 15:49:28 00900_orc_load: [ OK ] 1.47 sec.
2026-02-05 15:49:29 02500_bson_read_object_id: [ OK ] 0.57 sec.
2026-02-05 15:49:29 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.22 sec.
2026-02-05 15:49:29 03045_analyzer_alias_join_with_if: [ OK ] 0.17 sec.
2026-02-05 15:49:30 00553_buff_exists_materlized_column: [ OK ] 0.27 sec.
2026-02-05 15:49:30 02313_negative_datetime64: [ OK ] 0.17 sec.
2026-02-05 15:49:30 01460_line_as_string_format: [ OK ] 3.88 sec.
2026-02-05 15:49:30 01698_map_populate_overflow: [ OK ] 0.22 sec.
2026-02-05 15:49:30 00674_has_array_enum: [ OK ] 0.17 sec.
2026-02-05 15:49:30 01567_system_processes_current_database: [ OK ] 0.17 sec.
2026-02-05 15:49:31 00808_not_optimize_predicate: [ OK ] 0.32 sec.
2026-02-05 15:49:31 03213_deep_json: [ OK ] 0.22 sec.
2026-02-05 15:49:31 02366_kql_tabular: [ OK ] 0.37 sec.
2026-02-05 15:49:31 01114_database_atomic: [ OK ] 47.30 sec.
2026-02-05 15:49:31 02789_jit_cannot_convert_column: [ OK ] 0.12 sec.
2026-02-05 15:49:32 02293_h3_line: [ OK ] 0.27 sec.
2026-02-05 15:49:32 01098_msgpack_format: [ OK ] 6.48 sec.
2026-02-05 15:49:32 03073_analyzer_alias_as_column_name: [ OK ] 0.17 sec.
2026-02-05 15:49:33 02875_parallel_replicas_remote: [ OK ] 0.42 sec.
2026-02-05 15:49:33 02315_grouping_constant_folding: [ OK ] 0.27 sec.
2026-02-05 15:49:33 02346_fulltext_index_detach_attach: [ OK ] 0.22 sec.
2026-02-05 15:49:34 01881_union_header_mismatch_bug: [ OK ] 0.22 sec.
2026-02-05 15:49:34 01801_s3_cluster_count: [ OK ] 0.22 sec.
2026-02-05 15:49:34 02893_vertical_final_bugs: [ OK ] 0.23 sec.
2026-02-05 15:49:35 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.57 sec.
2026-02-05 15:49:35 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.27 sec.
2026-02-05 15:49:35 02872_prewhere_filter: [ OK ] 0.17 sec.
2026-02-05 15:49:36 02473_multistep_split_prewhere: [ OK ] 13.00 sec.
2026-02-05 15:49:36 01730_distributed_group_by_no_merge_order_by_long: [ OK ] 1.12 sec.
2026-02-05 15:49:36 02797_transform_narrow_types: [ OK ] 0.17 sec.
2026-02-05 15:49:37 00204_extract_url_parameter: [ OK ] 0.22 sec.
2026-02-05 15:49:37 02160_h3_cell_area_rads2: [ OK ] 0.17 sec.
2026-02-05 15:49:38 00133_long_shard_memory_tracker_and_exception_safety: [ OK ] 6.19 sec.
2026-02-05 15:49:38 00097_long_storage_buffer_race_condition: [ OK ] 16.32 sec.
2026-02-05 15:49:38 02421_type_json_async_insert: [ OK ] 1.27 sec.
2026-02-05 15:49:38 02998_native_parquet_reader: [ OK ] 0.52 sec.
2026-02-05 15:49:38 00030_alter_table: [ OK ] 0.27 sec.
2026-02-05 15:49:38 01655_plan_optimizations: [ OK ] 6.74 sec.
2026-02-05 15:49:38 00056_join_number_string: [ OK ] 0.12 sec.
2026-02-05 15:49:38 00105_shard_collations: [ OK ] 0.22 sec.
2026-02-05 15:49:39 03040_array_sum_and_join: [ OK ] 0.17 sec.
2026-02-05 15:49:39 03161_cnf_reduction: [ OK ] 0.27 sec.
2026-02-05 15:49:39 02889_file_log_save_errors: [ OK ] 2.37 sec.
2026-02-05 15:49:40 02539_settings_alias: [ OK ] 1.72 sec.
2026-02-05 15:49:41 00975_indices_mutation_replicated_zookeeper_long: [ OK ] 2.23 sec.
2026-02-05 15:49:41 02124_insert_deduplication_token_multiple_blocks: [ OK ] 2.12 sec.
2026-02-05 15:49:41 01943_non_deterministic_order_key: [ OK ] 0.12 sec.
2026-02-05 15:49:41 01881_to_week_monotonic_fix: [ OK ] 0.22 sec.
2026-02-05 15:49:41 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.42 sec.
2026-02-05 15:49:41 00113_shard_group_array: [ OK ] 3.08 sec.
2026-02-05 15:49:41 00492_drop_temporary_table: [ OK ] 0.17 sec.
2026-02-05 15:49:41 01272_totals_and_filter_bug: [ OK ] 0.22 sec.
2026-02-05 15:49:41 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.17 sec.
2026-02-05 15:49:41 01661_join_complex: [ OK ] 0.32 sec.
2026-02-05 15:49:42 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.32 sec.
2026-02-05 15:49:42 02403_arrow_large_string: [ OK ] 0.58 sec.
2026-02-05 15:49:42 03203_grpc_protocol: [ OK ] 0.82 sec.
2026-02-05 15:49:42 01600_encode_XML: [ OK ] 0.17 sec.
2026-02-05 15:49:42 02916_analyzer_set_in_join: [ OK ] 0.17 sec.
2026-02-05 15:49:42 01516_date_time_output_format: [ OK ] 0.22 sec.
2026-02-05 15:49:42 03038_nested_dynamic_merges_small: [ OK ] 0.97 sec.
2026-02-05 15:49:42 02392_every_setting_must_have_documentation: [ OK ] 0.17 sec.
2026-02-05 15:49:42 02226_in_untuple_issue_34810: [ OK ] 0.17 sec.
2026-02-05 15:49:42 01031_semi_anti_join: [ OK ] 0.17 sec.
2026-02-05 15:49:43 01213_alter_rename_compact_part: [ OK ] 0.22 sec.
2026-02-05 15:49:43 01825_type_json_partitions: [ OK ] 0.17 sec.
2026-02-05 15:49:43 02998_system_dns_cache_table: [ OK ] 0.17 sec.
2026-02-05 15:49:43 01163_search_case_insensetive_utf8: [ OK ] 0.17 sec.
2026-02-05 15:49:43 00584_view_union_all: [ OK ] 0.22 sec.
2026-02-05 15:49:43 02900_union_schema_inference_mode: [ OK ] 1.48 sec.
2026-02-05 15:49:43 01483_merge_table_join_and_group_by: [ OK ] 0.32 sec.
2026-02-05 15:49:43 03174_projection_deduplicate: [ OK ] 0.22 sec.
2026-02-05 15:49:43 02122_parallel_formatting_JSONCompactStringsEachRowWithNamesAndTypes: [ OK ] 1.43 sec.
2026-02-05 15:49:44 02377_executable_function_settings: [ OK ] 0.22 sec.
2026-02-05 15:49:44 01670_log_comment: [ OK ] 0.47 sec.
2026-02-05 15:49:44 02122_join_group_by_timeout: [ OK ] 5.18 sec.
2026-02-05 15:49:44 00953_zookeeper_suetin_deduplication_bug: [ OK ] 14.06 sec.
2026-02-05 15:49:44 02525_different_engines_in_temporary_tables: [ OK ] 0.27 sec.
2026-02-05 15:49:44 02026_accurate_cast_or_default: [ OK ] 0.32 sec.
2026-02-05 15:49:45 02112_with_fill_interval: [ OK ] 0.37 sec.
2026-02-05 15:49:45 00930_max_partitions_per_insert_block: [ OK ] 0.47 sec.
2026-02-05 15:49:45 01825_new_type_json_8: [ OK ] 1.67 sec.
2026-02-05 15:49:45 02022_bzip2_truncated: [ OK ] 1.32 sec.
2026-02-05 15:49:45 02264_format_insert_compression: [ OK ] 0.17 sec.
2026-02-05 15:49:45 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 0.52 sec.
2026-02-05 15:49:46 01818_input_format_with_names_use_header: [ OK ] 0.97 sec.
2026-02-05 15:49:46 01268_mergine_sorted_limit: [ OK ] 0.17 sec.
2026-02-05 15:49:46 02813_create_index_noop: [ OK ] 1.83 sec.
2026-02-05 15:49:46 02360_send_logs_level_colors: [ OK ] 0.77 sec.
2026-02-05 15:49:46 02679_query_parameters_dangling_pointer: [ OK ] 0.17 sec.
2026-02-05 15:49:47 00981_in_subquery_with_tuple: [ OK ] 1.72 sec.
2026-02-05 15:49:47 00829_bitmap64_function: [ OK ] 0.27 sec.
2026-02-05 15:49:47 02426_to_string_nullable_fixedstring: [ OK ] 0.17 sec.
2026-02-05 15:49:47 02981_nested_bad_types: [ OK ] 0.67 sec.
2026-02-05 15:49:47 02126_alter_table_alter_column: [ OK ] 0.17 sec.
2026-02-05 15:49:48 03208_array_of_json_read_subcolumns_2_memory: [ OK ] 22.50 sec.
2026-02-05 15:49:49 00348_tuples: [ OK ] 0.28 sec.
2026-02-05 15:49:49 02887_tuple_element_distributed: [ OK ] 0.22 sec.
2026-02-05 15:49:49 00954_client_prepared_statements: [ OK ] 2.48 sec.
2026-02-05 15:49:49 02892_rocksdb_trivial_count: [ OK ] 0.22 sec.
2026-02-05 15:49:49 02155_nested_lc_defalut_bug: [ OK ] 0.17 sec.
2026-02-05 15:49:49 00534_functions_bad_arguments4_long: [ OK ] 4.58 sec.
2026-02-05 15:49:49 01710_minmax_count_projection_constant_query: [ OK ] 0.17 sec.
2026-02-05 15:49:49 02269_create_table_with_collation: [ OK ] 0.17 sec.
2026-02-05 15:49:49 00667_compare_arrays_of_different_types: [ OK ] 0.12 sec.
2026-02-05 15:49:50 02408_to_fixed_string_short_circuit: [ OK ] 0.17 sec.
2026-02-05 15:49:50 02001_dist_on_dist_WithMergeableStateAfterAggregation: [ OK ] 0.22 sec.
2026-02-05 15:49:50 02421_simple_queries_for_opentelemetry: [ OK ] 2.33 sec.
2026-02-05 15:49:50 00944_create_bloom_filter_index_with_merge_tree: [ OK ] 2.48 sec.
2026-02-05 15:49:50 00344_row_number_in_all_blocks: [ OK ] 0.17 sec.
2026-02-05 15:49:50 02423_ddl_for_opentelemetry: [ OK ] 4.03 sec.
2026-02-05 15:49:50 02941_variant_type_3: [ OK ] 6.59 sec.
2026-02-05 15:49:50 00969_roundDuration: [ OK ] 0.22 sec.
2026-02-05 15:49:50 03215_analyzer_replace_with_dummy_tables: [ OK ] 0.12 sec.
2026-02-05 15:49:50 03217_filtering_in_system_tables: [ OK ] 0.22 sec.
2026-02-05 15:49:50 00725_join_on_bug_1: [ OK ] 0.22 sec.
2026-02-05 15:49:50 01306_polygons_intersection: [ OK ] 0.22 sec.
2026-02-05 15:49:50 00060_date_lut: [ OK ] 0.22 sec.
2026-02-05 15:49:50 02247_fix_extract_parser: [ OK ] 0.17 sec.
2026-02-05 15:49:50 00500_point_in_polygon: [ OK ] 0.27 sec.
2026-02-05 15:49:50 02377_analyzer_in_function_set: [ OK ] 0.22 sec.
2026-02-05 15:49:50 02681_comparsion_tuple_elimination_ast: [ OK ] 0.17 sec.
2026-02-05 15:49:50 02982_dont_infer_exponent_floats: [ OK ] 0.17 sec.
2026-02-05 15:49:50 02162_range_hashed_dictionary_ddl_expression: [ OK ] 0.17 sec.
2026-02-05 15:49:50 00061_merge_tree_alter: [ OK ] 0.38 sec.
2026-02-05 15:49:50 02513_validate_data_types: [ OK ] 0.27 sec.
2026-02-05 15:49:51 01247_least_greatest_filimonov: [ OK ] 0.12 sec.
2026-02-05 15:49:51 01289_min_execution_speed_not_too_early: [ OK ] 0.67 sec.
2026-02-05 15:49:51 01601_temporary_table_session_scope: [ OK ] 0.52 sec.
2026-02-05 15:49:51 02922_url_s3_engine_size_virtual_column: [ OK ] 0.98 sec.
2026-02-05 15:49:51 02904_arrow_dictionary_indexes: [ OK ] 1.62 sec.
2026-02-05 15:49:51 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.22 sec.
2026-02-05 15:49:52 00910_zookeeper_custom_compression_codecs_replicated_long: [ OK ] 0.77 sec.
2026-02-05 15:49:52 01685_ssd_cache_dictionary_complex_key: [ OK ] 0.77 sec.
2026-02-05 15:49:52 01080_join_get_null: [ OK ] 0.17 sec.
2026-02-05 15:49:52 02871_join_on_system_errors: [ OK ] 0.17 sec.
2026-02-05 15:49:52 03205_system_sync_replica_format: [ OK ] 0.17 sec.
2026-02-05 15:49:52 01761_alter_decimal_zookeeper_long: [ OK ] 0.32 sec.
2026-02-05 15:49:53 02560_with_fill_int256_int: [ OK ] 0.52 sec.
2026-02-05 15:49:53 02459_read_in_order_bufer: [ OK ] 0.17 sec.
2026-02-05 15:49:53 02267_file_globs_schema_inference: [ OK ] 1.68 sec.
2026-02-05 15:49:53 02227_union_match_by_name: [ OK ] 0.22 sec.
2026-02-05 15:49:54 00376_shard_group_uniq_array_of_int_array: [ OK ] 3.49 sec.
2026-02-05 15:49:54 01355_CSV_input_format_allow_errors: [ OK ] 1.32 sec.
2026-02-05 15:49:55 02125_lz4_compression_bug_JSONStringsEachRow: [ OK ] 4.13 sec.
2026-02-05 15:49:55 01945_system_warnings: [ OK ] 0.97 sec.
2026-02-05 15:49:55 00093_union_race_conditions_4: [ OK ] 1.83 sec.
2026-02-05 15:49:55 00310_tskv: [ OK ] 0.92 sec.
2026-02-05 15:49:55 02353_translate: [ OK ] 0.22 sec.
2026-02-05 15:49:55 03221_merge_profile_events: [ OK ] 0.62 sec.
2026-02-05 15:49:55 02972_parallel_replicas_cte: [ OK ] 0.33 sec.
2026-02-05 15:49:55 02509_h3_arguments: [ OK ] 0.22 sec.
2026-02-05 15:49:56 02864_test_ipv4_type_mismatch: [ OK ] 0.17 sec.
2026-02-05 15:49:56 02917_transform_tsan: [ OK ] 0.22 sec.
2026-02-05 15:49:56 00712_prewhere_with_missing_columns_2: [ OK ] 0.23 sec.
2026-02-05 15:49:56 01936_empty_function_support_uuid: [ OK ] 0.22 sec.
2026-02-05 15:49:56 00333_parser_number_bug: [ OK ] 0.17 sec.
2026-02-05 15:49:56 03038_recursive_cte_postgres_4: [ OK ] 0.22 sec.
2026-02-05 15:49:56 01086_window_view_cleanup: [ OK ] 3.79 sec.
2026-02-05 15:49:56 00593_union_all_assert_columns_removed: [ OK ] 0.17 sec.
2026-02-05 15:49:56 01234_to_string_monotonic: [ OK ] 0.27 sec.
2026-02-05 15:49:57 02861_interpolate_alias_precedence: [ OK ] 0.17 sec.
2026-02-05 15:49:57 02784_parallel_replicas_automatic_decision_join: [ OK ] 5.44 sec.
2026-02-05 15:49:57 02833_array_join_columns: [ OK ] 0.17 sec.
2026-02-05 15:49:57 02522_different_types_in_storage_merge: [ OK ] 0.17 sec.
2026-02-05 15:49:57 02406_minmax_behaviour: [ OK ] 0.72 sec.
2026-02-05 15:49:57 02381_client_prints_server_side_time: [ OK ] 1.32 sec.
2026-02-05 15:49:57 02704_keeper_map_zk_nodes: [ OK ] 2.63 sec.
2026-02-05 15:49:57 01576_alter_low_cardinality_and_select: [ OK ] 1.83 sec.
2026-02-05 15:49:58 02317_distinct_in_order_optimization_explain: [ OK ] 7.56 sec.
2026-02-05 15:49:58 03203_function_printf: [ OK ] 0.27 sec.
2026-02-05 15:49:58 02294_nothing_arguments_in_functions: [ OK ] 0.22 sec.
2026-02-05 15:49:58 03037_zero_step_in_numbers_table_function: [ OK ] 0.12 sec.
2026-02-05 15:49:58 01845_add_testcase_for_arrayElement: [ OK ] 0.17 sec.
2026-02-05 15:49:58 01390_check_table_codec: [ OK ] 0.22 sec.
2026-02-05 15:49:58 02113_untuple_func_alias: [ OK ] 0.17 sec.
2026-02-05 15:49:58 01293_client_interactive_vertical_singleline: [ OK ] 0.52 sec.
2026-02-05 15:49:58 00908_long_http_insert: [ OK ] 1.02 sec.
2026-02-05 15:49:59 03205_json_cast_from_string: [ OK ] 0.22 sec.
2026-02-05 15:49:59 02933_sqid: [ OK ] 1.32 sec.
2026-02-05 15:49:59 00550_join_insert_select: [ OK ] 0.67 sec.
2026-02-05 15:49:59 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.22 sec.
2026-02-05 15:49:59 01273_arrow_nested_arrays_load: [ OK ] 1.27 sec.
2026-02-05 15:49:59 03093_filter_push_down_crash: [ OK ] 0.17 sec.
2026-02-05 15:49:59 01185_create_or_replace_table: [ OK ] 0.22 sec.
2026-02-05 15:49:59 02807_default_date_time_nullable: [ OK ] 0.12 sec.
2026-02-05 15:49:59 02542_table_function_format: [ OK ] 0.17 sec.
2026-02-05 15:49:59 00764_max_query_size_allocation: [ OK ] 0.42 sec.
2026-02-05 15:49:59 01561_clickhouse_client_stage: [ OK ] 1.07 sec.
2026-02-05 15:49:59 01079_alter_default_zookeeper_long: [ OK ] 0.42 sec.
2026-02-05 15:49:59 02918_template_format_deadlock: [ OK ] 0.52 sec.
2026-02-05 15:49:59 03098_prefer_column_to_alias_subquery: [ OK ] 0.27 sec.
2026-02-05 15:49:59 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.37 sec.
2026-02-05 15:49:59 01461_alter_table_function: [ OK ] 0.22 sec.
2026-02-05 15:49:59 03101_analyzer_invalid_join_on: [ OK ] 0.17 sec.
2026-02-05 15:50:00 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 0.72 sec.
2026-02-05 15:50:00 00334_column_aggregate_function_limit: [ OK ] 0.23 sec.
2026-02-05 15:50:00 00628_in_lambda_on_merge_table_bug: [ OK ] 0.22 sec.
2026-02-05 15:50:00 02286_quantile_tdigest_infinity: [ OK ] 0.67 sec.
2026-02-05 15:50:00 01471_limit_by_format: [ OK ] 0.17 sec.
2026-02-05 15:50:00 02998_pretty_format_print_readable_number_on_single_value: [ OK ] 0.32 sec.
2026-02-05 15:50:00 02556_local_with_totals_and_extremes: [ OK ] 0.52 sec.
2026-02-05 15:50:00 01780_column_sparse: [ OK ] 0.27 sec.
2026-02-05 15:50:01 02454_set_parameters_formatting: [ OK ] 0.47 sec.
2026-02-05 15:50:01 02704_storage_merge_explain_graph_crash: [ OK ] 0.17 sec.
2026-02-05 15:50:01 02922_respect_nulls_states: [ OK ] 0.32 sec.
2026-02-05 15:50:01 02992_analyzer_group_by_const: [ OK ] 0.32 sec.
2026-02-05 15:50:02 02567_native_type_conversions: [ OK ] 0.97 sec.
2026-02-05 15:50:02 00949_format: [ OK ] 0.97 sec.
2026-02-05 15:50:02 02267_join_dup_columns_issue36199: [ OK ] 0.27 sec.
2026-02-05 15:50:02 01659_array_aggregation_ubsan: [ OK ] 0.12 sec.
2026-02-05 15:50:02 02367_analyzer_table_alias_columns: [ OK ] 0.22 sec.
2026-02-05 15:50:02 02125_lz4_compression_bug_JSONEachRow: [ OK ] 3.23 sec.
2026-02-05 15:50:02 01429_join_on_error_messages: [ OK ] 0.17 sec.
2026-02-05 15:50:02 00967_insert_into_distributed_different_types: [ OK ] 0.17 sec.
2026-02-05 15:50:03 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.17 sec.
2026-02-05 15:50:03 03036_reading_s3_archives: [ OK ] 0.57 sec.
2026-02-05 15:50:03 00908_bloom_filter_index: [ OK ] 6.99 sec.
2026-02-05 15:50:03 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.12 sec.
2026-02-05 15:50:03 02223_h3_test_const_columns: [ OK ] 0.32 sec.
2026-02-05 15:50:04 00738_lock_for_inner_table: [ OK ] 1.67 sec.
2026-02-05 15:50:04 03214_join_on_tuple_comparison_elimination_bug: [ OK ] 0.22 sec.
2026-02-05 15:50:05 03203_client_benchmark_options: [ OK ] 5.24 sec.
2026-02-05 15:50:05 02731_analyzer_join_resolve_nested: [ OK ] 1.52 sec.
2026-02-05 15:50:05 00420_null_in_scalar_subqueries: [ OK ] 0.17 sec.
2026-02-05 15:50:05 02125_lz4_compression_bug_Native: [ OK ] 2.58 sec.
2026-02-05 15:50:05 01825_type_json_16: [ OK ] 1.28 sec.
2026-02-05 15:50:05 02114_bool_type: [ OK ] 0.22 sec.
2026-02-05 15:50:06 01030_limit_by_with_ties_error: [ OK ] 0.87 sec.
2026-02-05 15:50:06 02830_insert_values_time_interval: [ OK ] 0.27 sec.
2026-02-05 15:50:06 02098_with_types_use_header: [ OK ] 2.73 sec.
2026-02-05 15:50:06 02419_keeper_map_primary_key: [ OK ] 0.92 sec.
2026-02-05 15:50:06 00749_inner_join_of_unnamed_subqueries: [ OK ] 0.22 sec.
2026-02-05 15:50:06 03196_local_memory_limit: [ OK ] 0.67 sec.
2026-02-05 15:50:07 03020_output_format_client: [ OK ] 1.22 sec.
2026-02-05 15:50:07 02737_session_timezone: [ OK ] 0.32 sec.
2026-02-05 15:50:07 01291_unsupported_conversion_from_decimal: [ OK ] 0.17 sec.
2026-02-05 15:50:08 02126_dist_desc: [ OK ] 1.02 sec.
2026-02-05 15:50:08 00759_kodieg: [ OK ] 0.17 sec.
2026-02-05 15:50:08 01651_lc_insert_tiny_log_2: [ OK ] 2.48 sec.
2026-02-05 15:50:08 00944_clear_index_in_partition: [ OK ] 1.77 sec.
2026-02-05 15:50:08 02561_null_as_default_more_formats: [ OK ] 7.29 sec.
2026-02-05 15:50:08 02035_isNull_isNotNull_format: [ OK ] 0.17 sec.
2026-02-05 15:50:08 00208_agg_state_merge: [ OK ] 0.17 sec.
2026-02-05 15:50:08 01355_ilike: [ OK ] 0.27 sec.
2026-02-05 15:50:08 01035_avg: [ OK ] 1.92 sec.
2026-02-05 15:50:08 03093_with_fill_support_constant_expression: [ OK ] 0.12 sec.
2026-02-05 15:50:08 01851_s2_to_geo: [ OK ] 0.17 sec.
2026-02-05 15:50:08 02414_all_new_table_functions_must_be_documented: [ OK ] 0.22 sec.
2026-02-05 15:50:09 01752_distributed_query_sigsegv: [ OK ] 0.17 sec.
2026-02-05 15:50:09 00976_system_stop_ttl_merges: [ OK ] 1.22 sec.
2026-02-05 15:50:09 01057_window_view_event_tumble_to_strict_asc: [ OK ] 1.12 sec.
2026-02-05 15:50:09 01651_lc_insert_tiny_log_1: [ OK ] 1.17 sec.
2026-02-05 15:50:09 02586_generate_random_structure: [ OK ] 0.27 sec.
2026-02-05 15:50:09 00449_filter_array_nullable_tuple: [ OK ] 0.22 sec.
2026-02-05 15:50:10 01643_merge_tree_fsync_smoke: [ OK ] 0.42 sec.
2026-02-05 15:50:12 03174_split_parts_ranges_into_intersecting_and_non_intersecting_final_and_read-in-order_bug: [ OK ] 3.08 sec.
2026-02-05 15:50:12 00377_shard_group_uniq_array_of_string_array: [ OK ] 3.59 sec.
2026-02-05 15:50:12 02881_system_detached_parts_modification_time: [ OK ] 0.17 sec.
2026-02-05 15:50:12 03120_analyzer_param_in_CTE_alias: [ OK ] 0.23 sec.
2026-02-05 15:50:12 01556_if_null: [ OK ] 0.17 sec.
2026-02-05 15:50:13 02968_file_log_multiple_read: [ OK ] 3.94 sec.
2026-02-05 15:50:13 00804_test_custom_compression_codecs: [ OK ] 0.62 sec.
2026-02-05 15:50:13 01271_optimize_arithmetic_operations_in_aggr_func_with_alias: [ OK ] 0.17 sec.
2026-02-05 15:50:13 01548_lzy305: [ OK ] 0.17 sec.
2026-02-05 15:50:13 01117_comma_and_others_join_mix: [ OK ] 0.17 sec.
2026-02-05 15:50:13 00547_named_tuples: [ OK ] 0.18 sec.
2026-02-05 15:50:13 00363_defaults: [ OK ] 0.17 sec.
2026-02-05 15:50:13 02835_drop_user_during_session: [ OK ] 4.18 sec.
2026-02-05 15:50:13 02973_parse_crlf_with_tsv_files: [ OK ] 0.72 sec.
2026-02-05 15:50:14 01325_freeze_mutation_stuck: [ OK ] 0.22 sec.
2026-02-05 15:50:14 01564_test_hint_woes: [ OK ] 0.22 sec.
2026-02-05 15:50:14 02995_index_4: [ OK ] 115.36 sec.
2026-02-05 15:50:14 02515_fix_any_parsing: [ OK ] 0.42 sec.
2026-02-05 15:50:14 00982_low_cardinality_setting_in_mv: [ OK ] 0.17 sec.
2026-02-05 15:50:14 02500_remove_redundant_distinct: [ OK ] 5.79 sec.
2026-02-05 15:50:14 01860_Distributed__shard_num_GROUP_BY: [ OK ] 0.22 sec.
2026-02-05 15:50:14 00986_materialized_view_stack_overflow: [ OK ] 0.42 sec.
2026-02-05 15:50:15 01313_parse_date_time_best_effort_null_zero: [ OK ] 0.22 sec.
2026-02-05 15:50:15 02490_replacing_merge_tree_is_deleted_column: [ OK ] 0.92 sec.
2026-02-05 15:50:15 01940_pad_string: [ OK ] 0.27 sec.
2026-02-05 15:50:15 02103_with_names_and_types_parallel_parsing: [ OK ] 2.43 sec.
2026-02-05 15:50:16 01198_client_quota_key: [ OK ] 0.67 sec.
2026-02-05 15:50:16 01710_normal_projection_fix1: [ OK ] 0.22 sec.
2026-02-05 15:50:16 02517_wrong_total_structure_crash: [ OK ] 0.22 sec.
2026-02-05 15:50:16 01507_transform_null_in: [ OK ] 0.17 sec.
2026-02-05 15:50:16 00047_stored_aggregates_complex: [ OK ] 0.22 sec.
2026-02-05 15:50:17 02232_allow_only_replicated_engine: [ OK ] 1.82 sec.
2026-02-05 15:50:17 02883_read_in_reverse_order_virtual_column: [ OK ] 0.62 sec.
2026-02-05 15:50:17 02864_statistics_bugs: [ OK ] 0.27 sec.
2026-02-05 15:50:17 00834_hints_for_type_function_typos: [ OK ] 2.98 sec.
2026-02-05 15:50:17 02575_merge_prewhere_different_default_kind: [ OK ] 0.22 sec.
2026-02-05 15:50:17 03205_parallel_replicas_alter_select_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:50:18 00214_primary_key_order: [ OK ] 0.17 sec.
2026-02-05 15:50:18 00534_client_ignore_error: [ OK ] 0.77 sec.
2026-02-05 15:50:18 00338_replicate_array_of_strings: [ OK ] 0.22 sec.
2026-02-05 15:50:18 01655_sleep_infinite_float: [ OK ] 0.17 sec.
2026-02-05 15:50:18 01938_joins_identifiers: [ OK ] 0.22 sec.
2026-02-05 15:50:18 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.27 sec.
2026-02-05 15:50:18 00566_enum_min_max: [ OK ] 0.17 sec.
2026-02-05 15:50:19 03006_async_insert_deadlock_log: [ OK ] 5.83 sec.
2026-02-05 15:50:19 02095_function_get_os_kernel_version: [ OK ] 0.12 sec.
2026-02-05 15:50:19 03034_dynamic_conversions: [ OK ] 0.32 sec.
2026-02-05 15:50:19 02122_parallel_formatting_JSONCompactStrings: [ OK ] 1.77 sec.
2026-02-05 15:50:19 00469_comparison_of_strings_containing_null_char: [ OK ] 0.22 sec.
2026-02-05 15:50:19 01034_values_parse_float_bug: [ OK ] 1.27 sec.
2026-02-05 15:50:19 01080_engine_merge_prewhere_tupleelement_error: [ OK ] 0.22 sec.
2026-02-05 15:50:20 02155_dictionary_comment: [ OK ] 0.32 sec.
2026-02-05 15:50:20 02573_insert_null_as_default_null_as_empty_nested: [ OK ] 0.27 sec.
2026-02-05 15:50:21 00186_very_long_arrays: [ OK ] 1.67 sec.
2026-02-05 15:50:21 01173_transaction_control_queries: [ OK ] 0.47 sec.
2026-02-05 15:50:21 02324_compatibility_setting: [ OK ] 1.52 sec.
2026-02-05 15:50:21 03210_empty_tuple_lhs_of_in: [ OK ] 0.12 sec.
2026-02-05 15:50:21 02790_url_multiple_tsv_files: [ OK ] 0.62 sec.
2026-02-05 15:50:22 03222_json_squashing: [ OK ] 0.77 sec.
2026-02-05 15:50:22 03033_lightweight_deletes_sync: [ OK ] 0.22 sec.
2026-02-05 15:50:22 02932_set_ttl_where: [ OK ] 3.63 sec.
2026-02-05 15:50:23 02337_multiple_joins_original_names: [ OK ] 0.17 sec.
2026-02-05 15:50:23 01388_clear_all_columns: [ OK ] 0.27 sec.
2026-02-05 15:50:23 02513_csv_bool_allow_crlf: [ OK ] 0.53 sec.
2026-02-05 15:50:23 00821_distributed_storage_with_join_on: [ OK ] 0.22 sec.
2026-02-05 15:50:23 01277_large_tuples: [ OK ] 0.22 sec.
2026-02-05 15:50:23 00811_garbage: [ OK ] 0.17 sec.
2026-02-05 15:50:24 02117_show_create_table_system: [ OK ] 0.32 sec.
2026-02-05 15:50:24 00898_parsing_bad_diagnostic_message: [ OK ] 0.62 sec.
2026-02-05 15:50:24 02702_allow_skip_errors_enum: [ OK ] 0.82 sec.
2026-02-05 15:50:24 01045_order_by_pk_special_storages: [ OK ] 3.63 sec.
2026-02-05 15:50:25 03034_normalized_ast: [ OK ] 0.17 sec.
2026-02-05 15:50:25 01444_create_table_drop_database_race: [ OK ] 10.49 sec.
2026-02-05 15:50:25 01825_type_json_3: [ OK ] 0.37 sec.
2026-02-05 15:50:25 01780_column_sparse_distinct: [ OK ] 0.17 sec.
2026-02-05 15:50:25 02554_format_json_columns_for_empty: [ OK ] 0.17 sec.
2026-02-05 15:50:25 02192_comment_error: [ OK ] 0.77 sec.
2026-02-05 15:50:25 01070_string_to_h3: [ OK ] 0.17 sec.
2026-02-05 15:50:25 00350_count_distinct: [ OK ] 0.17 sec.
2026-02-05 15:50:25 00032_fixed_string_to_string: [ OK ] 0.17 sec.
2026-02-05 15:50:25 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.52 sec.
2026-02-05 15:50:26 02428_delete_with_settings: [ OK ] 0.42 sec.
2026-02-05 15:50:26 00673_subquery_prepared_set_performance: [ OK ] 0.42 sec.
2026-02-05 15:50:26 03130_abs_in_key_condition_bug: [ OK ] 0.17 sec.
2026-02-05 15:50:26 00235_create_temporary_table_as: [ OK ] 0.17 sec.
2026-02-05 15:50:26 00700_decimal_compare: [ OK ] 0.42 sec.
2026-02-05 15:50:27 00418_input_format_allow_errors: [ OK ] 1.87 sec.
2026-02-05 15:50:27 01716_decimal_comparison_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:50:27 02844_max_backup_bandwidth_s3: [ OK ] 27.70 sec.
2026-02-05 15:50:27 01035_enum_conversion_native_format: [ OK ] 1.57 sec.
2026-02-05 15:50:28 01825_type_json_12: [ OK ] 1.17 sec.
2026-02-05 15:50:28 02995_index_8: [ OK ] 7.19 sec.
2026-02-05 15:50:28 02221_parallel_replicas_bug: [ OK ] 1.42 sec.
2026-02-05 15:50:28 02982_json_columns_with_metadata_http: [ OK ] 0.82 sec.
2026-02-05 15:50:28 02011_tuple_vector_functions: [ OK ] 0.62 sec.
2026-02-05 15:50:28 01710_order_by_projections_incomplete: [ OK ] 0.22 sec.
2026-02-05 15:50:28 03200_subcolumns_join_use_nulls: [ OK ] 0.17 sec.
2026-02-05 15:50:28 01825_new_type_json_in_array: [ OK ] 0.27 sec.
2026-02-05 15:50:28 02800_transform_alter: [ OK ] 0.22 sec.
2026-02-05 15:50:29 02841_local_assert: [ OK ] 0.67 sec.
2026-02-05 15:50:29 00405_pretty_formats: [ OK ] 0.22 sec.
2026-02-05 15:50:29 01508_query_obfuscator: [ OK ] 0.52 sec.
2026-02-05 15:50:29 02417_from_select_syntax: [ OK ] 0.17 sec.
2026-02-05 15:50:29 02267_output_format_prometheus: [ OK ] 0.17 sec.
2026-02-05 15:50:29 03000_too_big_max_execution_time_setting: [ OK ] 0.12 sec.
2026-02-05 15:50:29 02294_decimal_second_errors: [ OK ] 0.17 sec.
2026-02-05 15:50:30 01019_alter_materialized_view_atomic: [ OK ] 14.01 sec.
2026-02-05 15:50:30 02662_sparse_columns_mutations_4: [ OK ] 0.22 sec.
2026-02-05 15:50:30 00753_alter_attach: [ OK ] 0.82 sec.
2026-02-05 15:50:30 02201_use_skip_indexes_if_final: [ OK ] 0.22 sec.
2026-02-05 15:50:30 03144_compress_stdout: [ OK ] 0.62 sec.
2026-02-05 15:50:30 01170_alter_partition_isolation: [ OK ] 2.53 sec.
2026-02-05 15:50:30 02503_bad_compatibility_setting: [ OK ] 0.17 sec.
2026-02-05 15:50:30 03003_enum_and_string_compatible: [ OK ] 0.17 sec.
2026-02-05 15:50:31 01657_array_element_ubsan: [ OK ] 0.22 sec.
2026-02-05 15:50:31 00698_validate_array_sizes_for_nested: [ OK ] 0.22 sec.
2026-02-05 15:50:31 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.17 sec.
2026-02-05 15:50:31 03271_decimal_monotonic_day_of_week: [ OK ] 0.17 sec.
2026-02-05 15:50:31 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.17 sec.
2026-02-05 15:50:31 01533_collate_in_nullable: [ OK ] 0.22 sec.
2026-02-05 15:50:31 00049_any_left_join: [ OK ] 0.12 sec.
2026-02-05 15:50:31 00189_time_zones_long: [ OK ] 1.32 sec.
2026-02-05 15:50:31 01026_char_utf8: [ OK ] 0.17 sec.
2026-02-05 15:50:31 01523_interval_operator_support_string_literal: [ OK ] 0.17 sec.
2026-02-05 15:50:31 01543_collate_in_tuple: [ OK ] 0.22 sec.
2026-02-05 15:50:31 01811_datename: [ OK ] 0.22 sec.
2026-02-05 15:50:31 02381_parse_array_of_tuples: [ OK ] 0.17 sec.
2026-02-05 15:50:31 02786_transform_float: [ OK ] 0.12 sec.
2026-02-05 15:50:31 02354_vector_search_unquoted_index_parameters: [ OK ] 0.22 sec.
2026-02-05 15:50:31 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.17 sec.
2026-02-05 15:50:32 01016_simhash_minhash: [ OK ] 0.47 sec.
2026-02-05 15:50:32 02946_materialize_column_must_not_override_past_values: [ OK ] 0.47 sec.
2026-02-05 15:50:33 01825_type_json_15: [ OK ] 1.22 sec.
2026-02-05 15:50:33 02933_replicated_database_forbid_create_as_select: [ OK ] 1.82 sec.
2026-02-05 15:50:33 02880_indexHint__partition_id: [ OK ] 0.22 sec.
2026-02-05 15:50:34 01773_min_max_time_system_parts_datetime64: [ OK ] 0.22 sec.
2026-02-05 15:50:34 01784_parallel_formatting_memory: [ OK ] 0.22 sec.
2026-02-05 15:50:34 01043_h3_edge_length_m: [ OK ] 0.17 sec.
2026-02-05 15:50:34 00059_shard_global_in: [ OK ] 0.17 sec.
2026-02-05 15:50:34 02763_row_policy_storage_merge_alias: [ OK ] 0.32 sec.
2026-02-05 15:50:34 02420_final_setting: [ OK ] 0.52 sec.
2026-02-05 15:50:35 03037_s3_write_to_globbed_partitioned_path: [ OK ] 0.13 sec.
2026-02-05 15:50:35 01942_snowflakeIDToDateTime: [ OK ] 0.42 sec.
2026-02-05 15:50:35 00396_uuid: [ OK ] 0.22 sec.
2026-02-05 15:50:35 03209_json_type_vertical_merges: [ OK ] 6.69 sec.
2026-02-05 15:50:35 02200_use_skip_indexes: [ OK ] 0.22 sec.
2026-02-05 15:50:35 00111_shard_external_sort_distributed: [ OK ] 3.78 sec.
2026-02-05 15:50:35 02181_format_describe_query: [ OK ] 0.47 sec.
2026-02-05 15:50:36 01927_query_views_log_current_database: [ OK ] 0.62 sec.
2026-02-05 15:50:36 02016_bit_shift_right_for_string_integer: [ OK ] 0.62 sec.
2026-02-05 15:50:36 01852_cast_operator_2: [ OK ] 0.17 sec.
2026-02-05 15:50:36 01030_final_mark_empty_primary_key: [ OK ] 0.22 sec.
2026-02-05 15:50:40 02122_parallel_formatting_RowBinaryWithNamesAndTypes: [ OK ] 5.43 sec.
2026-02-05 15:50:40 01890_materialized_distributed_join: [ OK ] 4.68 sec.
2026-02-05 15:50:40 00913_many_threads: [ OK ] 4.83 sec.
2026-02-05 15:50:40 02287_type_object_convert: [ OK ] 4.59 sec.
2026-02-05 15:50:41 02575_merge_prewhere_materialized: [ OK ] 0.22 sec.
2026-02-05 15:50:41 01521_distributed_query_hang: [ OK ] 0.17 sec.
2026-02-05 15:50:41 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.17 sec.
2026-02-05 15:50:41 02416_grouping_function_compatibility: [ OK ] 0.22 sec.
2026-02-05 15:50:41 02595_orc_arrow_parquet_more_types: [ OK ] 0.97 sec.
2026-02-05 15:50:41 01825_type_json_describe: [ OK ] 0.22 sec.
2026-02-05 15:50:42 03150_trace_log_add_build_id: [ OK ] 1.22 sec.
2026-02-05 15:50:42 03143_group_by_constant_secondary: [ OK ] 0.17 sec.
2026-02-05 15:50:42 00875_join_right_nulls: [ OK ] 0.32 sec.
2026-02-05 15:50:42 00092_union_race_conditions_3: [ OK ] 14.36 sec.
2026-02-05 15:50:42 01327_decimal_cut_extra_digits_after_point: [ OK ] 0.22 sec.
2026-02-05 15:50:42 00201_array_uniq: [ OK ] 0.22 sec.
2026-02-05 15:50:42 01055_prewhere_bugs: [ OK ] 0.22 sec.
2026-02-05 15:50:42 01470_test_insert_select_asterisk: [ OK ] 0.22 sec.
2026-02-05 15:50:43 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.42 sec.
2026-02-05 15:50:43 00575_merge_and_index_with_function_in_in: [ OK ] 0.17 sec.
2026-02-05 15:50:43 02381_setting_value_auto: [ OK ] 0.17 sec.
2026-02-05 15:50:43 02810_initcap: [ OK ] 0.22 sec.
2026-02-05 15:50:43 02514_if_with_lazy_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:50:43 02840_merge__table_or_filter: [ OK ] 0.27 sec.
2026-02-05 15:50:43 01780_column_sparse_alter: [ OK ] 0.22 sec.
2026-02-05 15:50:44 01511_alter_version_versioned_collapsing_merge_tree_zookeeper: [ OK ] 0.42 sec.
2026-02-05 15:50:44 01077_window_view_alter_query_to_modify_source: [ OK ] 1.92 sec.
2026-02-05 15:50:44 03093_virtual_column_override_group_by: [ OK ] 0.17 sec.
2026-02-05 15:50:44 02868_select_support_from_keywords: [ OK ] 0.17 sec.
2026-02-05 15:50:44 03132_jit_sort_description_crash_fix: [ OK ] 0.27 sec.
2026-02-05 15:50:44 01086_modulo_or_zero: [ OK ] 0.17 sec.
2026-02-05 15:50:45 01624_soft_constraints: [ FAIL ] 3.48 sec.
2026-02-05 15:50:45 Reason: result differs with reference:
2026-02-05 15:50:45 --- /usr/share/clickhouse-test/queries/0_stateless/01624_soft_constraints.reference 2026-02-05 15:33:32.716774094 -0300
2026-02-05 15:50:45 +++ /tmp/clickhouse-test/0_stateless/01624_soft_constraints.stdout 2026-02-05 15:50:45.266733241 -0300
2026-02-05 15:50:45 @@ -1,16 +1,16 @@
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 2,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 2,
2026-02-05 15:50:45 - "rows_read": 2,
2026-02-05 15:50:45 - "rows_read": 2,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 2,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 1,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 3,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 "rows_read": 4,
2026-02-05 15:50:45 - "rows_read": 3,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45 + "rows_read": 4,
2026-02-05 15:50:45
2026-02-05 15:50:45
2026-02-05 15:50:45 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 21981505 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 17975415 --max_read_buffer_size 814974 --prefer_localhost_replica 0 --max_block_size 97488 --max_joined_block_size_rows 9949 --max_threads 32 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 52 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 4355994 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 1681757208 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 15 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2460059960 --min_compress_block_size 2394783 --max_compress_block_size 2981290 --merge_tree_compact_parts_min_granules_to_multibuffer_read 125 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 4394605 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.43 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 1 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0
2026-02-05 15:50:45
2026-02-05 15:50:45 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 4521787836 --index_granularity_bytes 29179994 --merge_max_block_size 16385 --index_granularity 5544 --min_bytes_for_wide_part 366175138 --marks_compress_block_size 48211 --primary_key_compress_block_size 24686 --replace_long_file_name_to_hash 1 --max_file_name_length 0 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 453573347 --compact_parts_max_granules_to_buffer 216 --compact_parts_merge_max_bytes_to_prefetch_part 7640620 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 152
2026-02-05 15:50:45
2026-02-05 15:50:45 Database: test_qn56enq4
2026-02-05 15:50:45 02466_distributed_query_profiler: [ OK ] 1.02 sec.
2026-02-05 15:50:45 02455_extract_fixed_string_from_nested_json: [ OK ] 0.17 sec.
2026-02-05 15:50:45 02317_like_with_trailing_escape: [ OK ] 0.17 sec.
2026-02-05 15:50:46 02456_keeper_retries_during_insert: [ OK ] 1.52 sec.
2026-02-05 15:50:46 02725_cnf_large_check: [ OK ] 0.27 sec.
2026-02-05 15:50:46 03164_materialize_skip_index: [ OK ] 0.78 sec.
2026-02-05 15:50:47 00504_mergetree_arrays_rw: [ OK ] 0.42 sec.
2026-02-05 15:50:47 00876_wrong_arraj_join_column: [ OK ] 0.17 sec.
2026-02-05 15:50:47 02786_max_execution_time_leaf: [ OK ] 2.18 sec.
2026-02-05 15:50:47 02489_analyzer_indexes: [ OK ] 0.27 sec.
2026-02-05 15:50:48 02310_profile_events_insert: [ OK ] 0.57 sec.
2026-02-05 15:50:48 02922_respect_nulls_extensive: [ OK ] 0.42 sec.
2026-02-05 15:50:48 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.17 sec.
2026-02-05 15:50:49 02151_hash_table_sizes_stats: [ OK ] 17.36 sec.
2026-02-05 15:50:49 02985_minmax_index_aggregate_function: [ OK ] 0.22 sec.
2026-02-05 15:50:49 02732_rename_after_processing: [ OK ] 1.68 sec.
2026-02-05 15:50:49 02242_make_date_mysql: [ OK ] 0.32 sec.
2026-02-05 15:50:49 03261_json_hints_types_check: [ OK ] 0.22 sec.
2026-02-05 15:50:49 01470_columns_transformers2: [ OK ] 0.17 sec.
2026-02-05 15:50:50 02668_ulid_decoding: [ OK ] 0.27 sec.
2026-02-05 15:50:50 00691_array_distinct: [ OK ] 0.17 sec.
2026-02-05 15:50:50 00091_union_race_conditions_2: [ OK ] 6.84 sec.
2026-02-05 15:50:50 01419_skip_index_compact_parts: [ OK ] 0.22 sec.
2026-02-05 15:50:50 02523_array_shuffle: [ OK ] 0.42 sec.
2026-02-05 15:50:51 00202_cross_join: [ OK ] 0.12 sec.
2026-02-05 15:50:51 02346_fulltext_index_search: [ OK ] 1.02 sec.
2026-02-05 15:50:51 03104_create_view_join: [ OK ] 0.17 sec.
2026-02-05 15:50:51 02983_empty_map: [ OK ] 0.32 sec.
2026-02-05 15:50:51 03164_analyzer_global_in_alias: [ OK ] 0.22 sec.
2026-02-05 15:50:52 00763_lock_buffer_long: [ OK ] 11.50 sec.
2026-02-05 15:50:52 02113_hdfs_assert: [ OK ] 0.72 sec.
2026-02-05 15:50:52 01656_sequence_next_node_long: [ OK ] 1.88 sec.
2026-02-05 15:50:52 02006_test_positional_arguments_on_cluster: [ OK ] 0.57 sec.
2026-02-05 15:50:53 00205_scalar_subqueries: [ OK ] 0.27 sec.
2026-02-05 15:50:53 01455_shard_leaf_max_rows_bytes_to_read: [ OK ] 0.38 sec.
2026-02-05 15:50:53 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.17 sec.
2026-02-05 15:50:53 03131_hilbert_coding: [ OK ] 0.32 sec.
2026-02-05 15:50:54 02741_hashed_dictionary_load_factor: [ OK ] 1.17 sec.
2026-02-05 15:50:54 02294_floating_point_second_in_settings: [ OK ] 3.98 sec.
2026-02-05 15:50:55 03215_multilinestring_geometry: [ OK ] 0.22 sec.
2026-02-05 15:50:55 01451_replicated_detach_drop_part_long: [ OK ] 0.42 sec.
2026-02-05 15:50:55 03019_numbers_pretty: [ OK ] 0.22 sec.
2026-02-05 15:50:55 00034_fixed_string_to_number: [ OK ] 0.17 sec.
2026-02-05 15:50:55 02906_interval_comparison: [ OK ] 0.22 sec.
2026-02-05 15:50:55 01801_dateDiff_DateTime64: [ OK ] 0.27 sec.
2026-02-05 15:50:55 00712_nan_comparison: [ OK ] 0.27 sec.
2026-02-05 15:50:55 01872_functions_to_subcolumns_analyzer: [ OK ] 0.27 sec.
2026-02-05 15:50:56 00843_optimize_predicate_and_rename_table: [ OK ] 0.22 sec.
2026-02-05 15:50:57 00534_functions_bad_arguments7: [ OK ] 4.64 sec.
2026-02-05 15:50:57 01307_orc_output_format: [ OK ] 1.67 sec.
2026-02-05 15:50:57 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.22 sec.
2026-02-05 15:50:58 01710_projection_detach_part: [ OK ] 0.28 sec.
2026-02-05 15:50:58 02235_remote_fs_cache_stress: [ OK ] 2.28 sec.
2026-02-05 15:50:58 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.32 sec.
2026-02-05 15:50:59 00083_create_merge_tree_zookeeper_long: [ OK ] 1.18 sec.
2026-02-05 15:50:59 03160_pretty_format_tty: [ OK ] 0.57 sec.
2026-02-05 15:50:59 00717_low_cardinaliry_group_by: [ OK ] 0.27 sec.
2026-02-05 15:51:01 03209_json_type_horizontal_merges: [ OK ] 7.49 sec.
2026-02-05 15:51:01 01492_format_readable_quantity: [ OK ] 0.17 sec.
2026-02-05 15:51:02 00233_position_function_family: [ OK ] 1.47 sec.
2026-02-05 15:51:02 02933_compare_with_bool_as_string: [ OK ] 0.22 sec.
2026-02-05 15:51:03 02989_group_by_tuple: [ OK ] 0.17 sec.
2026-02-05 15:51:03 00284_external_aggregation_2: [ OK ] 6.29 sec.
2026-02-05 15:51:03 01852_hints_enum_name: [ OK ] 0.52 sec.
2026-02-05 15:51:03 02010_array_index_bad_cast: [ OK ] 0.22 sec.
2026-02-05 15:51:04 02099_hashed_array_dictionary_complex_key: [ OK ] 4.69 sec.
2026-02-05 15:51:04 01079_bad_alters_zookeeper_long: [ OK ] 5.14 sec.
2026-02-05 15:51:04 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.27 sec.
2026-02-05 15:51:04 02346_fulltext_index_bug47393: [ OK ] 0.22 sec.
2026-02-05 15:51:05 01067_window_view_event_tumble_to_asc_lateness: [ OK ] 1.22 sec.
2026-02-05 15:51:05 02122_parallel_formatting_TSVWithNamesAndTypes: [ OK ] 1.33 sec.
2026-02-05 15:51:05 02343_aggregation_pipeline: [ OK ] 0.32 sec.
2026-02-05 15:51:05 02911_analyzer_remove_unused_projection_columns: [ OK ] 0.22 sec.
2026-02-05 15:51:05 03262_filter_push_down_view: [ OK ] 0.22 sec.
2026-02-05 15:51:06 00916_create_or_replace_view: [ OK ] 0.33 sec.
2026-02-05 15:51:06 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 1.78 sec.
2026-02-05 15:51:06 00700_decimal_complex_types: [ OK ] 1.37 sec.
2026-02-05 15:51:06 00200_shard_distinct_order_by_limit_distributed: [ OK ] 0.39 sec.
2026-02-05 15:51:06 01311_comparison_with_constant_string: [ OK ] 0.42 sec.
2026-02-05 15:51:06 01683_text_log_deadlock: [ OK ] 1.88 sec.
2026-02-05 15:51:07 02661_quantile_approx: [ OK ] 0.37 sec.
2026-02-05 15:51:07 00725_quantiles_shard: [ OK ] 0.17 sec.
2026-02-05 15:51:08 02864_statistics_ddl: [ OK ] 1.37 sec.
2026-02-05 15:51:08 02892_input_csv_cr_end_count_many_rows: [ OK ] 1.02 sec.
2026-02-05 15:51:08 01384_bloom_filter_bad_arguments: [ OK ] 0.22 sec.
2026-02-05 15:51:08 00296_url_parameters: [ OK ] 0.17 sec.
2026-02-05 15:51:08 01414_push_predicate_when_contains_with_clause: [ OK ] 0.27 sec.
2026-02-05 15:51:09 00227_quantiles_timing_arbitrary_order: [ OK ] 0.17 sec.
2026-02-05 15:51:09 03228_variant_permutation_issue: [ OK ] 0.22 sec.
2026-02-05 15:51:09 01054_random_printable_ascii_ubsan: [ OK ] 1.27 sec.
2026-02-05 15:51:10 02312_is_not_null_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:51:10 02375_analyzer_union: [ OK ] 0.27 sec.
2026-02-05 15:51:10 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.17 sec.
2026-02-05 15:51:10 00300_csv: [ OK ] 0.17 sec.
2026-02-05 15:51:11 02385_analyzer_aliases_compound_expression: [ OK ] 0.22 sec.
2026-02-05 15:51:11 01069_materialized_view_alter_target_table_with_default_expression: [ OK ] 0.22 sec.
2026-02-05 15:51:11 01056_predicate_optimizer_bugs: [ OK ] 0.42 sec.
2026-02-05 15:51:12 01925_date_date_time_comparison: [ OK ] 0.17 sec.
2026-02-05 15:51:12 02161_addressToLineWithInlines: [ OK ] 24.04 sec.
2026-02-05 15:51:12 01852_cast_operator_4: [ OK ] 0.17 sec.
2026-02-05 15:51:12 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.52 sec.
2026-02-05 15:51:12 01881_total_bytes_storage_buffer: [ OK ] 0.17 sec.
2026-02-05 15:51:12 02967_analyzer_fuzz: [ OK ] 0.27 sec.
2026-02-05 15:51:13 02157_readonly_system_suspend: [ OK ] 0.52 sec.
2026-02-05 15:51:13 01679_format_readable_time_delta_inf: [ OK ] 0.12 sec.
2026-02-05 15:51:13 02432_s3_parallel_parts_cleanup: [ OK ] 27.35 sec.
2026-02-05 15:51:14 01051_scalar_optimization: [ OK ] 0.17 sec.
2026-02-05 15:51:14 00725_memory_tracking: [ OK ] 1.02 sec.
2026-02-05 15:51:14 02112_skip_index_set_and_or: [ OK ] 0.22 sec.
2026-02-05 15:51:15 02973_s3_compressed_file_in_error_message: [ OK ] 0.68 sec.
2026-02-05 15:51:15 00594_alias_in_distributed: [ OK ] 0.53 sec.
2026-02-05 15:51:16 01305_buffer_final_bug: [ OK ] 0.22 sec.
2026-02-05 15:51:16 02242_join_rocksdb: [ OK ] 0.42 sec.
2026-02-05 15:51:16 02179_key_condition_no_common_type: [ OK ] 0.27 sec.
2026-02-05 15:51:17 00434_tonullable: [ OK ] 0.20 sec.
2026-02-05 15:51:17 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:51:17 02790_optimize_skip_unused_shards_join: [ OK ] 0.33 sec.
2026-02-05 15:51:17 01630_disallow_floating_point_as_partition_key: [ OK ] 0.17 sec.
2026-02-05 15:51:18 01383_log_broken_table: [ OK ] 12.37 sec.
2026-02-05 15:51:18 01082_bit_test_out_of_bound: [ OK ] 0.32 sec.
2026-02-05 15:51:19 02710_protobuf_ipv4_date32: [ OK ] 0.97 sec.
2026-02-05 15:51:19 02346_position_countsubstrings_zero_byte: [ OK ] 0.32 sec.
2026-02-05 15:51:19 00591_columns_removal_union_all: [ OK ] 0.22 sec.
2026-02-05 15:51:20 01523_client_local_queries_file_parameter: [ OK ] 1.28 sec.
2026-02-05 15:51:20 01246_buffer_flush: [ OK ] 7.75 sec.
2026-02-05 15:51:20 01674_unicode_asan: [ OK ] 0.32 sec.
2026-02-05 15:51:21 01050_window_view_parser_tumble: [ OK ] 0.42 sec.
2026-02-05 15:51:21 00352_external_sorting_and_constants: [ OK ] 0.52 sec.
2026-02-05 15:51:21 01353_low_cardinality_join_types: [ OK ] 0.37 sec.
2026-02-05 15:51:22 01891_partition_hash: [ OK ] 0.27 sec.
2026-02-05 15:51:22 01338_long_select_and_alter: [ OK ] 12.97 sec.
2026-02-05 15:51:22 01273_arrow_dictionaries_load: [ OK ] 3.03 sec.
2026-02-05 15:51:22 01134_set_overflow_mode: [ OK ] 0.32 sec.
2026-02-05 15:51:22 02478_projection_with_group_by_alter: [ OK ] 0.37 sec.
2026-02-05 15:51:22 01461_query_start_time_microseconds: [ OK ] 0.48 sec.
2026-02-05 15:51:22 03352_concurrent_rename_alter: [ OK ] 8.71 sec.
2026-02-05 15:51:22 01776_decrypt_aead_size_check: [ OK ] 0.17 sec.
2026-02-05 15:51:22 02831_ast_fuzz_asan_join: [ OK ] 0.17 sec.
2026-02-05 15:51:23 02539_vertical_merge_compact_parts: [ OK ] 0.27 sec.
2026-02-05 15:51:23 00956_join_use_nulls_with_array_column: [ OK ] 0.17 sec.
2026-02-05 15:51:23 02460_projections_and_aggregate_null_if_empty: [ OK ] 0.62 sec.
2026-02-05 15:51:23 00625_arrays_in_nested: [ OK ] 0.37 sec.
2026-02-05 15:51:24 02423_insert_summary_behaviour: [ OK ] 1.42 sec.
2026-02-05 15:51:24 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 1.47 sec.
2026-02-05 15:51:24 00319_index_for_like: [ OK ] 0.27 sec.
2026-02-05 15:51:24 02473_prewhere_with_bigint: [ OK ] 0.22 sec.
2026-02-05 15:51:24 02676_kafka_murmur_hash: [ OK ] 0.17 sec.
2026-02-05 15:51:24 03032_numbers_zeros: [ OK ] 0.22 sec.
2026-02-05 15:51:24 01273_arrow_nullable_arrays_load: [ OK ] 1.12 sec.
2026-02-05 15:51:24 02597_projection_materialize_and_replication: [ OK ] 1.17 sec.
2026-02-05 15:51:24 00323_quantiles_timing_bug: [ OK ] 0.32 sec.
2026-02-05 15:51:25 00488_column_name_primary: [ OK ] 0.17 sec.
2026-02-05 15:51:25 02097_initializeAggregationNullable: [ OK ] 0.17 sec.
2026-02-05 15:51:26 01042_system_reload_dictionary_reloads_completely: [ OK ] 5.03 sec.
2026-02-05 15:51:26 02185_arraySlice_negative_offset_size: [ OK ] 0.17 sec.
2026-02-05 15:51:26 00612_pk_in_tuple_perf: [ OK ] 1.37 sec.
2026-02-05 15:51:27 01429_empty_arrow_and_parquet: [ OK ] 2.88 sec.
2026-02-05 15:51:27 00575_illegal_column_exception_when_drop_depen_column: [ OK ] 1.42 sec.
2026-02-05 15:51:27 03023_remove_unused_column_distinct: [ OK ] 0.12 sec.
2026-02-05 15:51:27 03052_query_hash_includes_aliases: [ OK ] 0.17 sec.
2026-02-05 15:51:28 01603_decimal_mult_float: [ OK ] 0.22 sec.
2026-02-05 15:51:28 02025_storage_filelog_virtual_col: [ OK ] 3.43 sec.
2026-02-05 15:51:28 02301_harmful_reexec: [ OK ] 0.62 sec.
2026-02-05 15:51:28 02456_test_zero_copy_mutation: [ OK ] 0.27 sec.
2026-02-05 15:51:28 01127_month_partitioning_consistency_select: [ OK ] 0.22 sec.
2026-02-05 15:51:28 01770_add_months_ubsan: [ OK ] 0.12 sec.
2026-02-05 15:51:28 01075_allowed_client_hosts: [ OK ] 0.22 sec.
2026-02-05 15:51:28 01710_projection_with_nullable_keys: [ OK ] 0.17 sec.
2026-02-05 15:51:28 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.17 sec.
2026-02-05 15:51:28 02878_use_structure_from_insertion_table_with_explicit_insert_columns: [ OK ] 0.57 sec.
2026-02-05 15:51:29 02234_position_case_insensitive_utf8: [ OK ] 0.17 sec.
2026-02-05 15:51:29 02935_ipv6_bit_operations: [ OK ] 0.17 sec.
2026-02-05 15:51:29 03131_rewrite_sum_if_nullable: [ OK ] 0.22 sec.
2026-02-05 15:51:29 02695_logical_optimizer_alias_bug: [ OK ] 0.17 sec.
2026-02-05 15:51:29 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.17 sec.
2026-02-05 15:51:29 00155_long_merges: [ OK ] 62.09 sec.
2026-02-05 15:51:29 02513_analyzer_duplicate_alias_crash_fix: [ OK ] 0.12 sec.
2026-02-05 15:51:29 00286_format_long_negative_float: [ OK ] 0.12 sec.
2026-02-05 15:51:29 03161_lightweight_delete_projection: [ OK ] 0.22 sec.
2026-02-05 15:51:29 02952_binary: [ OK ] 0.42 sec.
2026-02-05 15:51:30 02457_tuple_of_intervals: [ OK ] 0.37 sec.
2026-02-05 15:51:30 02233_optimize_aggregation_in_order_prefix_with_merge: [ OK ] 0.17 sec.
2026-02-05 15:51:30 02155_csv_with_strings_with_slash: [ OK ] 1.27 sec.
2026-02-05 15:51:30 00647_histogram: [ OK ] 0.17 sec.
2026-02-05 15:51:30 02478_projection_and_alter_low_cardinality: [ OK ] 0.27 sec.
2026-02-05 15:51:30 01650_expressions_merge_bug: [ OK ] 0.17 sec.
2026-02-05 15:51:30 00506_union_distributed: [ OK ] 0.37 sec.
2026-02-05 15:51:30 03228_pr_subquery_view_order_by: [ OK ] 0.17 sec.
2026-02-05 15:51:31 02516_projections_and_context: [ OK ] 0.22 sec.
2026-02-05 15:51:31 01762_deltasumtimestamp_datetime64: [ OK ] 0.52 sec.
2026-02-05 15:51:31 01550_type_map_formats_input: [ OK ] 2.02 sec.
2026-02-05 15:51:31 00265_http_content_type_format_timezone: [ OK ] 0.77 sec.
2026-02-05 15:51:31 01514_tid_function: [ OK ] 0.17 sec.
2026-02-05 15:51:31 01420_logical_functions_materialized_null: [ OK ] 0.17 sec.
2026-02-05 15:51:32 01434_netloc_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:51:32 01013_hex_float: [ OK ] 0.17 sec.
2026-02-05 15:51:32 03213_distributed_analyzer: [ OK ] 0.22 sec.
2026-02-05 15:51:32 01426_geohash_constants: [ OK ] 0.17 sec.
2026-02-05 15:51:32 03035_argMinMax_numeric_non_extreme_bug: [ OK ] 0.22 sec.
2026-02-05 15:51:33 00862_decimal_in: [ OK ] 0.22 sec.
2026-02-05 15:51:33 02961_output_format_compress_params: [ OK ] 1.58 sec.
2026-02-05 15:51:33 00590_limit_by_column_removal: [ OK ] 0.12 sec.
2026-02-05 15:51:33 01880_materialized_view_to_table_type_check: [ OK ] 0.27 sec.
2026-02-05 15:51:33 03093_bug_gcd_codec: [ OK ] 0.22 sec.
2026-02-05 15:51:33 02875_final_invalid_read_ranges_bug: [ OK ] 0.22 sec.
2026-02-05 15:51:34 03224_json_merges_new_type_in_shared_data: [ OK ] 0.22 sec.
2026-02-05 15:51:34 02709_storage_memory_compressed: [ OK ] 0.17 sec.
2026-02-05 15:51:34 01087_window_view_alter_query: [ OK ] 1.67 sec.
2026-02-05 15:51:35 02677_get_subcolumn_array_of_tuples: [ OK ] 0.22 sec.
2026-02-05 15:51:35 02680_default_star: [ OK ] 0.17 sec.
2026-02-05 15:51:35 00652_replicated_mutations_zookeeper: [ OK ] 5.63 sec.
2026-02-05 15:51:35 02152_short_circuit_throw_if: [ OK ] 0.17 sec.
2026-02-05 15:51:35 01605_drop_settings_profile_while_assigned: [ OK ] 0.17 sec.
2026-02-05 15:51:35 00471_sql_style_quoting: [ OK ] 0.22 sec.
2026-02-05 15:51:36 03037_union_view: [ OK ] 0.22 sec.
2026-02-05 15:51:36 01825_type_json_multiple_files: [ OK ] 2.12 sec.
2026-02-05 15:51:36 02448_clone_replica_lost_part: [ OK ] 30.12 sec.
2026-02-05 15:51:37 00336_shard_stack_trace: [ OK ] 0.97 sec.
2026-02-05 15:51:37 00738_nested_merge_multidimensional_array: [ OK ] 0.22 sec.
2026-02-05 15:51:37 02534_analyzer_grouping_function: [ OK ] 0.27 sec.
2026-02-05 15:51:37 02245_weird_partitions_pruning: [ OK ] 0.22 sec.
2026-02-05 15:51:37 02716_create_direct_dict_with_lifetime_throws: [ OK ] 0.12 sec.
2026-02-05 15:51:37 03272_partition_pruning_monotonic_func_bug: [ OK ] 0.22 sec.
2026-02-05 15:51:37 00900_orc_nullable_arrays_load: [ OK ] 1.22 sec.
2026-02-05 15:51:37 01014_count_of_merges_metrics: [ OK ] 0.22 sec.
2026-02-05 15:51:38 00106_totals_after_having: [ OK ] 0.22 sec.
2026-02-05 15:51:38 01554_row_number_after_cannot_read_all_data: [ OK ] 0.62 sec.
2026-02-05 15:51:38 00295_global_in_one_shard_rows_before_limit: [ OK ] 0.17 sec.
2026-02-05 15:51:38 02492_clickhouse_local_context_uaf: [ OK ] 0.47 sec.
2026-02-05 15:51:39 00999_join_on_expression: [ OK ] 0.32 sec.
2026-02-05 15:51:39 02950_parallel_replicas_used_count: [ OK ] 1.32 sec.
2026-02-05 15:51:40 01062_max_parser_depth: [ OK ] 0.42 sec.
2026-02-05 15:51:40 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.17 sec.
2026-02-05 15:51:40 01809_inactive_parts_to_delay_throw_insert: [ OK ] 1.22 sec.
2026-02-05 15:51:40 01634_uuid_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:51:40 02539_generate_random_low_cardinality: [ OK ] 0.22 sec.
2026-02-05 15:51:40 02886_binary_like: [ OK ] 0.22 sec.
2026-02-05 15:51:40 02346_additional_filters_index: [ OK ] 0.22 sec.
2026-02-05 15:51:41 02521_lightweight_delete_and_ttl: [ OK ] 0.37 sec.
2026-02-05 15:51:41 02725_parquet_preserve_order: [ OK ] 9.70 sec.
2026-02-05 15:51:41 01268_data_numeric_parameters: [ OK ] 0.23 sec.
2026-02-05 15:51:42 02220_array_join_format: [ OK ] 0.12 sec.
2026-02-05 15:51:42 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 1.37 sec.
2026-02-05 15:51:42 00571_alter_nullable: [ OK ] 0.22 sec.
2026-02-05 15:51:42 02842_mutations_replace_non_deterministic: [ OK ] 0.77 sec.
2026-02-05 15:51:42 02834_nulls_first_sort: [ OK ] 0.17 sec.
2026-02-05 15:51:43 01926_order_by_desc_limit: [ OK ] 2.33 sec.
2026-02-05 15:51:43 02184_ipv6_select_parsing: [ OK ] 0.17 sec.
2026-02-05 15:51:43 00287_column_const_with_nan: [ OK ] 0.17 sec.
2026-02-05 15:51:43 01273_arrow_stream: [ OK ] 8.10 sec.
2026-02-05 15:51:43 00824_filesystem: [ OK ] 0.17 sec.
2026-02-05 15:51:43 02902_json_skip_null_values: [ OK ] 0.22 sec.
2026-02-05 15:51:44 00825_protobuf_format_nested_in_nested: [ OK ] 1.18 sec.
2026-02-05 15:51:44 01622_defaults_for_file_engine: [ OK ] 0.17 sec.
2026-02-05 15:51:44 02569_order_by_aggregation_result: [ OK ] 0.22 sec.
2026-02-05 15:51:44 01513_defaults_on_defaults_no_column: [ OK ] 0.22 sec.
2026-02-05 15:51:44 00703_join_crash: [ OK ] 0.22 sec.
2026-02-05 15:51:44 02981_vertical_merges_memory_usage: [ OK ] 1.48 sec.
2026-02-05 15:51:44 03232_pr_not_ready_set: [ OK ] 0.27 sec.
2026-02-05 15:51:44 00098_7_union_all: [ OK ] 0.17 sec.
2026-02-05 15:51:44 03147_asof_join_ddb_missing: [ OK ] 0.57 sec.
2026-02-05 15:51:44 01710_order_by_projections_complete: [ OK ] 0.22 sec.
2026-02-05 15:51:44 01825_new_type_json_2: [ OK ] 0.32 sec.
2026-02-05 15:51:45 01283_strict_resize_bug: [ OK ] 0.78 sec.
2026-02-05 15:51:45 03065_analyzer_cross_join_and_array_join: [ OK ] 0.17 sec.
2026-02-05 15:51:45 01516_drop_table_stress_long: [ OK ] 20.42 sec.
2026-02-05 15:51:45 02124_empty_uuid: [ OK ] 0.17 sec.
2026-02-05 15:51:45 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.32 sec.
2026-02-05 15:51:45 01258_bom_tsv: [ OK ] 0.47 sec.
2026-02-05 15:51:45 02890_partition_prune_in_extra_columns: [ OK ] 0.17 sec.
2026-02-05 15:51:45 03127_window_functions_uint16: [ OK ] 0.17 sec.
2026-02-05 15:51:45 00232_format_readable_decimal_size: [ OK ] 0.17 sec.
2026-02-05 15:51:45 00910_buffer_prewhere_different_types: [ OK ] 0.22 sec.
2026-02-05 15:51:45 03002_int_div_decimal_with_date_bug: [ OK ] 0.17 sec.
2026-02-05 15:51:46 02932_punycode: [ OK ] 0.52 sec.
2026-02-05 15:51:46 01787_map_remote: [ OK ] 0.22 sec.
2026-02-05 15:51:46 01801_nullable_low_cardinality_tsv: [ OK ] 0.92 sec.
2026-02-05 15:51:46 00926_multimatch: [ OK ] 0.97 sec.
2026-02-05 15:51:46 01457_int256_hashing: [ OK ] 0.24 sec.
2026-02-05 15:51:46 02002_sampling_and_unknown_column_bug: [ OK ] 0.17 sec.
2026-02-05 15:51:46 00606_quantiles_and_nans: [ OK ] 0.17 sec.
2026-02-05 15:51:46 02903_rmt_retriable_merge_exception: [ OK ] 1.57 sec.
2026-02-05 15:51:47 02476_query_parameters_without_serialisation: [ OK ] 0.17 sec.
2026-02-05 15:51:47 01226_dist_on_dist_global_in: [ OK ] 0.22 sec.
2026-02-05 15:51:47 00927_asof_join_other_types: [ OK ] 0.67 sec.
2026-02-05 15:51:47 01732_race_condition_storage_join_long: [ OK ] 20.68 sec.
2026-02-05 15:51:47 02015_async_inserts_3: [ OK ] 0.87 sec.
2026-02-05 15:51:47 01871_merge_tree_compile_expressions: [ OK ] 0.42 sec.
2026-02-05 15:51:47 02750_settings_alias_tcp_protocol: [ OK ] 0.52 sec.
2026-02-05 15:51:47 03161_decimal_binary_math: [ OK ] 0.37 sec.
2026-02-05 15:51:47 01600_multiple_left_join_with_aliases: [ OK ] 0.17 sec.
2026-02-05 15:51:47 02474_create_user_query_fuzzer_bug: [ OK ] 0.12 sec.
2026-02-05 15:51:47 01732_more_consistent_datetime64_parsing: [ OK ] 0.17 sec.
2026-02-05 15:51:47 00156_array_map_to_constant: [ OK ] 0.17 sec.
2026-02-05 15:51:47 03023_invalid_format_detection: [ OK ] 0.57 sec.
2026-02-05 15:51:47 02950_part_log_bytes_uncompressed: [ OK ] 0.22 sec.
2026-02-05 15:51:48 00317_in_tuples_and_out_of_range_values: [ OK ] 0.17 sec.
2026-02-05 15:51:48 02903_parameterized_view_explain_ast: [ OK ] 0.17 sec.
2026-02-05 15:51:48 02483_cuturlparameter_with_arrays: [ OK ] 0.17 sec.
2026-02-05 15:51:48 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.22 sec.
2026-02-05 15:51:48 02998_primary_key_skip_columns: [ OK ] 98.17 sec.
2026-02-05 15:51:48 00751_low_cardinality_nullable_group_by: [ OK ] 0.67 sec.
2026-02-05 15:51:48 02418_tautological_if_index: [ OK ] 0.22 sec.
2026-02-05 15:51:48 03033_dynamic_text_serialization: [ OK ] 0.22 sec.
2026-02-05 15:51:48 01259_dictionary_custom_settings_ddl: [ OK ] 0.27 sec.
2026-02-05 15:51:48 01322_cast_keep_nullable: [ OK ] 0.22 sec.
2026-02-05 15:51:49 02816_check_projection_metadata: [ OK ] 0.17 sec.
2026-02-05 15:51:49 00534_filimonov: [ OK ] 1.38 sec.
2026-02-05 15:51:49 01661_week_functions_string_args: [ OK ] 0.42 sec.
2026-02-05 15:51:49 02473_extract_low_cardinality_from_json: [ OK ] 0.12 sec.
2026-02-05 15:51:49 01941_dict_get_has_complex_single_key: [ OK ] 0.27 sec.
2026-02-05 15:51:49 02920_alter_column_of_projections: [ OK ] 0.27 sec.
2026-02-05 15:51:50 01544_file_engine_settings: [ OK ] 0.82 sec.
2026-02-05 15:51:50 01504_rocksdb: [ OK ] 1.73 sec.
2026-02-05 15:51:50 01710_minmax_count_projection_distributed_query: [ OK ] 0.17 sec.
2026-02-05 15:51:50 00100_subquery_table_identifier: [ OK ] 1.02 sec.
2026-02-05 15:51:50 02566_analyzer_limit_settings_distributed: [ OK ] 0.22 sec.
2026-02-05 15:51:51 02845_arrayShiftRotate: [ OK ] 0.37 sec.
2026-02-05 15:51:51 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 0.82 sec.
2026-02-05 15:51:51 02995_preliminary_filters_duplicated_columns_SimpleAggregateFunction: [ OK ] 0.22 sec.
2026-02-05 15:51:51 01165_lost_part_empty_partition: [ OK ] 2.59 sec.
2026-02-05 15:51:51 00740_database_in_nested_view: [ OK ] 0.27 sec.
2026-02-05 15:51:52 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.47 sec.
2026-02-05 15:51:52 01033_function_substring: [ OK ] 0.57 sec.
2026-02-05 15:51:52 02933_ephemeral_mv: [ OK ] 0.22 sec.
2026-02-05 15:51:52 02242_case_insensitive_column_matching: [ OK ] 2.03 sec.
2026-02-05 15:51:52 00822_array_insert_default: [ OK ] 0.47 sec.
2026-02-05 15:51:53 00854_multiple_join_asterisks: [ OK ] 0.22 sec.
2026-02-05 15:51:53 01017_uniqCombined_memory_usage: [ OK ] 0.82 sec.
2026-02-05 15:51:53 02152_csv_tuple: [ OK ] 0.22 sec.
2026-02-05 15:51:53 00968_file_engine_in_subquery: [ OK ] 0.37 sec.
2026-02-05 15:51:53 00284_external_aggregation: [ OK ] 5.53 sec.
2026-02-05 15:51:53 02225_parallel_distributed_insert_select_view: [ OK ] 0.97 sec.
2026-02-05 15:51:53 02148_issue_32737: [ OK ] 0.42 sec.
2026-02-05 15:51:53 02968_sumMap_with_nan: [ OK ] 0.17 sec.
2026-02-05 15:51:53 00307_format_xml: [ OK ] 0.18 sec.
2026-02-05 15:51:53 02841_remote_parameter_parsing_error: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02354_tuple_lowcardinality: [ OK ] 0.18 sec.
2026-02-05 15:51:54 02724_jit_logical_functions: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02872_gcd_codec: [ OK ] 0.48 sec.
2026-02-05 15:51:54 00977_int_div: [ OK ] 0.22 sec.
2026-02-05 15:51:54 01660_join_or_any: [ OK ] 0.42 sec.
2026-02-05 15:51:54 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02709_generate_random_valid_decimals_and_bools: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02006_h3_to_geo_boundary: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02956_rocksdb_with_ttl: [ OK ] 3.23 sec.
2026-02-05 15:51:54 00752_low_cardinality_array_result: [ OK ] 0.22 sec.
2026-02-05 15:51:54 02243_ipv6_long_parsing: [ OK ] 0.22 sec.
2026-02-05 15:51:54 00909_kill_not_initialized_query: [ OK ] 6.69 sec.
2026-02-05 15:51:54 03203_fill_missed_subcolumns: [ OK ] 0.37 sec.
2026-02-05 15:51:54 01642_if_nullable_regression: [ OK ] 0.22 sec.
2026-02-05 15:51:55 00853_join_with_nulls_crash: [ OK ] 0.32 sec.
2026-02-05 15:51:55 00397_tsv_format_synonym: [ OK ] 0.17 sec.
2026-02-05 15:51:55 00823_sequence_match_dfa: [ OK ] 0.52 sec.
2026-02-05 15:51:55 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.42 sec.
2026-02-05 15:51:55 00806_alter_update: [ OK ] 0.22 sec.
2026-02-05 15:51:55 01852_cast_operator_3: [ OK ] 0.17 sec.
2026-02-05 15:51:55 02559_multiple_read_steps_in_prewhere_reuse_computation: [ OK ] 0.22 sec.
2026-02-05 15:51:55 02982_create_mv_inner_extra: [ OK ] 0.17 sec.
2026-02-05 15:51:55 01908_with_unknown_column: [ OK ] 0.17 sec.
2026-02-05 15:51:56 02943_create_query_interpreter_sample_block_fix: [ OK ] 0.32 sec.
2026-02-05 15:51:56 00634_logging_shard: [ OK ] 1.32 sec.
2026-02-05 15:51:56 01581_deduplicate_by_columns_local: [ OK ] 0.52 sec.
2026-02-05 15:51:56 02310_uuid_v7: [ OK ] 0.17 sec.
2026-02-05 15:51:56 00840_top_k_weighted: [ OK ] 0.17 sec.
2026-02-05 15:51:56 01286_constraints_on_default: [ OK ] 0.22 sec.
2026-02-05 15:51:56 02337_join_analyze_stuck: [ OK ] 0.32 sec.
2026-02-05 15:51:56 01288_shard_max_network_bandwidth: [ OK ] 2.68 sec.
2026-02-05 15:51:56 03001_restore_from_old_backup_with_matview_inner_table_metadata: [ OK ] 1.22 sec.
2026-02-05 15:51:56 02354_vector_search_multiple_indexes: [ OK ] 0.17 sec.
2026-02-05 15:51:57 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.27 sec.
2026-02-05 15:51:57 02789_describe_table_settings: [ OK ] 0.17 sec.
2026-02-05 15:51:57 00916_add_materialized_column_after: [ OK ] 0.17 sec.
2026-02-05 15:51:57 00623_in_partition_key: [ OK ] 0.42 sec.
2026-02-05 15:51:57 02842_move_pk_to_end_of_prewhere: [ OK ] 0.27 sec.
2026-02-05 15:51:57 03143_ttl_in_system_parts_columns_table: [ OK ] 0.17 sec.
2026-02-05 15:51:57 03035_alias_column_bug_distributed: [ OK ] 0.27 sec.
2026-02-05 15:51:57 02916_date_text_parsing: [ OK ] 0.27 sec.
2026-02-05 15:51:57 00147_alter_nested_default: [ OK ] 0.27 sec.
2026-02-05 15:51:58 02124_comparison_betwwen_decimal_and_float: [ OK ] 0.27 sec.
2026-02-05 15:51:58 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.22 sec.
2026-02-05 15:51:58 02989_join_using_parent_scope: [ OK ] 0.47 sec.
2026-02-05 15:51:58 01825_new_type_json_9: [ OK ] 0.22 sec.
2026-02-05 15:51:58 02493_analyzer_sum_if_to_count_if: [ OK ] 0.22 sec.
2026-02-05 15:51:58 02313_cross_join_dup_col_names: [ OK ] 0.12 sec.
2026-02-05 15:51:58 01271_show_privileges: [ OK ] 0.12 sec.
2026-02-05 15:51:58 02804_intersect_bad_cast: [ OK ] 0.17 sec.
2026-02-05 15:51:58 00522_multidimensional: [ OK ] 0.72 sec.
2026-02-05 15:51:58 03108_describe_union_all: [ OK ] 0.17 sec.
2026-02-05 15:51:58 01676_clickhouse_client_autocomplete: [ OK ] 3.98 sec.
2026-02-05 15:51:59 02345_analyzer_subqueries: [ OK ] 0.27 sec.
2026-02-05 15:51:59 03261_sort_cursor_crash: [ OK ] 0.22 sec.
2026-02-05 15:51:59 00700_decimal_empty_aggregates: [ OK ] 0.47 sec.
2026-02-05 15:51:59 00825_protobuf_format_array_of_arrays: [ OK ] 1.02 sec.
2026-02-05 15:51:59 01735_to_datetime64: [ OK ] 0.17 sec.
2026-02-05 15:51:59 02028_create_select_settings: [ OK ] 0.12 sec.
2026-02-05 15:51:59 01763_support_map_lowcardinality_type: [ OK ] 0.22 sec.
2026-02-05 15:51:59 01101_prewhere_after_alter: [ OK ] 0.22 sec.
2026-02-05 15:52:00 00595_insert_into_view: [ OK ] 1.34 sec.
2026-02-05 15:52:00 01825_new_type_json_insert_select: [ OK ] 0.72 sec.
2026-02-05 15:52:00 02884_string_distance_function: [ OK ] 0.47 sec.
2026-02-05 15:52:00 03006_buffer_overflow_join: [ OK ] 0.17 sec.
2026-02-05 15:52:00 02959_system_database_engines: [ OK ] 0.17 sec.
2026-02-05 15:52:00 02156_storage_merge_prewhere_not_ready_set_bug: [ OK ] 0.23 sec.
2026-02-05 15:52:00 00282_merging: [ OK ] 0.58 sec.
2026-02-05 15:52:00 01374_if_nullable_filimonov: [ OK ] 0.12 sec.
2026-02-05 15:52:00 02158_ztest: [ OK ] 0.17 sec.
2026-02-05 15:52:00 03059_analyzer_join_engine_missing_column: [ OK ] 0.22 sec.
2026-02-05 15:52:01 00981_no_virtual_columns: [ OK ] 0.23 sec.
2026-02-05 15:52:01 02680_illegal_type_of_filter_projection: [ OK ] 0.23 sec.
2026-02-05 15:52:01 02494_zero_copy_projection_cancel_fetch: [ OK ] 23.81 sec.
2026-02-05 15:52:01 01197_summing_enum: [ OK ] 0.17 sec.
2026-02-05 15:52:01 02165_h3_exact_edge_length_Km: [ OK ] 0.28 sec.
2026-02-05 15:52:01 01456_modify_column_type_via_add_drop_update: [ OK ] 0.57 sec.
2026-02-05 15:52:01 03217_primary_index_memory_leak: [ OK ] 5.19 sec.
2026-02-05 15:52:01 02500_analyzer_storage_view_crash_fix: [ OK ] 0.27 sec.
2026-02-05 15:52:01 03171_direct_dict_short_circuit_bug: [ OK ] 0.22 sec.
2026-02-05 15:52:01 02810_system_jemalloc_bins: [ OK ] 0.17 sec.
2026-02-05 15:52:01 02968_full_sorting_join_fuzz: [ OK ] 2.33 sec.
2026-02-05 15:52:01 00561_storage_join: [ OK ] 0.22 sec.
2026-02-05 15:52:01 01783_http_chunk_size: [ OK ] 0.52 sec.
2026-02-05 15:52:01 01551_mergetree_read_in_order_spread: [ OK ] 0.22 sec.
2026-02-05 15:52:01 01090_fixed_string_bit_ops: [ OK ] 0.17 sec.
2026-02-05 15:52:01 02311_create_table_with_unknown_format: [ OK ] 0.17 sec.
2026-02-05 15:52:02 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.17 sec.
2026-02-05 15:52:02 03198_json_extract_more_types: [ OK ] 0.27 sec.
2026-02-05 15:52:02 01651_map_functions: [ OK ] 0.67 sec.
2026-02-05 15:52:02 03227_json_invalid_regexp: [ OK ] 0.17 sec.
2026-02-05 15:52:02 00908_analyze_query: [ OK ] 0.17 sec.
2026-02-05 15:52:03 02675_predicate_push_down_filled_join_fix: [ OK ] 0.27 sec.
2026-02-05 15:52:03 02277_full_sort_join_misc: [ OK ] 0.22 sec.
2026-02-05 15:52:04 00415_into_outfile: [ OK ] 1.22 sec.
2026-02-05 15:52:04 02002_row_level_filter_bug: [ OK ] 2.48 sec.
2026-02-05 15:52:04 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.45 sec.
2026-02-05 15:52:05 02183_dictionary_no_attributes: [ OK ] 0.52 sec.
2026-02-05 15:52:05 02047_log_family_data_file_dumps: [ OK ] 3.38 sec.
2026-02-05 15:52:05 03165_round_scale_as_column: [ OK ] 0.57 sec.
2026-02-05 15:52:05 00579_merge_tree_partition_and_primary_keys_using_same_expression: [ OK ] 0.22 sec.
2026-02-05 15:52:05 00635_shard_distinct_order_by: [ OK ] 0.22 sec.
2026-02-05 15:52:05 02534_default_granularity: [ OK ] 0.17 sec.
2026-02-05 15:52:05 01903_http_fields: [ OK ] 0.92 sec.
2026-02-05 15:52:06 02563_async_insert_bad_data: [ OK ] 4.39 sec.
2026-02-05 15:52:06 02897_alter_partition_parameters: [ OK ] 0.53 sec.
2026-02-05 15:52:06 00502_custom_partitioning_replicated_zookeeper_long: [ OK ] 1.14 sec.
2026-02-05 15:52:06 01594_storage_join_uuid: [ OK ] 0.22 sec.
2026-02-05 15:52:06 03149_asof_join_ddb_timestamps: [ OK ] 0.27 sec.
2026-02-05 15:52:06 03269_partition_key_not_in_set: [ OK ] 0.37 sec.
2026-02-05 15:52:06 02790_fix_coredump_when_compile_expression: [ OK ] 0.17 sec.
2026-02-05 15:52:06 01944_insert_partition_by: [ OK ] 0.32 sec.
2026-02-05 15:52:07 01145_with_fill_const: [ OK ] 0.17 sec.
2026-02-05 15:52:07 03169_optimize_injective_functions_inside_uniq_crash: [ OK ] 0.17 sec.
2026-02-05 15:52:07 02456_datetime_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:52:07 01572_kill_window_function: [ OK ] 0.67 sec.
2026-02-05 15:52:07 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.37 sec.
2026-02-05 15:52:07 03229_json_structure_comparison: [ OK ] 0.22 sec.
2026-02-05 15:52:07 00359_convert_or_zero_functions: [ OK ] 0.17 sec.
2026-02-05 15:52:07 02251_alter_enum_nested_struct: [ OK ] 0.27 sec.
2026-02-05 15:52:08 02714_async_inserts_empty_data: [ OK ] 1.12 sec.
2026-02-05 15:52:08 01330_array_join_in_higher_order_function: [ OK ] 0.17 sec.
2026-02-05 15:52:08 02267_empty_arrays_read_reverse: [ OK ] 0.47 sec.
2026-02-05 15:52:08 02250_hints_for_columns: [ OK ] 1.07 sec.
2026-02-05 15:52:09 00013_create_table_with_arrays: [ OK ] 0.22 sec.
2026-02-05 15:52:09 02015_executable_user_defined_functions: [ OK ] 0.92 sec.
2026-02-05 15:52:09 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.12 sec.
2026-02-05 15:52:09 01446_json_strings_each_row: [ OK ] 4.49 sec.
2026-02-05 15:52:10 02713_array_low_cardinality_string: [ OK ] 0.17 sec.
2026-02-05 15:52:10 02021_map_has: [ OK ] 0.22 sec.
2026-02-05 15:52:10 02813_float_parsing: [ OK ] 0.17 sec.
2026-02-05 15:52:10 01527_bad_aggregation_in_lambda: [ OK ] 0.12 sec.
2026-02-05 15:52:10 00957_format_with_clashed_aliases: [ OK ] 0.42 sec.
2026-02-05 15:52:10 03038_move_partition_to_oneself_deadlock: [ OK ] 0.17 sec.
2026-02-05 15:52:10 00500_point_in_polygon_nan: [ OK ] 0.12 sec.
2026-02-05 15:52:10 00948_to_valid_utf8: [ OK ] 0.63 sec.
2026-02-05 15:52:10 01651_group_uniq_array_enum: [ OK ] 0.17 sec.
2026-02-05 15:52:10 01671_aggregate_function_group_bitmap_data: [ OK ] 0.22 sec.
2026-02-05 15:52:10 02410_csv_empty_fields_inference: [ OK ] 0.12 sec.
2026-02-05 15:52:10 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 2.98 sec.
2026-02-05 15:52:11 01033_storage_odbc_parsing_exception_check: [ OK ] 0.17 sec.
2026-02-05 15:52:11 01958_partial_hour_timezone: [ OK ] 0.22 sec.
2026-02-05 15:52:11 03103_positional_arguments: [ OK ] 0.17 sec.
2026-02-05 15:52:11 03003_prql_panic: [ OK ] 0.52 sec.
2026-02-05 15:52:11 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 9.65 sec.
2026-02-05 15:52:11 01634_summap_nullable: [ OK ] 0.17 sec.
2026-02-05 15:52:11 02527_storage_merge_prewhere_different_type: [ OK ] 0.22 sec.
2026-02-05 15:52:11 02918_alter_temporary_table: [ OK ] 0.17 sec.
2026-02-05 15:52:11 01666_gcd_ubsan: [ OK ] 0.27 sec.
2026-02-05 15:52:11 03222_parallel_replicas_final_in_subquery: [ OK ] 0.17 sec.
2026-02-05 15:52:11 01293_show_clusters: [ OK ] 0.67 sec.
2026-02-05 15:52:11 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.17 sec.
2026-02-05 15:52:12 02697_stop_reading_on_first_cancel: [ OK ] 0.67 sec.
2026-02-05 15:52:12 02502_bad_values_schema_inference: [ OK ] 0.12 sec.
2026-02-05 15:52:12 01711_cte_subquery_fix: [ OK ] 0.17 sec.
2026-02-05 15:52:12 00688_low_cardinality_serialization: [ OK ] 1.68 sec.
2026-02-05 15:52:12 01187_set_profile_as_setting: [ OK ] 0.77 sec.
2026-02-05 15:52:12 02994_merge_tree_mutations_cleanup: [ OK ] 10.50 sec.
2026-02-05 15:52:12 01710_aggregate_projection_with_normalized_states: [ OK ] 0.22 sec.
2026-02-05 15:52:13 02459_group_by_all: [ OK ] 0.22 sec.
2026-02-05 15:52:13 02160_client_autocomplete_parse_query: [ OK ] 1.63 sec.
2026-02-05 15:52:13 03014_invalid_utf8_client: [ OK ] 0.52 sec.
2026-02-05 15:52:13 00800_low_cardinality_array_group_by_arg: [ OK ] 0.27 sec.
2026-02-05 15:52:13 02461_join_lc_issue_42380: [ OK ] 0.22 sec.
2026-02-05 15:52:13 00459_group_array_insert_at: [ OK ] 0.17 sec.
2026-02-05 15:52:13 03262_test_parquet_native_reader_int_logical_type: [ OK ] 0.77 sec.
2026-02-05 15:52:13 00897_flatten: [ OK ] 0.17 sec.
2026-02-05 15:52:13 00476_pretty_formats_and_widths: [ OK ] 0.22 sec.
2026-02-05 15:52:13 03313_case_insensitive_json_type_declaration: [ OK ] 0.12 sec.
2026-02-05 15:52:13 02918_join_pm_lc_crash: [ OK ] 0.17 sec.
2026-02-05 15:52:13 01528_to_uuid_or_null_or_zero: [ OK ] 0.27 sec.
2026-02-05 15:52:14 01020_function_char: [ OK ] 0.18 sec.
2026-02-05 15:52:14 00126_buffer: [ OK ] 0.42 sec.
2026-02-05 15:52:14 02583_map_literal_cast: [ OK ] 0.22 sec.
2026-02-05 15:52:14 02677_analyzer_bitmap_has_any: [ OK ] 0.22 sec.
2026-02-05 15:52:14 02024_join_on_or_long: [ OK ] 1.22 sec.
2026-02-05 15:52:14 00342_escape_sequences: [ OK ] 0.17 sec.
2026-02-05 15:52:15 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.22 sec.
2026-02-05 15:52:15 03156_dynamic_type_concurrent_inserts: [ OK ] 0.87 sec.
2026-02-05 15:52:15 01210_drop_view: [ OK ] 0.17 sec.
2026-02-05 15:52:15 01069_set_in_group_by: [ OK ] 0.17 sec.
2026-02-05 15:52:15 03236_squashing_high_memory: [ OK ] 9.65 sec.
2026-02-05 15:52:15 00614_array_nullable: [ OK ] 0.17 sec.
2026-02-05 15:52:15 02918_multif_for_nullable: [ OK ] 0.97 sec.
2026-02-05 15:52:15 00500_point_in_polygon_bug_3_linestring_rotation_precision: [ OK ] 0.22 sec.
2026-02-05 15:52:15 02461_mullable_pk_monotonicity_bug: [ OK ] 0.37 sec.
2026-02-05 15:52:15 02004_intersect_except_operators: [ OK ] 0.52 sec.
2026-02-05 15:52:16 03101_analyzer_identifiers_4: [ OK ] 0.27 sec.
2026-02-05 15:52:16 00929_multi_match_edit_distance: [ OK ] 0.87 sec.
2026-02-05 15:52:16 00975_values_list: [ OK ] 0.22 sec.
2026-02-05 15:52:16 00999_nullable_nested_types_4877: [ OK ] 0.27 sec.
2026-02-05 15:52:16 01865_aggregator_overflow_row: [ OK ] 0.22 sec.
2026-02-05 15:52:16 03078_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.17 sec.
2026-02-05 15:52:16 00706_iso_week_and_day_of_year: [ OK ] 0.22 sec.
2026-02-05 15:52:16 02790_keyed_hash_bug: [ OK ] 0.12 sec.
2026-02-05 15:52:16 01474_bad_global_join: [ OK ] 0.23 sec.
2026-02-05 15:52:16 00836_indices_alter: [ OK ] 0.27 sec.
2026-02-05 15:52:16 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 2.68 sec.
2026-02-05 15:52:16 02971_functions_to_subcolumns_variant: [ OK ] 0.17 sec.
2026-02-05 15:52:17 02224_s2_test_const_columns: [ OK ] 0.17 sec.
2026-02-05 15:52:17 02481_parquet_list_monotonically_increasing_offsets: [ OK ] 32.07 sec.
2026-02-05 15:52:17 01764_collapsing_merge_adaptive_granularity: [ OK ] 0.42 sec.
2026-02-05 15:52:17 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.28 sec.
2026-02-05 15:52:17 00907_set_index_max_rows: [ OK ] 1.17 sec.
2026-02-05 15:52:17 02675_is_ipv6_function_fix: [ OK ] 0.18 sec.
2026-02-05 15:52:17 01889_tokenize: [ OK ] 0.17 sec.
2026-02-05 15:52:17 02494_combinators_with_null_argument: [ OK ] 0.22 sec.
2026-02-05 15:52:17 01732_bigint_ubsan: [ OK ] 0.22 sec.
2026-02-05 15:52:18 01651_bugs_from_15889: [ OK ] 1.48 sec.
2026-02-05 15:52:18 02833_tuple_concat: [ OK ] 0.27 sec.
2026-02-05 15:52:18 01925_join_materialized_columns: [ OK ] 0.52 sec.
2026-02-05 15:52:18 01284_port: [ OK ] 0.52 sec.
2026-02-05 15:52:18 02008_materialize_column: [ OK ] 0.37 sec.
2026-02-05 15:52:18 00046_stored_aggregates_simple: [ OK ] 0.22 sec.
2026-02-05 15:52:18 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.52 sec.
2026-02-05 15:52:18 03243_compatibility_setting_with_alias: [ OK ] 0.17 sec.
2026-02-05 15:52:18 02785_summing_merge_tree_datetime64: [ OK ] 0.22 sec.
2026-02-05 15:52:18 00393_if_with_constant_condition: [ OK ] 0.17 sec.
2026-02-05 15:52:19 01921_datatype_date32: [ OK ] 0.62 sec.
2026-02-05 15:52:19 03171_indexing_by_hilbert_curve: [ OK ] 0.47 sec.
2026-02-05 15:52:19 02393_every_metric_must_have_documentation: [ OK ] 0.17 sec.
2026-02-05 15:52:19 00940_max_parts_in_total: [ OK ] 0.22 sec.
2026-02-05 15:52:19 02274_full_sort_join_nodistinct: [ OK ] 3.18 sec.
2026-02-05 15:52:19 00836_indices_alter_replicated_zookeeper_long: [ OK ] 0.72 sec.
2026-02-05 15:52:19 02535_ip_parser_not_whole: [ OK ] 0.17 sec.
2026-02-05 15:52:19 01076_range_reader_segfault: [ OK ] 0.22 sec.
2026-02-05 15:52:19 00360_to_date_from_string_with_datetime: [ OK ] 0.17 sec.
2026-02-05 15:52:19 02023_nullable_int_uint_where: [ OK ] 0.17 sec.
2026-02-05 15:52:19 01511_different_expression_with_same_alias: [ OK ] 0.17 sec.
2026-02-05 15:52:19 02346_fulltext_index_bug59039: [ OK ] 0.12 sec.
2026-02-05 15:52:20 02318_template_schema_inference_bug: [ OK ] 0.17 sec.
2026-02-05 15:52:20 02293_grouping_function: [ OK ] 0.28 sec.
2026-02-05 15:52:20 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.65 sec.
2026-02-05 15:52:20 01548_query_log_query_execution_ms: [ OK ] 1.47 sec.
2026-02-05 15:52:20 02374_analyzer_join_using: [ OK ] 1.08 sec.
2026-02-05 15:52:20 01356_state_resample: [ OK ] 0.17 sec.
2026-02-05 15:52:20 02722_matcher_join_use_nulls: [ OK ] 0.62 sec.
2026-02-05 15:52:20 02354_vector_search_default_granularity: [ OK ] 0.22 sec.
2026-02-05 15:52:20 01602_modified_julian_day_msan: [ OK ] 0.27 sec.
2026-02-05 15:52:21 03261_variant_permutation_bug: [ OK ] 0.17 sec.
2026-02-05 15:52:21 03290_dictionary_assert_on_function: [ OK ] 0.17 sec.
2026-02-05 15:52:21 01889_clickhouse_client_config_format: [ OK ] 1.57 sec.
2026-02-05 15:52:21 02265_per_table_ttl_mutation_on_change: [ OK ] 0.34 sec.
2026-02-05 15:52:21 03095_window_functions_qualify: [ OK ] 0.32 sec.
2026-02-05 15:52:21 03246_json_subcolumn_correct_type: [ OK ] 0.32 sec.
2026-02-05 15:52:21 00191_aggregating_merge_tree_and_final: [ OK ] 0.28 sec.
2026-02-05 15:52:22 00760_url_functions_overflow: [ OK ] 0.23 sec.
2026-02-05 15:52:22 01248_least_greatest_mixed_const: [ OK ] 0.17 sec.
2026-02-05 15:52:22 01277_random_fixed_string: [ OK ] 1.53 sec.
2026-02-05 15:52:22 02582_async_reading_with_small_limit: [ OK ] 0.44 sec.
2026-02-05 15:52:22 01213_alter_rename_with_default_zookeeper_long: [ OK ] 0.52 sec.
2026-02-05 15:52:22 00577_full_join_segfault: [ OK ] 0.23 sec.
2026-02-05 15:52:23 01710_projection_with_mixed_pipeline: [ OK ] 0.37 sec.
2026-02-05 15:52:23 02532_profileevents_server_startup_time: [ OK ] 0.19 sec.
2026-02-05 15:52:23 01605_adaptive_granularity_block_borders: [ OK ] 10.82 sec.
2026-02-05 15:52:23 00586_removing_unused_columns_from_subquery: [ OK ] 0.52 sec.
2026-02-05 15:52:23 03214_backup_and_clear_old_temporary_directories: [ OK ] 3.59 sec.
2026-02-05 15:52:23 02956_clickhouse_local_system_parts: [ OK ] 1.18 sec.
2026-02-05 15:52:24 02867_nullable_primary_key_final: [ OK ] 0.94 sec.
2026-02-05 15:52:24 01268_shard_avgweighted: [ OK ] 0.58 sec.
2026-02-05 15:52:24 02908_filesystem_cache_as_collection: [ OK ] 0.34 sec.
2026-02-05 15:52:24 02706_kolmogorov_smirnov_test: [ OK ] 0.53 sec.
2026-02-05 15:52:24 01891_not_like_partition_prune: [ OK ] 0.23 sec.
2026-02-05 15:52:24 02551_obfuscator_keywords: [ OK ] 0.83 sec.
2026-02-05 15:52:24 02341_global_join_cte: [ OK ] 0.39 sec.
2026-02-05 15:52:24 01518_nullable_aggregate_states1: [ OK ] 0.23 sec.
2026-02-05 15:52:25 02792_drop_projection_lwd: [ OK ] 0.22 sec.
2026-02-05 15:52:25 03001_bad_error_message_higher_order_functions: [ OK ] 0.79 sec.
2026-02-05 15:52:25 02988_ordinary_database_warning: [ OK ] 0.17 sec.
2026-02-05 15:52:25 02367_optimize_trivial_count_with_array_join: [ OK ] 0.37 sec.
2026-02-05 15:52:25 02481_fix_parameters_parsing: [ OK ] 0.18 sec.
2026-02-05 15:52:25 02018_multiple_with_fill_for_the_same_column: [ OK ] 0.19 sec.
2026-02-05 15:52:25 00123_shard_unmerged_result_when_max_distributed_connections_is_one: [ OK ] 0.18 sec.
2026-02-05 15:52:25 00644_different_expressions_with_same_alias: [ OK ] 0.32 sec.
2026-02-05 15:52:25 00831_quantile_weighted_parameter_check: [ OK ] 0.17 sec.
2026-02-05 15:52:26 03001_parallel_parsing_deadlock: [ OK ] 5.39 sec.
2026-02-05 15:52:26 01528_play: [ OK ] 0.42 sec.
2026-02-05 15:52:26 01166_truncate_multiple_partitions: [ OK ] 0.57 sec.
2026-02-05 15:52:26 02373_analyzer_join_use_nulls: [ OK ] 0.32 sec.
2026-02-05 15:52:26 01661_arraySlice_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:52:26 02902_diable_apply_deleted_mask: [ OK ] 0.28 sec.
2026-02-05 15:52:26 01532_clickhouse_local_tmp_folder: [ OK ] 0.52 sec.
2026-02-05 15:52:26 02783_parallel_replicas_trivial_count_optimization: [ OK ] 1.93 sec.
2026-02-05 15:52:26 02481_aggregation_in_order_plan: [ OK ] 0.22 sec.
2026-02-05 15:52:27 01495_subqueries_in_with_statement: [ OK ] 0.37 sec.
2026-02-05 15:52:27 01073_window_view_event_tumble_to_asc_populate: [ OK ] 1.58 sec.
2026-02-05 15:52:27 02125_lz4_compression_bug_TSKV: [ OK ] 3.58 sec.
2026-02-05 15:52:27 02796_projection_date_filter_on_view: [ OK ] 0.72 sec.
2026-02-05 15:52:27 02025_having_filter_column: [ OK ] 0.22 sec.
2026-02-05 15:52:27 02876_yyyymmddhhmmsstodatetime: [ OK ] 0.62 sec.
2026-02-05 15:52:27 01074_window_view_event_tumble_asc_join_populate: [ OK ] 1.48 sec.
2026-02-05 15:52:28 02732_transform_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:52:28 01290_empty_array_index_analysis: [ OK ] 0.37 sec.
2026-02-05 15:52:28 00125_array_element_of_array_of_tuple: [ OK ] 0.17 sec.
2026-02-05 15:52:28 02596_build_set_and_remote: [ OK ] 0.42 sec.
2026-02-05 15:52:28 00098_e_union_all: [ OK ] 0.22 sec.
2026-02-05 15:52:28 02311_system_zookeeper_insert: [ OK ] 0.38 sec.
2026-02-05 15:52:28 00972_geohashesInBox: [ OK ] 0.62 sec.
2026-02-05 15:52:28 03174_merge_join_bug: [ OK ] 0.12 sec.
2026-02-05 15:52:28 02221_system_zookeeper_unrestricted_like: [ OK ] 1.72 sec.
2026-02-05 15:52:28 00601_kill_running_query: [ OK ] 0.47 sec.
2026-02-05 15:52:29 03031_table_function_fuzzquery: [ OK ] 0.17 sec.
2026-02-05 15:52:29 03076_analyzer_multiple_joins_alias: [ OK ] 0.17 sec.
2026-02-05 15:52:29 00283_column_cut: [ OK ] 0.12 sec.
2026-02-05 15:52:29 02499_monotonicity_toUnixTimestamp64: [ OK ] 0.97 sec.
2026-02-05 15:52:29 00394_new_nested_column_keeps_offsets: [ OK ] 0.27 sec.
2026-02-05 15:52:29 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.22 sec.
2026-02-05 15:52:29 02921_database_filesystem_path_check: [ OK ] 0.12 sec.
2026-02-05 15:52:29 01710_projection_drop_if_exists: [ OK ] 0.12 sec.
2026-02-05 15:52:29 02785_date_predicate_optimizations_ast_query_tree_rewrite: [ OK ] 0.42 sec.
2026-02-05 15:52:29 00919_sum_aggregate_states_constants: [ OK ] 0.17 sec.
2026-02-05 15:52:29 01710_projection_in_index: [ OK ] 0.27 sec.
2026-02-05 15:52:29 00431_if_nulls: [ OK ] 0.67 sec.
2026-02-05 15:52:29 01710_projections_optimize_aggregation_in_order: [ OK ] 2.98 sec.
2026-02-05 15:52:29 03148_mutations_virtual_columns: [ OK ] 0.22 sec.
2026-02-05 15:52:30 02834_array_exists_segfault: [ OK ] 0.17 sec.
2026-02-05 15:52:30 01070_h3_hex_area_m2: [ OK ] 0.18 sec.
2026-02-05 15:52:30 03215_udf_with_union: [ OK ] 0.17 sec.
2026-02-05 15:52:30 00031_parser_number: [ OK ] 0.17 sec.
2026-02-05 15:52:30 01768_array_product: [ OK ] 0.27 sec.
2026-02-05 15:52:30 01019_Buffer_and_max_memory_usage: [ OK ] 0.97 sec.
2026-02-05 15:52:30 02336_sort_optimization_with_fill: [ OK ] 0.22 sec.
2026-02-05 15:52:30 00650_csv_with_specified_quote_rule: [ OK ] 2.48 sec.
2026-02-05 15:52:30 02885_ephemeral_columns_from_file: [ OK ] 1.38 sec.
2026-02-05 15:52:30 01300_group_by_other_keys_having: [ OK ] 1.02 sec.
2026-02-05 15:52:31 02269_insert_select_with_format_without_schema_inference: [ OK ] 0.17 sec.
2026-02-05 15:52:31 02751_parallel_replicas_bug_chunkinfo_not_set: [ OK ] 0.17 sec.
2026-02-05 15:52:31 03143_parallel_replicas_mat_view_bug: [ OK ] 0.22 sec.
2026-02-05 15:52:31 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.37 sec.
2026-02-05 15:52:31 02313_test_fpc_codec: [ OK ] 0.32 sec.
2026-02-05 15:52:31 02000_table_function_cluster_macros: [ OK ] 0.17 sec.
2026-02-05 15:52:31 00688_case_without_else: [ OK ] 0.22 sec.
2026-02-05 15:52:31 00087_distinct_of_empty_arrays: [ OK ] 0.17 sec.
2026-02-05 15:52:31 03146_parameterized_view_with_date: [ OK ] 0.22 sec.
2026-02-05 15:52:31 00983_summing_merge_tree_not_an_identifier: [ OK ] 0.12 sec.
2026-02-05 15:52:31 01058_window_view_event_hop_to_strict_asc: [ OK ] 1.32 sec.
2026-02-05 15:52:31 02768_into_outfile_extensions_format: [ OK ] 0.42 sec.
2026-02-05 15:52:31 01232_untuple: [ OK ] 0.27 sec.
2026-02-05 15:52:31 02683_native_too_large_size: [ OK ] 0.17 sec.
2026-02-05 15:52:31 01254_dict_create_without_db: [ OK ] 0.22 sec.
2026-02-05 15:52:31 01279_dist_group_by: [ OK ] 0.22 sec.
2026-02-05 15:52:32 02987_logical_optimizer_pass_lowcardinality: [ OK ] 0.17 sec.
2026-02-05 15:52:32 02901_analyzer_recursive_window: [ OK ] 0.22 sec.
2026-02-05 15:52:32 03009_format_show_database: [ OK ] 0.67 sec.
2026-02-05 15:52:32 02960_polygon_bound_bug: [ OK ] 0.62 sec.
2026-02-05 15:52:32 00819_ast_refactoring_bugs: [ OK ] 0.22 sec.
2026-02-05 15:52:32 03068_analyzer_distributed_join: [ OK ] 0.32 sec.
2026-02-05 15:52:32 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.17 sec.
2026-02-05 15:52:32 00006_extremes_and_subquery_from: [ OK ] 0.17 sec.
2026-02-05 15:52:32 02041_openssl_hash_functions_test: [ OK ] 0.17 sec.
2026-02-05 15:52:32 01085_max_distributed_connections: [ OK ] 1.52 sec.
2026-02-05 15:52:32 02428_index_analysis_with_null_literal: [ OK ] 0.77 sec.
2026-02-05 15:52:32 01913_summing_mt_and_simple_agg_function_with_lc: [ OK ] 0.17 sec.
2026-02-05 15:52:32 02067_lost_part_s3: [ OK ] 12.46 sec.
2026-02-05 15:52:32 00707_float_csv_delimiter: [ OK ] 0.22 sec.
2026-02-05 15:52:32 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.22 sec.
2026-02-05 15:52:32 01252_weird_time_zone: [ OK ] 0.57 sec.
2026-02-05 15:52:33 02122_4letter_words_stress_zookeeper: [ OK ] 16.63 sec.
2026-02-05 15:52:33 03057_analyzer_subquery_alias_join: [ OK ] 0.22 sec.
2026-02-05 15:52:33 03131_deprecated_functions: [ OK ] 0.22 sec.
2026-02-05 15:52:33 00961_visit_param_buffer_underflow: [ OK ] 0.12 sec.
2026-02-05 15:52:33 02736_bit_count_big_int: [ OK ] 0.17 sec.
2026-02-05 15:52:33 00339_parsing_bad_arrays: [ OK ] 0.47 sec.
2026-02-05 15:52:33 00977_join_use_nulls_denny_crane: [ OK ] 0.37 sec.
2026-02-05 15:52:33 01020_having_without_group_by: [ OK ] 0.17 sec.
2026-02-05 15:52:33 00678_shard_funnel_window: [ OK ] 0.27 sec.
2026-02-05 15:52:33 01161_information_schema: [ OK ] 0.37 sec.
2026-02-05 15:52:33 02869_http_headers_elapsed_ns: [ OK ] 0.52 sec.
2026-02-05 15:52:34 02431_single_value_or_null_empty: [ OK ] 0.17 sec.
2026-02-05 15:52:34 01076_array_join_prewhere_const_folding: [ OK ] 0.37 sec.
2026-02-05 15:52:34 03036_dynamic_read_subcolumns_memory: [ OK ] 0.97 sec.
2026-02-05 15:52:34 01279_empty_external_table: [ OK ] 0.82 sec.
2026-02-05 15:52:34 03230_anyHeavy_merge: [ OK ] 0.22 sec.
2026-02-05 15:52:34 00630_arbitrary_csv_delimiter: [ OK ] 2.78 sec.
2026-02-05 15:52:34 00700_decimal_round: [ OK ] 0.47 sec.
2026-02-05 15:52:35 01533_distinct_depends_on_max_threads: [ OK ] 0.27 sec.
2026-02-05 15:52:35 02968_mysql_show_warnings: [ OK ] 0.62 sec.
2026-02-05 15:52:35 03015_analyzer_groupby_fuzz_60772: [ OK ] 0.12 sec.
2026-02-05 15:52:35 01710_projection_with_ast_rewrite_settings: [ OK ] 0.27 sec.
2026-02-05 15:52:35 01621_clickhouse_compressor: [ OK ] 0.62 sec.
2026-02-05 15:52:35 03033_scalars_context_data_race: [ OK ] 0.27 sec.
2026-02-05 15:52:35 02902_show_databases_limit: [ OK ] 0.17 sec.
2026-02-05 15:52:35 01072_nullable_jit: [ OK ] 0.22 sec.
2026-02-05 15:52:35 02562_native_tskv_default_for_omitted_fields: [ OK ] 2.03 sec.
2026-02-05 15:52:35 01063_create_column_set: [ OK ] 0.17 sec.
2026-02-05 15:52:35 02395_every_merge_tree_setting_must_have_documentation: [ OK ] 0.17 sec.
2026-02-05 15:52:35 02302_lc_nullable_string_insert_as_number: [ OK ] 0.22 sec.
2026-02-05 15:52:35 01181_db_atomic_drop_on_cluster: [ OK ] 0.42 sec.
2026-02-05 15:52:35 02579_fill_empty_chunk_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:52:35 02191_nested_with_dots: [ OK ] 0.27 sec.
2026-02-05 15:52:36 00864_union_all_supertype: [ OK ] 0.22 sec.
2026-02-05 15:52:36 02946_parallel_replicas_force_primary_key: [ OK ] 0.42 sec.
2026-02-05 15:52:36 02404_lightweight_delete_vertical_merge: [ OK ] 0.42 sec.
2026-02-05 15:52:36 02724_delay_mutations: [ OK ] 3.48 sec.
2026-02-05 15:52:36 03033_recursive_cte_basic: [ OK ] 0.32 sec.
2026-02-05 15:52:36 02833_local_with_dialect: [ OK ] 0.52 sec.
2026-02-05 15:52:36 02345_filesystem_local: [ OK ] 0.52 sec.
2026-02-05 15:52:36 01961_roaring_memory_tracking: [ OK ] 3.93 sec.
2026-02-05 15:52:36 00098_c_union_all: [ OK ] 0.17 sec.
2026-02-05 15:52:36 02504_bar_fractions: [ OK ] 0.13 sec.
2026-02-05 15:52:36 01359_geodistance_loop: [ OK ] 0.17 sec.
2026-02-05 15:52:36 01851_fix_row_policy_empty_result: [ OK ] 0.22 sec.
2026-02-05 15:52:37 01137_order_by_func_final: [ OK ] 0.22 sec.
2026-02-05 15:52:37 02122_parallel_formatting_CustomSeparated: [ OK ] 1.33 sec.
2026-02-05 15:52:37 01560_optimize_on_insert_zookeeper: [ OK ] 0.32 sec.
2026-02-05 15:52:37 02025_subcolumns_compact_parts: [ OK ] 0.17 sec.
2026-02-05 15:52:37 02524_fuzz_and_fuss_2: [ OK ] 0.17 sec.
2026-02-05 15:52:37 03273_dynamic_pretty_json_serialization: [ OK ] 0.17 sec.
2026-02-05 15:52:37 01646_fix_window_funnel_inconistency: [ OK ] 0.17 sec.
2026-02-05 15:52:37 03201_avro_negative_block_size_arrays: [ OK ] 0.57 sec.
2026-02-05 15:52:37 02477_single_value_data_string_regression: [ OK ] 0.47 sec.
2026-02-05 15:52:37 03111_inner_join_group_by: [ OK ] 0.12 sec.
2026-02-05 15:52:37 02302_column_decl_null_before_defaul_value: [ OK ] 0.42 sec.
2026-02-05 15:52:37 02988_join_using_prewhere_pushdown: [ OK ] 0.17 sec.
2026-02-05 15:52:37 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.17 sec.
2026-02-05 15:52:37 02267_insert_empty_data: [ OK ] 0.12 sec.
2026-02-05 15:52:37 01881_aggregate_functions_versioning: [ OK ] 0.17 sec.
2026-02-05 15:52:37 01390_remove_injective_in_uniq: [ OK ] 0.17 sec.
2026-02-05 15:52:38 02772_jit_date_time_add: [ OK ] 0.17 sec.
2026-02-05 15:52:38 01547_query_log_current_database: [ OK ] 0.32 sec.
2026-02-05 15:52:38 03167_empty_tuple_concat: [ OK ] 0.17 sec.
2026-02-05 15:52:38 02842_table_function_file_filter_by_virtual_columns: [ OK ] 0.62 sec.
2026-02-05 15:52:38 02911_analyzer_explain_estimate: [ OK ] 0.17 sec.
2026-02-05 15:52:38 02266_protobuf_format_google_wrappers: [ OK ] 2.17 sec.
2026-02-05 15:52:38 01881_negate_formatting: [ OK ] 0.17 sec.
2026-02-05 15:52:38 02946_merge_tree_final_split_ranges_by_primary_key: [ OK ] 0.27 sec.
2026-02-05 15:52:38 00552_logical_functions_uint8_as_bool: [ OK ] 0.17 sec.
2026-02-05 15:52:38 02113_format_row: [ OK ] 0.17 sec.
2026-02-05 15:52:38 01774_bar_with_illegal_value: [ OK ] 0.12 sec.
2026-02-05 15:52:38 01640_marks_corruption_regression: [ OK ] 0.22 sec.
2026-02-05 15:52:38 02868_operator_is_not_distinct_from_priority: [ OK ] 0.17 sec.
2026-02-05 15:52:38 00973_create_table_as_table_function: [ OK ] 0.22 sec.
2026-02-05 15:52:39 01558_transform_null_in: [ OK ] 0.27 sec.
2026-02-05 15:52:39 01662_date_ubsan: [ OK ] 0.42 sec.
2026-02-05 15:52:39 00027_argMinMax: [ OK ] 0.17 sec.
2026-02-05 15:52:39 00589_removal_unused_columns_aggregation: [ OK ] 0.17 sec.
2026-02-05 15:52:40 01061_window_view_event_hop_to_asc: [ OK ] 1.17 sec.
2026-02-05 15:52:40 01822_short_circuit: [ OK ] 0.52 sec.
2026-02-05 15:52:40 02961_read_bool_as_string_json: [ OK ] 0.22 sec.
2026-02-05 15:52:40 02149_schema_inference_create_table_syntax: [ OK ] 2.38 sec.
2026-02-05 15:52:41 00679_replace_asterisk: [ OK ] 0.17 sec.
2026-02-05 15:52:41 00990_metric_log_table_not_empty: [ OK ] 2.18 sec.
2026-02-05 15:52:41 01756_optimize_skip_unused_shards_rewrite_in: [ OK ] 1.12 sec.
2026-02-05 15:52:41 02481_analyzer_join_alias_unknown_identifier_crash: [ OK ] 0.17 sec.
2026-02-05 15:52:41 01641_memory_tracking_insert_optimize: [ OK ] 0.37 sec.
2026-02-05 15:52:41 02883_array_scalar_mult_div_modulo: [ OK ] 0.27 sec.
2026-02-05 15:52:42 02703_row_policy_for_database: [ OK ] 0.88 sec.
2026-02-05 15:52:42 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 5.43 sec.
2026-02-05 15:52:42 02890_named_tuple_functions: [ OK ] 0.27 sec.
2026-02-05 15:52:42 01338_sha256_fixedstring: [ OK ] 0.22 sec.
2026-02-05 15:52:43 01544_errorCodeToName: [ OK ] 0.17 sec.
2026-02-05 15:52:43 00800_function_java_hash: [ OK ] 0.17 sec.
2026-02-05 15:52:43 00941_to_custom_week: [ OK ] 0.27 sec.
2026-02-05 15:52:43 02971_limit_by_distributed: [ OK ] 0.22 sec.
2026-02-05 15:52:44 01142_merge_join_lc_and_nullable_in_key: [ OK ] 0.32 sec.
2026-02-05 15:52:44 00700_decimal_array_functions: [ OK ] 0.22 sec.
2026-02-05 15:52:44 00964_os_thread_priority: [ OK ] 0.17 sec.
2026-02-05 15:52:44 00682_empty_parts_merge: [ OK ] 6.79 sec.
2026-02-05 15:52:44 02885_arg_min_max_combinator: [ OK ] 0.22 sec.
2026-02-05 15:52:44 01375_null_issue_3767: [ OK ] 0.17 sec.
2026-02-05 15:52:45 00285_not_all_data_in_totals: [ OK ] 0.17 sec.
2026-02-05 15:52:45 00677_shard_any_heavy_merge: [ OK ] 0.17 sec.
2026-02-05 15:52:45 01051_aggregate_function_crash: [ OK ] 0.12 sec.
2026-02-05 15:52:45 00994_table_function_numbers_mt: [ OK ] 0.17 sec.
2026-02-05 15:52:45 03047_group_by_field_identified_aggregation: [ OK ] 0.17 sec.
2026-02-05 15:52:45 02530_ip_part_id: [ OK ] 0.22 sec.
2026-02-05 15:52:45 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.17 sec.
2026-02-05 15:52:45 02125_query_views_log: [ OK ] 0.37 sec.
2026-02-05 15:52:45 03159_dynamic_type_all_types: [ OK ] 0.32 sec.
2026-02-05 15:52:46 02475_positive_modulo: [ OK ] 0.17 sec.
2026-02-05 15:52:46 00411_long_accurate_number_comparison_int3: [ OK ] 4.13 sec.
2026-02-05 15:52:46 03146_bug47862: [ OK ] 0.12 sec.
2026-02-05 15:52:46 01916_lowcard_dict_type: [ OK ] 0.22 sec.
2026-02-05 15:52:46 00725_join_on_bug_3: [ OK ] 0.22 sec.
2026-02-05 15:52:46 00947_ml_test: [ OK ] 0.27 sec.
2026-02-05 15:52:46 01017_bithamming_distance: [ OK ] 0.22 sec.
2026-02-05 15:52:46 00007_array: [ OK ] 0.22 sec.
2026-02-05 15:52:46 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 0.62 sec.
2026-02-05 15:52:46 01847_bad_like: [ OK ] 0.22 sec.
2026-02-05 15:52:46 03170_part_offset_as_table_column: [ OK ] 0.17 sec.
2026-02-05 15:52:47 02430_initialize_aggregation_with_combinators: [ OK ] 0.17 sec.
2026-02-05 15:52:47 01034_unknown_qualified_column_in_join: [ OK ] 0.22 sec.
2026-02-05 15:52:47 03087_analyzer_subquery_with_alias: [ OK ] 0.12 sec.
2026-02-05 15:52:47 00741_client_comment_multiline: [ OK ] 0.12 sec.
2026-02-05 15:52:47 00293_shard_max_subquery_depth: [ OK ] 0.22 sec.
2026-02-05 15:52:47 00996_limit_with_ties: [ OK ] 0.32 sec.
2026-02-05 15:52:47 02909_settings_in_json_schema_cache: [ OK ] 0.53 sec.
2026-02-05 15:52:48 00647_histogram_negative: [ OK ] 0.17 sec.
2026-02-05 15:52:48 03094_recursive_type_proto: [ OK ] 0.62 sec.
2026-02-05 15:52:48 02420_key_condition_actions_dag_bug_40599: [ OK ] 0.27 sec.
2026-02-05 15:52:48 00732_decimal_summing_merge_tree: [ OK ] 0.17 sec.
2026-02-05 15:52:48 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.22 sec.
2026-02-05 15:52:48 02377_modify_column_from_nested: [ OK ] 0.22 sec.
2026-02-05 15:52:49 01051_random_printable_ascii: [ OK ] 0.17 sec.
2026-02-05 15:52:49 03040_dynamic_type_alters_1_compact_merge_tree: [ OK ] 0.52 sec.
2026-02-05 15:52:49 01710_normal_projection_join_plan_fix: [ OK ] 0.22 sec.
2026-02-05 15:52:49 01355_if_fixed_string: [ OK ] 0.22 sec.
2026-02-05 15:52:49 01823_array_low_cardinality_KuliginStepan: [ OK ] 0.17 sec.
2026-02-05 15:52:49 00387_use_client_time_zone: [ OK ] 0.52 sec.
2026-02-05 15:52:50 01596_setting_limit_offset: [ OK ] 0.27 sec.
2026-02-05 15:52:50 02967_mysql_settings_override: [ OK ] 0.62 sec.
2026-02-05 15:52:50 02902_add_scalar_in_all_case: [ OK ] 0.17 sec.
2026-02-05 15:52:51 01115_prewhere_array_join: [ OK ] 0.77 sec.
2026-02-05 15:52:51 03032_async_backup_restore: [ OK ] 1.27 sec.
2026-02-05 15:52:51 00976_asof_join_on: [ OK ] 0.47 sec.
2026-02-05 15:52:51 03150_dynamic_type_mv_insert: [ OK ] 0.32 sec.
2026-02-05 15:52:52 03001_data_version_column: [ OK ] 0.17 sec.
2026-02-05 15:52:52 02149_schema_inference_formats_with_schema_1: [ OK ] 9.50 sec.
2026-02-05 15:52:52 02771_if_constant_folding: [ OK ] 0.12 sec.
2026-02-05 15:52:52 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.22 sec.
2026-02-05 15:52:52 01318_map_add_map_subtract_on_map_type: [ OK ] 0.32 sec.
2026-02-05 15:52:52 00544_agg_foreach_of_two_arg: [ OK ] 0.17 sec.
2026-02-05 15:52:52 02685_decimal256_various: [ OK ] 0.32 sec.
2026-02-05 15:52:52 02116_clickhouse_stderr: [ OK ] 1.27 sec.
2026-02-05 15:52:53 02900_decimal_sort_with_multiple_columns: [ OK ] 0.12 sec.
2026-02-05 15:52:53 02193_async_insert_tcp_client_2: [ OK ] 6.44 sec.
2026-02-05 15:52:53 03091_analyzer_same_table_name_in_different_databases: [ OK ] 0.17 sec.
2026-02-05 15:52:53 02916_addcolumn_nested: [ OK ] 0.27 sec.
2026-02-05 15:52:53 03031_clickhouse_local_input: [ OK ] 0.83 sec.
2026-02-05 15:52:53 02974_backup_query_format_null: [ OK ] 0.92 sec.
2026-02-05 15:52:53 02916_glogal_in_cancel: [ OK ] 0.62 sec.
2026-02-05 15:52:53 03130_convert_outer_join_to_inner_join: [ OK ] 0.22 sec.
2026-02-05 15:52:53 00615_nullable_alter_optimize: [ OK ] 0.22 sec.
2026-02-05 15:52:54 02904_distributed_settings_background_insert_compatibility: [ OK ] 0.37 sec.
2026-02-05 15:52:54 01514_input_format_json_enum_as_number: [ OK ] 0.22 sec.
2026-02-05 15:52:54 01660_sum_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:52:54 00927_disable_hyperscan: [ OK ] 0.27 sec.
2026-02-05 15:52:54 00607_index_in_in: [ OK ] 0.22 sec.
2026-02-05 15:52:54 00552_logical_functions_ternary: [ OK ] 0.22 sec.
2026-02-05 15:52:54 03008_deduplication_remote_insert_select: [ OK ] 0.32 sec.
2026-02-05 15:52:54 02249_parse_date_time_basic: [ OK ] 0.22 sec.
2026-02-05 15:52:54 01754_clickhouse_format_backslash: [ OK ] 0.47 sec.
2026-02-05 15:52:54 02000_join_on_const: [ OK ] 0.47 sec.
2026-02-05 15:52:54 02794_pushdown_invalid_get: [ OK ] 0.17 sec.
2026-02-05 15:52:54 02594_msgpack_more_types: [ OK ] 0.57 sec.
2026-02-05 15:52:54 01710_projection_with_joins: [ OK ] 0.22 sec.
2026-02-05 15:52:55 03200_memory_engine_alter_dynamic: [ OK ] 0.18 sec.
2026-02-05 15:52:55 03246_json_tuple_decompress_race: [ OK ] 0.32 sec.
2026-02-05 15:52:55 01132_max_rows_to_read: [ OK ] 0.22 sec.
2026-02-05 15:52:55 00578_merge_table_shadow_virtual_column: [ OK ] 0.22 sec.
2026-02-05 15:52:55 03033_analyzer_query_parameters: [ OK ] 0.57 sec.
2026-02-05 15:52:55 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.37 sec.
2026-02-05 15:52:55 01278_alter_rename_combination: [ OK ] 0.27 sec.
2026-02-05 15:52:55 02001_hostname_test: [ OK ] 0.22 sec.
2026-02-05 15:52:55 02332_dist_insert_send_logs_level: [ OK ] 0.62 sec.
2026-02-05 15:52:55 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.17 sec.
2026-02-05 15:52:55 02809_prewhere_and_in: [ OK ] 0.32 sec.
2026-02-05 15:52:56 01942_dateTimeToSnowflakeID: [ OK ] 0.32 sec.
2026-02-05 15:52:56 02475_bson_each_row_format: [ OK ] 15.11 sec.
2026-02-05 15:52:56 01278_variance_nonnegative: [ OK ] 0.27 sec.
2026-02-05 15:52:56 01262_fractional_timezone_near_start_of_epoch: [ OK ] 0.22 sec.
2026-02-05 15:52:56 01600_benchmark_query: [ OK ] 0.67 sec.
2026-02-05 15:52:56 00688_low_cardinality_nullable_cast: [ OK ] 0.17 sec.
2026-02-05 15:52:56 02437_drop_mv_restart_replicas: [ OK ] 16.02 sec.
2026-02-05 15:52:56 01069_database_memory: [ OK ] 0.17 sec.
2026-02-05 15:52:56 02947_merge_tree_index_table_1: [ OK ] 0.22 sec.
2026-02-05 15:52:56 01720_union_distinct_with_limit: [ OK ] 0.17 sec.
2026-02-05 15:52:56 02572_max_intersections: [ OK ] 0.12 sec.
2026-02-05 15:52:56 01428_h3_range_check: [ OK ] 0.17 sec.
2026-02-05 15:52:56 00098_5_union_all: [ OK ] 0.22 sec.
2026-02-05 15:52:56 01825_type_json_add_column: [ SKIPPED ] 0.00 sec.
2026-02-05 15:52:56 Reason: disabled
2026-02-05 15:52:56 00373_group_by_tuple: [ OK ] 0.17 sec.
2026-02-05 15:52:56 03037_dynamic_merges_2_vertical_wide_merge_tree: [ OK ] 0.37 sec.
2026-02-05 15:52:56 03034_recursive_cte_tree: [ OK ] 0.27 sec.
2026-02-05 15:52:56 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.17 sec.
2026-02-05 15:52:57 00955_test_final_mark: [ OK ] 0.57 sec.
2026-02-05 15:52:57 02346_inverted_index_experimental_flag: [ OK ] 0.32 sec.
2026-02-05 15:52:57 02354_vector_search_legacy_index_compatibility: [ OK ] 0.22 sec.
2026-02-05 15:52:57 02183_dictionary_date_types: [ OK ] 0.52 sec.
2026-02-05 15:52:57 02016_summing_mt_aggregating_column: [ OK ] 0.22 sec.
2026-02-05 15:52:57 00942_mutate_index: [ OK ] 1.32 sec.
2026-02-05 15:52:57 00998_constraints_all_tables: [ OK ] 0.42 sec.
2026-02-05 15:52:57 02310_clickhouse_local_INSERT_progress_profile_events: [ OK ] 0.57 sec.
2026-02-05 15:52:57 01720_country_perimeter_and_area: [ OK ] 2.23 sec.
2026-02-05 15:52:58 01560_optimize_on_insert_long: [ OK ] 0.32 sec.
2026-02-05 15:52:58 03231_dynamic_uniq_group_by: [ OK ] 0.17 sec.
2026-02-05 15:52:58 01650_drop_part_and_deduplication_zookeeper_long: [ OK ] 0.27 sec.
2026-02-05 15:52:58 01632_max_partitions_to_read: [ OK ] 0.22 sec.
2026-02-05 15:52:58 02122_parallel_formatting_TSVWithNames: [ OK ] 1.27 sec.
2026-02-05 15:52:58 02771_jit_functions_comparison_crash: [ OK ] 0.17 sec.
2026-02-05 15:52:58 01825_new_type_json_partitions: [ OK ] 0.17 sec.
2026-02-05 15:52:58 03519_ttl_extended_data_types: [ OK ] 0.32 sec.
2026-02-05 15:52:58 00804_test_delta_codec_no_type_alter: [ OK ] 0.17 sec.
2026-02-05 15:52:58 01280_min_map_max_map: [ OK ] 0.32 sec.
2026-02-05 15:52:58 02246_clickhouse_local_drop_database: [ OK ] 0.82 sec.
2026-02-05 15:52:58 01852_cast_operator: [ OK ] 0.22 sec.
2026-02-05 15:52:58 01933_invalid_date: [ OK ] 0.27 sec.
2026-02-05 15:52:58 00437_nulls_first_last: [ OK ] 0.27 sec.
2026-02-05 15:52:58 03003_compatibility_setting_bad_value: [ OK ] 0.12 sec.
2026-02-05 15:52:58 03001_insert_threads_deduplication: [ OK ] 0.27 sec.
2026-02-05 15:52:59 02933_local_system_setting: [ OK ] 0.52 sec.
2026-02-05 15:52:59 02985_dialects_with_distributed_tables: [ OK ] 0.27 sec.
2026-02-05 15:52:59 02950_part_offset_as_primary_key: [ OK ] 0.27 sec.
2026-02-05 15:52:59 00914_replicate: [ OK ] 0.17 sec.
2026-02-05 15:52:59 02012_settings_clause_for_s3: [ OK ] 0.17 sec.
2026-02-05 15:52:59 01050_group_array_sample: [ OK ] 0.12 sec.
2026-02-05 15:52:59 02707_skip_index_with_in: [ OK ] 0.17 sec.
2026-02-05 15:52:59 00837_minmax_index: [ OK ] 1.33 sec.
2026-02-05 15:52:59 00268_aliases_without_as_keyword: [ OK ] 0.17 sec.
2026-02-05 15:52:59 03032_multi_search_const_low_cardinality: [ OK ] 0.17 sec.
2026-02-05 15:52:59 01622_codec_zstd_long: [ OK ] 0.32 sec.
2026-02-05 15:52:59 03150_url_hash_non_constant_level: [ OK ] 0.17 sec.
2026-02-05 15:53:00 03227_test_sample_n: [ OK ] 0.22 sec.
2026-02-05 15:53:00 02958_transform_enum: [ OK ] 0.17 sec.
2026-02-05 15:53:00 02021_prewhere_column_optimization: [ OK ] 0.17 sec.
2026-02-05 15:53:00 02244_make_datetime: [ OK ] 0.27 sec.
2026-02-05 15:53:00 02482_load_parts_refcounts: [ OK ] 1.17 sec.
2026-02-05 15:53:00 03161_ipv4_ipv6_equality: [ OK ] 0.17 sec.
2026-02-05 15:53:00 02248_nullable_custom_types_to_string: [ OK ] 0.17 sec.
2026-02-05 15:53:00 02149_schema_inference_formats_with_schema_3: [ OK ] 1.77 sec.
2026-02-05 15:53:00 02498_analyzer_aggregate_functions_arithmetic_operations_pass_fix: [ OK ] 0.22 sec.
2026-02-05 15:53:00 02473_optimize_old_parts: [ OK ] 27.55 sec.
2026-02-05 15:53:00 01515_logtrace_function: [ OK ] 0.52 sec.
2026-02-05 15:53:01 01548_with_totals_having: [ OK ] 0.17 sec.
2026-02-05 15:53:01 01605_skip_idx_compact_parts: [ OK ] 0.22 sec.
2026-02-05 15:53:01 02011_http_parsing: [ OK ] 0.47 sec.
2026-02-05 15:53:01 02122_parallel_formatting_JSONCompactStringsEachRow: [ OK ] 1.42 sec.
2026-02-05 15:53:01 01455_optimize_trivial_insert_select: [ OK ] 0.27 sec.
2026-02-05 15:53:01 02375_scalar_lc_cte: [ OK ] 0.17 sec.
2026-02-05 15:53:01 02245_format_string_stack_overflow: [ OK ] 0.17 sec.
2026-02-05 15:53:01 01247_optimize_distributed_group_by_sharding_key_dist_on_dist: [ OK ] 0.32 sec.
2026-02-05 15:53:01 01455_default_compression: [ OK ] 0.17 sec.
2026-02-05 15:53:02 00974_adaptive_granularity_secondary_index: [ OK ] 0.37 sec.
2026-02-05 15:53:02 01157_replace_table: [ OK ] 0.37 sec.
2026-02-05 15:53:02 01802_formatDateTime_DateTime64_century: [ OK ] 0.17 sec.
2026-02-05 15:53:02 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.37 sec.
2026-02-05 15:53:02 02286_tuple_numeric_identifier: [ OK ] 0.22 sec.
2026-02-05 15:53:02 02915_analyzer_fuzz_2: [ OK ] 0.22 sec.
2026-02-05 15:53:02 03012_parser_backtracking: [ OK ] 2.12 sec.
2026-02-05 15:53:02 02539_generate_random_ip: [ OK ] 0.17 sec.
2026-02-05 15:53:03 00676_group_by_in: [ OK ] 0.17 sec.
2026-02-05 15:53:03 01825_new_type_json_3: [ OK ] 0.42 sec.
2026-02-05 15:53:03 02813_array_concat_agg: [ OK ] 0.17 sec.
2026-02-05 15:53:03 01710_projection_in_set: [ OK ] 0.27 sec.
2026-02-05 15:53:03 00534_functions_bad_arguments11: [ OK ] 5.03 sec.
2026-02-05 15:53:04 02373_datetime64_monotonicity: [ OK ] 1.82 sec.
2026-02-05 15:53:04 01660_test_toDayOfYear_mysql_compatibility: [ OK ] 0.17 sec.
2026-02-05 15:53:04 00909_arrayEnumerateUniq: [ OK ] 1.14 sec.
2026-02-05 15:53:04 02212_h3_point_dist: [ OK ] 0.22 sec.
2026-02-05 15:53:07 02561_temporary_table_grants: [ OK ] 2.22 sec.
2026-02-05 15:53:07 02015_order_by_with_fill_misoptimization: [ OK ] 0.17 sec.
2026-02-05 15:53:07 02476_analyzer_identifier_hints: [ OK ] 7.09 sec.
2026-02-05 15:53:07 03015_with_fill_invalid_expression: [ OK ] 0.12 sec.
2026-02-05 15:53:07 01290_max_execution_speed_distributed: [ OK ] 2.93 sec.
2026-02-05 15:53:07 03215_parsing_archive_name_s3: [ OK ] 0.27 sec.
2026-02-05 15:53:07 00745_compile_scalar_subquery: [ OK ] 0.27 sec.
2026-02-05 15:53:07 02045_like_function: [ OK ] 0.17 sec.
2026-02-05 15:53:07 02156_storage_merge_prewhere: [ OK ] 0.32 sec.
2026-02-05 15:53:08 01044_great_circle_angle: [ OK ] 0.17 sec.
2026-02-05 15:53:08 00404_null_literal: [ OK ] 0.17 sec.
2026-02-05 15:53:08 02015_async_inserts_5: [ OK ] 0.97 sec.
2026-02-05 15:53:08 02782_avro_decimals: [ OK ] 0.62 sec.
2026-02-05 15:53:09 03060_analyzer_regular_view_alias: [ OK ] 0.17 sec.
2026-02-05 15:53:09 02933_paste_join: [ OK ] 0.42 sec.
2026-02-05 15:53:09 00675_shard_remote_with_table_function: [ OK ] 0.22 sec.
2026-02-05 15:53:09 02159_left_right: [ OK ] 0.32 sec.
2026-02-05 15:53:09 02015_async_inserts_1: [ OK ] 5.88 sec.
2026-02-05 15:53:09 02999_ulid_short_circuit: [ OK ] 0.17 sec.
2026-02-05 15:53:09 03036_schema_inference_cache_s3_archives: [ OK ] 0.22 sec.
2026-02-05 15:53:09 02812_csv_date_time_with_comma: [ OK ] 0.17 sec.
2026-02-05 15:53:09 02962_arrow_dictionary_indexes_types: [ OK ] 1.72 sec.
2026-02-05 15:53:09 01416_join_totals_header_bug: [ OK ] 0.28 sec.
2026-02-05 15:53:09 02990_parts_splitter_invalid_ranges: [ OK ] 0.22 sec.
2026-02-05 15:53:10 00053_all_inner_join: [ OK ] 0.17 sec.
2026-02-05 15:53:10 00355_array_of_non_const_convertible_types: [ OK ] 0.12 sec.
2026-02-05 15:53:10 01180_client_syntax_errors: [ OK ] 0.57 sec.
2026-02-05 15:53:10 02428_partial_sort_optimization_bug: [ OK ] 0.17 sec.
2026-02-05 15:53:10 01798_having_push_down: [ OK ] 0.22 sec.
2026-02-05 15:53:10 01560_merge_distributed_join: [ OK ] 0.22 sec.
2026-02-05 15:53:10 00559_filter_array_generic: [ OK ] 0.12 sec.
2026-02-05 15:53:10 02887_format_readable_timedelta_subseconds: [ OK ] 0.17 sec.
2026-02-05 15:53:10 02815_alias_to_length: [ OK ] 0.17 sec.
2026-02-05 15:53:10 00927_asof_join_long: [ OK ] 8.80 sec.
2026-02-05 15:53:10 02371_analyzer_join_cross: [ OK ] 0.32 sec.
2026-02-05 15:53:10 00732_base64_functions: [ OK ] 0.27 sec.
2026-02-05 15:53:11 02733_sparse_columns_reload: [ OK ] 0.22 sec.
2026-02-05 15:53:11 02783_parsedatetimebesteffort_syslog: [ OK ] 0.22 sec.
2026-02-05 15:53:11 01599_mutation_query_params: [ OK ] 1.02 sec.
2026-02-05 15:53:11 02791_predicate_pushdown_different_types: [ OK ] 0.17 sec.
2026-02-05 15:53:11 02226_analyzer_or_like_combine: [ OK ] 0.22 sec.
2026-02-05 15:53:11 01096_block_serialized_state: [ OK ] 0.17 sec.
2026-02-05 15:53:11 01245_limit_infinite_sources: [ OK ] 0.80 sec.
2026-02-05 15:53:11 01034_with_fill_and_push_down_predicate: [ OK ] 0.29 sec.
2026-02-05 15:53:11 01198_plus_inf: [ OK ] 0.17 sec.
2026-02-05 15:53:12 01357_version_collapsing_attach_detach_zookeeper: [ OK ] 0.42 sec.
2026-02-05 15:53:12 02135_local_create_db: [ OK ] 0.92 sec.
2026-02-05 15:53:12 02281_limit_by_distributed: [ OK ] 0.27 sec.
2026-02-05 15:53:12 00445_join_nullable_keys: [ OK ] 0.24 sec.
2026-02-05 15:53:12 02423_json_quote_float64: [ OK ] 0.17 sec.
2026-02-05 15:53:14 02707_clickhouse_local_implicit_file_table_function: [ OK ] 1.75 sec.
2026-02-05 15:53:14 00914_join_bgranvea: [ OK ] 0.27 sec.
2026-02-05 15:53:14 01304_direct_io_long: [ OK ] 11.66 sec.
2026-02-05 15:53:15 01213_alter_rename_nested: [ OK ] 0.27 sec.
2026-02-05 15:53:15 00328_long_case_construction: [ OK ] 14.70 sec.
2026-02-05 15:53:15 02543_alter_update_rename_stuck: [ OK ] 4.59 sec.
2026-02-05 15:53:15 02337_base58: [ OK ] 0.17 sec.
2026-02-05 15:53:15 02746_index_analysis_binary_operator_with_null: [ OK ] 0.17 sec.
2026-02-05 15:53:16 02482_if_with_nothing_argument: [ OK ] 0.22 sec.
2026-02-05 15:53:16 01375_output_format_tsv_csv_with_names: [ OK ] 1.12 sec.
2026-02-05 15:53:16 01011_group_uniq_array_memsan: [ OK ] 0.22 sec.
2026-02-05 15:53:17 02423_insert_stats_behaviour: [ OK ] 2.43 sec.
2026-02-05 15:53:17 01763_max_distributed_depth: [ OK ] 0.17 sec.
2026-02-05 15:53:17 00511_get_size_of_enum: [ OK ] 0.28 sec.
2026-02-05 15:53:18 02676_optimize_old_parts_replicated: [ OK ] 42.75 sec.
2026-02-05 15:53:18 00565_enum_order: [ OK ] 1.83 sec.
2026-02-05 15:53:18 02151_client_option_echo: [ OK ] 0.87 sec.
2026-02-05 15:53:18 02013_json_function_null_column: [ OK ] 0.32 sec.
2026-02-05 15:53:18 02735_asof_join_right_null: [ OK ] 0.22 sec.
2026-02-05 15:53:19 02935_format_with_arbitrary_types: [ OK ] 0.42 sec.
2026-02-05 15:53:19 02555_davengers_rename_chain: [ OK ] 3.08 sec.
2026-02-05 15:53:19 02475_split_with_max_substrings: [ OK ] 0.78 sec.
2026-02-05 15:53:19 01509_check_many_parallel_quorum_inserts_long: [ OK ] 3.68 sec.
2026-02-05 15:53:19 01715_tuple_insert_null_as_default: [ OK ] 0.48 sec.
2026-02-05 15:53:19 02152_dictionary_date32_type: [ OK ] 0.28 sec.
2026-02-05 15:53:19 02708_dotProduct: [ OK ] 0.47 sec.
2026-02-05 15:53:19 00401_merge_and_stripelog: [ OK ] 0.57 sec.
2026-02-05 15:53:19 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.23 sec.
2026-02-05 15:53:19 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.12 sec.
2026-02-05 15:53:20 03036_prewhere_lambda_function: [ OK ] 0.17 sec.
2026-02-05 15:53:20 03321_join_on_is_null_lowcardinality: [ OK ] 0.17 sec.
2026-02-05 15:53:20 01010_low_cardinality_and_native_http: [ OK ] 1.72 sec.
2026-02-05 15:53:20 02477_age_date32: [ OK ] 0.57 sec.
2026-02-05 15:53:20 00251_has_types: [ OK ] 0.32 sec.
2026-02-05 15:53:20 01047_window_view_parser_inner_table: [ OK ] 0.87 sec.
2026-02-05 15:53:21 00544_insert_with_select: [ OK ] 0.23 sec.
2026-02-05 15:53:21 03277_analyzer_array_join_fix: [ OK ] 0.17 sec.
2026-02-05 15:53:21 01442_date_time_with_params: [ OK ] 0.57 sec.
2026-02-05 15:53:21 02343_analyzer_column_transformers_strict: [ OK ] 0.22 sec.
2026-02-05 15:53:21 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.22 sec.
2026-02-05 15:53:21 02342_analyzer_compound_types: [ OK ] 0.47 sec.
2026-02-05 15:53:22 03037_dynamic_merges_1_horizontal_compact_merge_tree: [ OK ] 2.63 sec.
2026-02-05 15:53:22 02132_client_history_navigation: [ OK ] 0.72 sec.
2026-02-05 15:53:22 01392_column_resolve: [ OK ] 0.27 sec.
2026-02-05 15:53:22 02041_test_fuzzy_alter: [ OK ] 0.22 sec.
2026-02-05 15:53:23 01767_timezoneOf: [ OK ] 0.72 sec.
2026-02-05 15:53:23 02237_lzma_bug: [ OK ] 2.63 sec.
2026-02-05 15:53:24 01780_column_sparse_tuple: [ OK ] 0.37 sec.
2026-02-05 15:53:24 02570_fallback_from_async_insert: [ OK ] 2.68 sec.
2026-02-05 15:53:24 00197_if_fixed_string: [ OK ] 0.17 sec.
2026-02-05 15:53:24 02812_pointwise_array_operations: [ OK ] 0.32 sec.
2026-02-05 15:53:25 00076_ip_coding_functions: [ OK ] 0.63 sec.
2026-02-05 15:53:25 01513_optimize_aggregation_in_order_memory_long: [ OK ] 2.73 sec.
2026-02-05 15:53:25 03011_definitive_guide_to_cast: [ OK ] 0.72 sec.
2026-02-05 15:53:26 01521_format_readable_time_delta2: [ OK ] 0.22 sec.
2026-02-05 15:53:26 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.58 sec.
2026-02-05 15:53:26 Reason: return code: 134, result:
2026-02-05 15:53:26
2026-02-05 15:53:26
2026-02-05 15:53:26
2026-02-05 15:53:26 stdout:
2026-02-05 15:53:26
2026-02-05 15:53:26
2026-02-05 15:53:26 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 17125242 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 10269454 --max_read_buffer_size 607698 --prefer_localhost_replica 0 --max_block_size 61628 --max_joined_block_size_rows 51977 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 100 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 10066623 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method read --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 15 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1756043913 --min_compress_block_size 1325219 --max_compress_block_size 201583 --merge_tree_compact_parts_min_granules_to_multibuffer_read 53 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 10242969 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.49 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0
2026-02-05 15:53:26
2026-02-05 15:53:26 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 1965826376 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 2004212676 --index_granularity_bytes 14618742 --merge_max_block_size 19987 --index_granularity 8844 --min_bytes_for_wide_part 0 --marks_compress_block_size 63937 --primary_key_compress_block_size 99525 --replace_long_file_name_to_hash 1 --max_file_name_length 69 --min_bytes_for_full_part_storage 160606575 --compact_parts_max_bytes_to_buffer 296776459 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 5406926 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 0 --old_parts_lifetime 278
2026-02-05 15:53:26
2026-02-05 15:53:26 Database: test_gimi9dzc
2026-02-05 15:53:26 02515_projections_with_totals: [ OK ] 0.25 sec.
2026-02-05 15:53:26 01635_nullable_fuzz: [ OK ] 0.17 sec.
2026-02-05 15:53:26 01323_too_many_threads_bug: [ OK ] 0.62 sec.
2026-02-05 15:53:26 03164_selects_with_pk_usage_profile_event: [ OK ] 2.68 sec.
2026-02-05 15:53:27 01246_extractAllGroupsHorizontal: [ OK ] 0.37 sec.
2026-02-05 15:53:27 02287_legacy_column_name_of_tuple_literal_over_distributed: [ OK ] 0.17 sec.
2026-02-05 15:53:27 02575_map_hashing_msan: [ OK ] 0.23 sec.
2026-02-05 15:53:27 02152_invalid_setting_with_hints_in_http_request: [ OK ] 0.47 sec.
2026-02-05 15:53:27 00231_format_vertical_raw: [ OK ] 0.17 sec.
2026-02-05 15:53:27 02869_unicode_minus: [ OK ] 0.12 sec.
2026-02-05 15:53:28 02946_literal_alias_misclassification: [ OK ] 0.17 sec.
2026-02-05 15:53:28 02416_keeper_map: [ OK ] 0.77 sec.
2026-02-05 15:53:28 00498_array_functions_concat_slice_push_pop: [ OK ] 1.88 sec.
2026-02-05 15:53:28 00626_replace_partition_from_table_zookeeper: [ OK ] 16.88 sec.
2026-02-05 15:53:29 03037_precent_rank: [ OK ] 0.22 sec.
2026-02-05 15:53:29 01273_extractGroups: [ OK ] 0.32 sec.
2026-02-05 15:53:29 03172_error_log_table_not_empty: [ OK ] 5.71 sec.
2026-02-05 15:53:29 02285_hex_bin_support_more_types: [ OK ] 0.22 sec.
2026-02-05 15:53:29 02809_storage_set_analysis_bug: [ OK ] 0.27 sec.
2026-02-05 15:53:30 02428_decimal_in_floating_point_literal: [ OK ] 0.32 sec.
2026-02-05 15:53:30 02160_untuple_exponential_growth: [ OK ] 0.87 sec.
2026-02-05 15:53:30 02799_transform_empty_arrays: [ OK ] 0.17 sec.
2026-02-05 15:53:30 02269_to_start_of_interval_overflow: [ OK ] 0.17 sec.
2026-02-05 15:53:31 02987_group_array_intersect: [ OK ] 1.18 sec.
2026-02-05 15:53:31 01043_categorical_iv: [ OK ] 0.28 sec.
2026-02-05 15:53:31 02503_in_lc_const_args_bug: [ OK ] 0.12 sec.
2026-02-05 15:53:32 02482_execute_functions_before_sorting_bug: [ OK ] 0.22 sec.
2026-02-05 15:53:32 01370_client_autocomplete_word_break_characters: [ OK ] 1.57 sec.
2026-02-05 15:53:32 01212_empty_join_and_totals: [ OK ] 0.17 sec.
2026-02-05 15:53:32 01305_polygons_union: [ OK ] 0.27 sec.
2026-02-05 15:53:32 00216_bit_test_function_family: [ OK ] 0.17 sec.
2026-02-05 15:53:32 01062_pm_all_join_with_block_continuation: [ OK ] 4.79 sec.
2026-02-05 15:53:33 00882_multiple_join_no_alias: [ OK ] 0.23 sec.
2026-02-05 15:53:33 02381_join_dup_columns_in_plan: [ OK ] 0.32 sec.
2026-02-05 15:53:33 02234_clickhouse_local_test_mode: [ OK ] 0.87 sec.
2026-02-05 15:53:33 01273_h3EdgeAngle_range_check: [ OK ] 0.17 sec.
2026-02-05 15:53:33 02553_new_type_json_attach_partition: [ OK ] 0.22 sec.
2026-02-05 15:53:33 01084_defaults_on_aliases: [ OK ] 0.32 sec.
2026-02-05 15:53:33 01024__getScalar: [ OK ] 0.17 sec.
2026-02-05 15:53:33 01073_attach_if_not_exists: [ OK ] 0.22 sec.
2026-02-05 15:53:34 00834_dont_allow_to_set_two_configuration_files_in_client: [ OK ] 0.47 sec.
2026-02-05 15:53:34 01030_incorrect_count_summing_merge_tree: [ OK ] 0.72 sec.
2026-02-05 15:53:34 02366_kql_func_datetime: [ OK ] 0.42 sec.
2026-02-05 15:53:34 02343_analyzer_lambdas_issue_28083: [ OK ] 0.17 sec.
2026-02-05 15:53:34 02009_array_join_partition: [ OK ] 0.17 sec.
2026-02-05 15:53:35 01670_sign_function: [ OK ] 0.32 sec.
2026-02-05 15:53:35 00541_to_start_of_fifteen_minutes: [ OK ] 0.17 sec.
2026-02-05 15:53:35 00634_performance_introspection_and_logging: [ OK ] 1.83 sec.
2026-02-05 15:53:35 03172_dynamic_binary_serialization: [ OK ] 6.96 sec.
2026-02-05 15:53:35 02999_analyzer_preimage_null: [ OK ] 0.17 sec.
2026-02-05 15:53:35 02384_decrypt_bad_arguments: [ OK ] 0.12 sec.
2026-02-05 15:53:35 00961_check_table: [ OK ] 0.27 sec.
2026-02-05 15:53:35 01124_view_bad_types: [ OK ] 0.22 sec.
2026-02-05 15:53:35 01848_partition_value_column: [ OK ] 0.27 sec.
2026-02-05 15:53:35 00689_join_table_function: [ OK ] 0.17 sec.
2026-02-05 15:53:35 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.42 sec.
2026-02-05 15:53:35 02694_wrong_identifier_shouldnt_be_accepted: [ OK ] 0.22 sec.
2026-02-05 15:53:36 01497_mutation_support_for_storage_memory: [ OK ] 0.23 sec.
2026-02-05 15:53:36 01780_column_sparse_pk: [ OK ] 0.37 sec.
2026-02-05 15:53:36 01259_combinator_distinct_distributed: [ OK ] 0.27 sec.
2026-02-05 15:53:36 01293_client_interactive_vertical_multiline: [ OK ] 1.27 sec.
2026-02-05 15:53:36 02152_count_distinct_optimization: [ OK ] 0.22 sec.
2026-02-05 15:53:36 00740_optimize_predicate_expression: [ OK ] 0.17 sec.
2026-02-05 15:53:36 01113_local_dictionary_type_conversion: [ OK ] 0.17 sec.
2026-02-05 15:53:36 02473_functions_in_readonly_mode: [ OK ] 1.07 sec.
2026-02-05 15:53:37 01663_aes_msan: [ OK ] 0.17 sec.
2026-02-05 15:53:37 01273_arrow_load: [ OK ] 1.18 sec.
2026-02-05 15:53:37 03032_scalars_create_as_select: [ OK ] 0.22 sec.
2026-02-05 15:53:37 01746_convert_type_with_default: [ OK ] 0.43 sec.
2026-02-05 15:53:37 02832_transform_fixed_string_no_default: [ OK ] 0.17 sec.
2026-02-05 15:53:37 00832_storage_file_lock: [ OK ] 0.22 sec.
2026-02-05 15:53:37 02499_quantile_nan_ubsan_msan: [ OK ] 0.27 sec.
2026-02-05 15:53:37 00535_parse_float_scientific: [ OK ] 0.22 sec.
2026-02-05 15:53:38 02932_parallel_replicas_fuzzer: [ OK ] 0.27 sec.
2026-02-05 15:53:38 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.17 sec.
2026-02-05 15:53:38 02771_semi_join_use_nulls: [ OK ] 1.63 sec.
2026-02-05 15:53:38 01272_offset_without_limit: [ OK ] 0.17 sec.
2026-02-05 15:53:38 03165_storage_merge_view_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:53:38 01946_tskv: [ OK ] 1.02 sec.
2026-02-05 15:53:38 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 1.23 sec.
2026-02-05 15:53:39 01601_proxy_protocol: [ OK ] 0.47 sec.
2026-02-05 15:53:39 02495_concat_with_separator: [ OK ] 0.47 sec.
2026-02-05 15:53:39 02011_normalize_utf8: [ OK ] 0.42 sec.
2026-02-05 15:53:39 01656_ipv4_bad_formatting: [ OK ] 0.18 sec.
2026-02-05 15:53:39 01925_broken_partition_id_zookeeper: [ OK ] 0.27 sec.
2026-02-05 15:53:39 00018_distinct_in_subquery: [ OK ] 0.22 sec.
2026-02-05 15:53:39 00974_text_log_table_not_empty: [ OK ] 1.39 sec.
2026-02-05 15:53:39 02462_match_regexp_pk: [ OK ] 0.22 sec.
2026-02-05 15:53:41 01232_json_as_string_format: [ OK ] 1.27 sec.
2026-02-05 15:53:41 01017_tsv_empty_as_default: [ OK ] 1.07 sec.
2026-02-05 15:53:41 00543_access_to_temporary_table_in_readonly_mode: [ OK ] 1.93 sec.
2026-02-05 15:53:41 01019_array_fill: [ OK ] 0.22 sec.
2026-02-05 15:53:41 00817_with_simple: [ OK ] 0.17 sec.
2026-02-05 15:53:41 00697_in_subquery_shard: [ OK ] 0.43 sec.
2026-02-05 15:53:41 03211_nested_json_merges: [ OK ] 21.95 sec.
2026-02-05 15:53:42 01025_array_compact_generic: [ OK ] 0.22 sec.
2026-02-05 15:53:42 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 2.78 sec.
2026-02-05 15:53:42 02015_async_inserts_6: [ OK ] 0.97 sec.
2026-02-05 15:53:42 01616_untuple_access_field: [ OK ] 0.17 sec.
2026-02-05 15:53:42 00687_insert_into_mv: [ OK ] 0.33 sec.
2026-02-05 15:53:42 02477_exists_fuzz_43478: [ OK ] 0.17 sec.
2026-02-05 15:53:42 03232_json_uniq_group_by: [ OK ] 0.32 sec.
2026-02-05 15:53:42 01635_sum_map_fuzz: [ OK ] 0.22 sec.
2026-02-05 15:53:43 00735_long_conditional: [ OK ] 1.49 sec.
2026-02-05 15:53:43 02452_json_utf8_validation: [ OK ] 0.32 sec.
2026-02-05 15:53:43 01051_all_join_engine: [ OK ] 0.47 sec.
2026-02-05 15:53:43 03046_column_in_block_array_join: [ OK ] 0.22 sec.
2026-02-05 15:53:43 00754_first_significant_subdomain_more: [ OK ] 0.12 sec.
2026-02-05 15:53:43 02814_create_index_uniq_noop: [ OK ] 0.12 sec.
2026-02-05 15:53:43 01397_in_bad_arguments: [ OK ] 0.17 sec.
2026-02-05 15:53:43 02902_select_subcolumns_from_engine_null: [ OK ] 0.22 sec.
2026-02-05 15:53:43 00026_shard_something_distributed: [ OK ] 0.22 sec.
2026-02-05 15:53:43 03231_dynamic_incomplete_type_insert_bug: [ OK ] 0.22 sec.
2026-02-05 15:53:44 02835_join_step_explain: [ OK ] 0.22 sec.
2026-02-05 15:53:44 03144_fuzz_quoted_type_name: [ OK ] 0.18 sec.
2026-02-05 15:53:44 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 3.24 sec.
2026-02-05 15:53:44 00446_clear_column_in_partition_zookeeper_long: [ OK ] 2.03 sec.
2026-02-05 15:53:44 02388_conversion_from_string_with_datetime64_to_date_and_date32: [ OK ] 0.32 sec.
2026-02-05 15:53:44 02497_storage_file_reader_selection: [ OK ] 1.12 sec.
2026-02-05 15:53:44 01610_client_spawn_editor: [ OK ] 0.12 sec.
2026-02-05 15:53:45 01090_zookeeper_mutations_and_insert_quorum_long: [ OK ] 0.72 sec.
2026-02-05 15:53:45 01379_with_fill_several_columns: [ OK ] 0.17 sec.
2026-02-05 15:53:45 01825_new_type_json_distributed: [ OK ] 0.22 sec.
2026-02-05 15:53:45 01301_polygons_within: [ OK ] 0.22 sec.
2026-02-05 15:53:45 01661_referer: [ OK ] 0.95 sec.
2026-02-05 15:53:45 00688_low_cardinality_dictionary_deserialization: [ OK ] 1.33 sec.
2026-02-05 15:53:46 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.29 sec.
2026-02-05 15:53:46 03051_many_ctes: [ OK ] 0.22 sec.
2026-02-05 15:53:46 02165_h3_num_hexagons: [ OK ] 0.28 sec.
2026-02-05 15:53:46 02575_merge_prewhere_default_expression: [ OK ] 0.22 sec.
2026-02-05 15:53:46 02471_wrong_date_monotonicity: [ OK ] 0.18 sec.
2026-02-05 15:53:46 02467_set_with_lowcardinality_type: [ OK ] 0.32 sec.
2026-02-05 15:53:46 00438_bit_rotate: [ OK ] 0.23 sec.
2026-02-05 15:53:46 02378_part_log_profile_events: [ OK ] 0.68 sec.
2026-02-05 15:53:46 01900_kill_mutation_parallel_long: [ OK ] 3.20 sec.
2026-02-05 15:53:46 02122_parallel_formatting_JSONEachRow: [ OK ] 1.94 sec.
2026-02-05 15:53:46 00704_arrayCumSumLimited_arrayDifference: [ OK ] 0.17 sec.
2026-02-05 15:53:46 02367_join_pushdown_column_not_found: [ OK ] 0.17 sec.
2026-02-05 15:53:47 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.17 sec.
2026-02-05 15:53:47 00978_ml_math: [ OK ] 0.17 sec.
2026-02-05 15:53:47 02971_analyzer_remote_id: [ OK ] 0.72 sec.
2026-02-05 15:53:47 03289_explain_syntax_statistics: [ OK ] 0.22 sec.
2026-02-05 15:53:47 01623_constraints_column_swap: [ OK ] 0.97 sec.
2026-02-05 15:53:48 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.27 sec.
2026-02-05 15:53:50 00825_protobuf_format_squares: [ OK ] 2.00 sec.
2026-02-05 15:53:50 01293_show_settings: [ OK ] 0.12 sec.
2026-02-05 15:53:50 02698_marked_dropped_tables: [ OK ] 0.22 sec.
2026-02-05 15:53:51 01825_new_type_json_parallel_insert: [ OK ] 0.47 sec.
2026-02-05 15:53:51 00927_asof_join_noninclusive: [ OK ] 0.53 sec.
2026-02-05 15:53:52 00443_optimize_final_vertical_merge: [ OK ] 4.65 sec.
2026-02-05 15:53:52 00517_date_parsing: [ OK ] 0.54 sec.
2026-02-05 15:53:52 02291_dictionary_scalar_subquery_reload: [ OK ] 0.59 sec.
2026-02-05 15:53:53 02480_every_asynchronous_metric_must_have_documentation: [ OK ] 0.17 sec.
2026-02-05 15:53:54 02875_clickhouse_local_multiquery: [ OK ] 1.65 sec.
2026-02-05 15:53:54 01079_bit_operations_using_bitset: [ OK ] 0.33 sec.
2026-02-05 15:53:54 02661_read_from_archive_tar: [ OK ] 8.02 sec.
2026-02-05 15:53:55 02996_nullable_arrayReduce: [ OK ] 0.27 sec.
2026-02-05 15:53:55 01104_fixed_string_like: [ OK ] 0.52 sec.
2026-02-05 15:53:55 00534_functions_bad_arguments8: [ OK ] 8.37 sec.
2026-02-05 15:53:55 02731_formats_s3: [ OK ] 0.49 sec.
2026-02-05 15:53:55 03006_parallel_replicas_cte_explain_syntax_crash: [ OK ] 0.37 sec.
2026-02-05 15:53:55 01377_supertype_low_cardinality: [ OK ] 0.63 sec.
2026-02-05 15:53:56 01449_json_compact_strings: [ OK ] 0.28 sec.
2026-02-05 15:53:56 02428_batch_nullable_assert: [ OK ] 0.19 sec.
2026-02-05 15:53:56 03070_analyzer_CTE_scalar_as_numbers: [ OK ] 0.24 sec.
2026-02-05 15:53:56 01069_insert_float_as_nullable_unit8: [ OK ] 0.28 sec.
2026-02-05 15:53:56 00555_hasSubstr: [ OK ] 0.48 sec.
2026-02-05 15:53:57 03086_analyzer_window_func_part_of_group_by: [ OK ] 0.19 sec.
2026-02-05 15:53:57 01037_polygon_dicts_simple_functions: [ OK ] 3.90 sec.
2026-02-05 15:53:57 02015_async_inserts_stress_long: [ OK ] 9.81 sec.
2026-02-05 15:53:57 02915_sleep_large_uint: [ OK ] 0.20 sec.
2026-02-05 15:53:57 02707_protobuf_unnamed_tuple_as_nested_message: [ OK ] 0.93 sec.
2026-02-05 15:53:57 00439_fixed_string_filter: [ OK ] 0.19 sec.
2026-02-05 15:53:57 02004_intersect_except_const_column: [ OK ] 0.23 sec.
2026-02-05 15:53:57 00195_shard_union_all_and_global_in: [ OK ] 0.22 sec.
2026-02-05 15:53:57 00910_client_window_size_detection: [ OK ] 0.62 sec.
2026-02-05 15:53:57 02467_cross_join_three_table_functions: [ OK ] 0.17 sec.
2026-02-05 15:53:57 00098_g_union_all: [ OK ] 0.12 sec.
2026-02-05 15:53:58 01319_mv_constants_bug: [ OK ] 0.27 sec.
2026-02-05 15:53:58 01825_type_json_10: [ OK ] 0.22 sec.
2026-02-05 15:53:58 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.22 sec.
2026-02-05 15:53:58 02096_date_time_1970_saturation2: [ OK ] 0.28 sec.
2026-02-05 15:53:59 00746_sql_fuzzy: [ OK ] 46.38 sec.
2026-02-05 15:53:59 00078_string_concat: [ OK ] 0.88 sec.
2026-02-05 15:53:59 02048_alter_command_format: [ OK ] 0.47 sec.
2026-02-05 15:53:59 03153_trailing_comma_in_values_list_in_insert: [ OK ] 0.17 sec.
2026-02-05 15:53:59 01403_datetime64_constant_arg: [ OK ] 0.17 sec.
2026-02-05 15:53:59 01119_session_log: [ OK ] 30.66 sec.
2026-02-05 15:53:59 00957_delta_diff_bug: [ OK ] 0.17 sec.
2026-02-05 15:53:59 02806_cte_block_cannot_be_empty: [ OK ] 0.17 sec.
2026-02-05 15:53:59 01554_bloom_filter_index_big_integer_uuid: [ OK ] 0.28 sec.
2026-02-05 15:53:59 00349_visible_width: [ OK ] 0.22 sec.
2026-02-05 15:53:59 00825_http_header_query_id: [ OK ] 0.42 sec.
2026-02-05 15:53:59 03199_merge_filters_bug: [ OK ] 0.22 sec.
2026-02-05 15:53:59 02155_parse_date_lowcard_default_throw: [ OK ] 0.17 sec.
2026-02-05 15:54:00 02436_system_zookeeper_context: [ OK ] 0.22 sec.
2026-02-05 15:54:00 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.52 sec.
2026-02-05 15:54:00 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 0.47 sec.
2026-02-05 15:54:00 01080_window_view_inner_table_memory_hop: [ OK ] 1.22 sec.
2026-02-05 15:54:00 01347_partition_date_vs_datetime: [ OK ] 0.17 sec.
2026-02-05 15:54:00 01521_alter_enum_and_reverse_read: [ OK ] 0.18 sec.
2026-02-05 15:54:00 00140_prewhere_column_order: [ OK ] 0.18 sec.
2026-02-05 15:54:00 03034_recursive_cte_tree_merge_tree: [ OK ] 0.47 sec.
2026-02-05 15:54:00 02315_replace_multiif_to_if: [ OK ] 0.17 sec.
2026-02-05 15:54:00 00931_low_cardinality_set_index_in_key_condition: [ OK ] 0.22 sec.
2026-02-05 15:54:01 00852_any_join_nulls: [ OK ] 0.32 sec.
2026-02-05 15:54:01 01832_memory_write_suffix: [ OK ] 0.27 sec.
2026-02-05 15:54:01 02537_distributed_loosing_files_after_exception: [ OK ] 0.37 sec.
2026-02-05 15:54:01 00801_daylight_saving_time_hour_underflow: [ OK ] 0.17 sec.
2026-02-05 15:54:01 00181_aggregate_functions_statistics: [ OK ] 0.42 sec.
2026-02-05 15:54:01 00619_extract: [ OK ] 0.34 sec.
2026-02-05 15:54:02 02990_arrayFold_nullable_lc: [ OK ] 0.53 sec.
2026-02-05 15:54:02 02479_race_condition_between_insert_and_droppin_mv: [ OK ] 52.05 sec.
2026-02-05 15:54:02 00084_summing_merge_tree: [ OK ] 0.65 sec.
2026-02-05 15:54:02 00020_sorting_arrays: [ OK ] 0.27 sec.
2026-02-05 15:54:03 02142_http_with_query_parameters: [ OK ] 0.98 sec.
2026-02-05 15:54:03 02968_url_args: [ OK ] 0.34 sec.
2026-02-05 15:54:03 02941_variant_type_2: [ OK ] 8.02 sec.
2026-02-05 15:54:04 01825_new_type_json_10: [ OK ] 0.38 sec.
2026-02-05 15:54:04 02206_format_override: [ OK ] 2.25 sec.
2026-02-05 15:54:04 02883_named_collections_override: [ OK ] 1.63 sec.
2026-02-05 15:54:04 00976_shard_low_cardinality_achimbab: [ OK ] 0.48 sec.
2026-02-05 15:54:05 00193_parallel_replicas: [ OK ] 0.65 sec.
2026-02-05 15:54:05 00834_kill_mutation: [ OK ] 4.60 sec.
2026-02-05 15:54:05 02133_issue_32458: [ OK ] 0.39 sec.
2026-02-05 15:54:06 01854_HTTP_dict_decompression: [ OK ] 1.50 sec.
2026-02-05 15:54:06 00024_unused_array_join_in_subquery: [ OK ] 0.34 sec.
2026-02-05 15:54:06 02004_max_hyperscan_regex_length: [ OK ] 1.33 sec.
2026-02-05 15:54:06 02589_bson_invalid_document_size: [ OK ] 0.19 sec.
2026-02-05 15:54:06 00634_rename_view: [ OK ] 0.28 sec.
2026-02-05 15:54:06 02526_kv_engine_different_filter_type: [ OK ] 0.48 sec.
2026-02-05 15:54:07 02920_unary_operators_functions: [ OK ] 0.28 sec.
2026-02-05 15:54:07 02374_in_tuple_index: [ OK ] 0.43 sec.
2026-02-05 15:54:07 00267_tuple_array_access_operators_priority: [ OK ] 0.17 sec.
2026-02-05 15:54:07 01116_cross_count_asterisks: [ OK ] 0.22 sec.
2026-02-05 15:54:07 00980_zookeeper_merge_tree_alter_settings: [ OK ] 2.04 sec.
2026-02-05 15:54:07 01525_select_with_offset_fetch_clause: [ OK ] 0.44 sec.
2026-02-05 15:54:08 02533_generate_random_schema_inference: [ OK ] 0.22 sec.
2026-02-05 15:54:08 01553_datetime64_comparison: [ OK ] 0.22 sec.
2026-02-05 15:54:08 03040_recursive_cte_postgres_6: [ OK ] 0.48 sec.
2026-02-05 15:54:09 01511_prewhere_with_virtuals: [ OK ] 0.58 sec.
2026-02-05 15:54:10 02269_bool_map_sync_after_error: [ OK ] 2.75 sec.
2026-02-05 15:54:11 01066_window_view_event_tumble_to_strict_asc_lateness: [ OK ] 2.58 sec.
2026-02-05 15:54:12 02562_regexp_extract: [ OK ] 0.70 sec.
2026-02-05 15:54:12 00900_orc_nested_arrays_load: [ OK ] 1.80 sec.
2026-02-05 15:54:12 02995_forget_partition: [ OK ] 9.19 sec.
2026-02-05 15:54:13 03042_analyzer_alias_join: [ OK ] 0.23 sec.
2026-02-05 15:54:13 01921_with_fill_with_totals: [ OK ] 0.32 sec.
2026-02-05 15:54:13 02932_refreshable_materialized_views_1: [ OK ] 15.65 sec.
2026-02-05 15:54:13 03258_old_analyzer_const_expr_bug: [ OK ] 0.27 sec.
2026-02-05 15:54:13 01680_date_time_add_ubsan: [ OK ] 0.32 sec.
2026-02-05 15:54:13 01471_top_k_range_check: [ OK ] 0.22 sec.
2026-02-05 15:54:13 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.33 sec.
2026-02-05 15:54:14 00424_shard_aggregate_functions_of_nullable: [ OK ] 0.43 sec.
2026-02-05 15:54:14 02947_parallel_replicas_remote: [ OK ] 0.59 sec.
2026-02-05 15:54:15 02377_optimize_sorting_by_input_stream_properties_explain: [ OK ] 8.48 sec.
2026-02-05 15:54:15 02494_array_function_range: [ OK ] 0.29 sec.
2026-02-05 15:54:15 00699_materialized_view_mutations: [ OK ] 2.16 sec.
2026-02-05 15:54:15 03207_json_read_subcolumns_1_memory: [ OK ] 1.03 sec.
2026-02-05 15:54:15 00800_low_cardinality_distinct_numeric: [ OK ] 0.24 sec.
2026-02-05 15:54:16 02124_encrypt_decrypt_nullable: [ OK ] 0.28 sec.
2026-02-05 15:54:16 02949_parallel_replicas_in_subquery: [ OK ] 0.67 sec.
2026-02-05 15:54:16 03167_base64_url_functions: [ OK ] 0.39 sec.
2026-02-05 15:54:16 01253_subquery_in_aggregate_function_JustStranger: [ OK ] 0.29 sec.
2026-02-05 15:54:18 02896_leading_zeroes_no_octal: [ OK ] 2.03 sec.
2026-02-05 15:54:18 02313_displayname: [ OK ] 0.18 sec.
2026-02-05 15:54:19 02868_no_merge_across_partitions_final_with_lonely: [ OK ] 3.41 sec.
2026-02-05 15:54:20 03101_analyzer_identifiers_2: [ OK ] 0.53 sec.
2026-02-05 15:54:20 01647_clickhouse_local_hung: [ OK ] 23.55 sec.
2026-02-05 15:54:21 02731_nothing_deserialization: [ OK ] 0.17 sec.
2026-02-05 15:54:21 02752_forbidden_headers: [ OK ] 0.73 sec.
2026-02-05 15:54:21 00652_mutations_alter_update: [ OK ] 8.63 sec.
2026-02-05 15:54:21 01270_optimize_skip_unused_shards_low_cardinality: [ OK ] 0.32 sec.
2026-02-05 15:54:21 01901_in_literal_shard_prune: [ OK ] 0.34 sec.
2026-02-05 15:54:21 00324_hashing_enums: [ OK ] 0.27 sec.
2026-02-05 15:54:21 01675_data_type_coroutine_2: [ OK ] 14.66 sec.
2026-02-05 15:54:21 00534_functions_bad_arguments2: [ OK ] 7.40 sec.
2026-02-05 15:54:22 01018_ip_dictionary_long: [ OK ] 3.70 sec.
2026-02-05 15:54:22 01340_datetime64_fpe: [ OK ] 0.69 sec.
2026-02-05 15:54:22 03146_tpc_ds_grouping: [ OK ] 0.38 sec.
2026-02-05 15:54:22 01651_lc_insert_tiny_log_3: [ OK ] 5.78 sec.
2026-02-05 15:54:22 02974_if_with_map: [ OK ] 0.44 sec.
2026-02-05 15:54:22 01658_values_ubsan: [ OK ] 0.28 sec.
2026-02-05 15:54:22 02710_aggregation_nested_map_ip_uuid: [ OK ] 0.53 sec.
2026-02-05 15:54:23 01097_cyclic_defaults: [ OK ] 0.59 sec.
2026-02-05 15:54:23 00425_count_nullable: [ OK ] 0.33 sec.
2026-02-05 15:54:23 02388_analyzer_recursive_lambda: [ OK ] 0.20 sec.
2026-02-05 15:54:23 02493_max_streams_for_merge_tree_reading: [ OK ] 1.79 sec.
2026-02-05 15:54:23 00098_a_union_all: [ OK ] 0.22 sec.
2026-02-05 15:54:23 03214_bitslice_argument_evaluation: [ OK ] 0.32 sec.
2026-02-05 15:54:23 01600_quota_by_forwarded_ip: [ OK ] 1.58 sec.
2026-02-05 15:54:23 02426_orc_bug: [ OK ] 0.88 sec.
2026-02-05 15:54:23 00135_duplicate_group_by_keys_segfault: [ OK ] 0.17 sec.
2026-02-05 15:54:23 01083_log_first_column_alias: [ OK ] 0.34 sec.
2026-02-05 15:54:24 03591_optimize_prewhere_row_policy: [ OK ] 0.44 sec.
2026-02-05 15:54:24 01230_join_get_truncate: [ OK ] 0.29 sec.
2026-02-05 15:54:24 01702_bitmap_native_integers: [ OK ] 0.28 sec.
2026-02-05 15:54:24 01602_runningConcurrency: [ OK ] 0.53 sec.
2026-02-05 15:54:24 00184_shard_distributed_group_by_no_merge: [ OK ] 0.84 sec.
2026-02-05 15:54:25 02113_base64encode_trailing_bytes: [ OK ] 1.08 sec.
2026-02-05 15:54:25 02167_columns_with_dots_default_values: [ OK ] 0.49 sec.
2026-02-05 15:54:25 01788_update_nested_type_subcolumn_check: [ OK ] 0.94 sec.
2026-02-05 15:54:26 01825_type_json_parallel_insert: [ OK ] 0.76 sec.
2026-02-05 15:54:27 03036_recursive_cte_postgres_2: [ OK ] 1.29 sec.
2026-02-05 15:54:27 01052_array_reduce_exception: [ OK ] 0.24 sec.
2026-02-05 15:54:28 00098_4_union_all: [ OK ] 0.32 sec.
2026-02-05 15:54:28 02100_limit_push_down_bug: [ OK ] 0.37 sec.
2026-02-05 15:54:28 01015_database_bad_tables: [ OK ] 4.83 sec.
2026-02-05 15:54:30 00534_functions_bad_arguments5: [ OK ] 6.94 sec.
2026-02-05 15:54:30 02241_parquet_bad_column: [ OK ] 2.15 sec.
2026-02-05 15:54:30 01016_null_part_minmax: [ OK ] 0.22 sec.
2026-02-05 15:54:31 03134_positional_arguments: [ OK ] 2.50 sec.
2026-02-05 15:54:31 02252_executable_user_defined_function_short_circuit: [ OK ] 0.69 sec.
2026-02-05 15:54:31 00662_array_has_nullable: [ OK ] 0.32 sec.
2026-02-05 15:54:32 03208_numbers_total_rows_approx: [ OK ] 0.22 sec.
2026-02-05 15:54:32 03094_one_thousand_joins: [ OK ] 7.16 sec.
2026-02-05 15:54:33 00991_system_parts_race_condition_long: [ OK ] 32.55 sec.
2026-02-05 15:54:33 01493_alter_remove_properties: [ OK ] 0.97 sec.
2026-02-05 15:54:33 03210_convert_outer_join_to_inner_join_any_join: [ OK ] 1.12 sec.
2026-02-05 15:54:33 00578_merge_trees_without_primary_key: [ OK ] 1.92 sec.
2026-02-05 15:54:33 00552_logical_functions_simple: [ OK ] 0.22 sec.
2026-02-05 15:54:33 01447_json_strings: [ OK ] 0.17 sec.
2026-02-05 15:54:33 02834_sparse_columns_sort_with_limit: [ OK ] 0.27 sec.
2026-02-05 15:54:33 02967_fuzz_bad_cast: [ OK ] 0.17 sec.
2026-02-05 15:54:33 00435_coalesce: [ OK ] 0.17 sec.
2026-02-05 15:54:33 02346_additional_filters: [ OK ] 0.47 sec.
2026-02-05 15:54:33 00489_pk_subexpression: [ OK ] 0.22 sec.
2026-02-05 15:54:33 00617_array_in: [ OK ] 0.17 sec.
2026-02-05 15:54:34 02550_client_connections_credentials: [ OK ] 10.78 sec.
2026-02-05 15:54:34 02884_create_view_with_sql_security_option: [ OK ] 12.25 sec.
2026-02-05 15:54:34 00902_entropy: [ OK ] 0.22 sec.
2026-02-05 15:54:34 02995_index_9: [ OK ] 8.23 sec.
2026-02-05 15:54:34 01509_output_format_pretty_row_numbers: [ OK ] 0.32 sec.
2026-02-05 15:54:34 02515_analyzer_null_for_empty: [ OK ] 0.17 sec.
2026-02-05 15:54:34 02910_nullable_enum_cast: [ OK ] 0.17 sec.
2026-02-05 15:54:34 02366_window_function_order_by: [ OK ] 0.17 sec.
2026-02-05 15:54:34 03230_subcolumns_mv: [ OK ] 0.22 sec.
2026-02-05 15:54:34 02016_aggregation_spark_bar: [ OK ] 0.52 sec.
2026-02-05 15:54:34 03020_order_by_SimpleAggregateFunction: [ OK ] 0.38 sec.
2026-02-05 15:54:34 01660_second_extremes_bug: [ OK ] 0.17 sec.
2026-02-05 15:54:34 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:54:34 03140_client_subsequent_external_tables: [ OK ] 0.57 sec.
2026-02-05 15:54:34 02470_suspicious_low_cardinality_msan: [ OK ] 0.22 sec.
2026-02-05 15:54:34 02294_dictionaries_hierarchical_index: [ OK ] 0.27 sec.
2026-02-05 15:54:34 01931_storage_merge_no_columns: [ OK ] 0.17 sec.
2026-02-05 15:54:35 02126_lc_window_functions: [ OK ] 0.32 sec.
2026-02-05 15:54:35 00880_decimal_in_key: [ OK ] 0.72 sec.
2026-02-05 15:54:35 02344_describe_cache: [ OK ] 0.72 sec.
2026-02-05 15:54:35 02944_variant_as_common_type_analyzer: [ OK ] 0.32 sec.
2026-02-05 15:54:35 01942_snowflakeToDateTime: [ OK ] 0.42 sec.
2026-02-05 15:54:35 02280_add_query_level_settings: [ OK ] 0.22 sec.
2026-02-05 15:54:35 01273_arrow_arrays_load: [ OK ] 1.22 sec.
2026-02-05 15:54:35 02771_system_user_processes: [ OK ] 1.32 sec.
2026-02-05 15:54:35 03014_window_view_crash: [ OK ] 0.17 sec.
2026-02-05 15:54:35 03172_bcrypt_validation: [ OK ] 0.12 sec.
2026-02-05 15:54:35 03210_lag_lead_inframe_types: [ OK ] 0.17 sec.
2026-02-05 15:54:35 02479_analyzer_aggregation_totals_rollup_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:54:36 03149_analyzer_window_redefinition: [ OK ] 0.22 sec.
2026-02-05 15:54:36 00513_fractional_time_zones: [ OK ] 0.17 sec.
2026-02-05 15:54:36 01031_mutations_interpreter_and_context: [ OK ] 1.27 sec.
2026-02-05 15:54:36 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.59 sec.
2026-02-05 15:54:36 01214_test_storage_merge_aliases_with_where: [ OK ] 0.27 sec.
2026-02-05 15:54:36 01281_alter_rename_and_other_renames: [ OK ] 0.37 sec.
2026-02-05 15:54:36 03132_rewrite_aggregate_function_with_if_implicit_cast: [ OK ] 0.22 sec.
2026-02-05 15:54:36 00148_summing_merge_tree_nested_map_multiple_values: [ OK ] 0.23 sec.
2026-02-05 15:54:36 03084_analyzer_join_column_alias: [ OK ] 0.17 sec.
2026-02-05 15:54:37 02234_cast_to_ip_address: [ OK ] 1.52 sec.
2026-02-05 15:54:37 02131_materialize_column_cast: [ OK ] 0.27 sec.
2026-02-05 15:54:37 02475_join_bug_42832: [ OK ] 0.22 sec.
2026-02-05 15:54:37 02122_parallel_formatting_Markdown: [ OK ] 1.27 sec.
2026-02-05 15:54:37 02864_statistics_predicates: [ OK ] 0.92 sec.
2026-02-05 15:54:37 02813_system_licenses_base: [ OK ] 0.17 sec.
2026-02-05 15:54:37 02723_param_exception_message_context: [ OK ] 0.57 sec.
2026-02-05 15:54:37 02832_alter_delete_indexes_projections: [ OK ] 0.38 sec.
2026-02-05 15:54:38 02366_kql_func_math: [ OK ] 0.22 sec.
2026-02-05 15:54:38 02889_system_drop_format_schema: [ OK ] 0.17 sec.
2026-02-05 15:54:38 01502_jemalloc_percpu_arena: [ OK ] 1.08 sec.
2026-02-05 15:54:38 01746_long_zstd_http_compression_json_format: [ OK ] 2.07 sec.
2026-02-05 15:54:38 02497_analyzer_sum_if_count_if_pass_crash_fix: [ OK ] 0.20 sec.
2026-02-05 15:54:38 02901_remove_nullable_crash_analyzer: [ OK ] 0.28 sec.
2026-02-05 15:54:39 02498_random_string_in_json_schema_inference: [ OK ] 0.78 sec.
2026-02-05 15:54:40 02932_lwd_and_mutations: [ OK ] 0.58 sec.
2026-02-05 15:54:40 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.29 sec.
2026-02-05 15:54:40 02366_kql_operator_in_sql: [ OK ] 0.29 sec.
2026-02-05 15:54:40 02015_async_inserts_4: [ OK ] 2.96 sec.
2026-02-05 15:54:40 00742_require_join_strictness: [ OK ] 0.12 sec.
2026-02-05 15:54:41 02463_julian_day_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:54:42 02104_clickhouse_local_columns_description: [ OK ] 1.13 sec.
2026-02-05 15:54:43 02353_format_settings: [ OK ] 0.78 sec.
2026-02-05 15:54:43 02768_cse_nested_distributed: [ OK ] 0.22 sec.
2026-02-05 15:54:43 02496_remove_redundant_sorting_analyzer: [ OK ] 7.46 sec.
2026-02-05 15:54:43 02368_cancel_write_into_hdfs: [ OK ] 6.25 sec.
2026-02-05 15:54:43 02144_avg_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:54:43 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.32 sec.
2026-02-05 15:54:44 02313_group_by_modifiers_with_non_default_types: [ OK ] 0.22 sec.
2026-02-05 15:54:44 03250_avoid_prefetch_empty_parts: [ OK ] 0.32 sec.
2026-02-05 15:54:44 03211_convert_outer_join_to_inner_join_anti_join: [ OK ] 0.17 sec.
2026-02-05 15:54:45 02381_compress_marks_and_primary_key: [ OK ] 1.22 sec.
2026-02-05 15:54:45 01825_new_type_json_in_other_types: [ OK ] 1.83 sec.
2026-02-05 15:54:45 00033_fixed_string_to_string: [ OK ] 0.23 sec.
2026-02-05 15:54:45 02410_to_decimal_or_default: [ OK ] 0.23 sec.
2026-02-05 15:54:45 00127_group_by_concat: [ OK ] 0.17 sec.
2026-02-05 15:54:45 00713_collapsing_merge_tree: [ OK ] 0.22 sec.
2026-02-05 15:54:45 01582_deterministic_function_with_predicate: [ OK ] 0.17 sec.
2026-02-05 15:54:46 00728_json_each_row_parsing: [ OK ] 11.42 sec.
2026-02-05 15:54:46 01440_to_date_monotonicity: [ OK ] 0.22 sec.
2026-02-05 15:54:46 01102_distributed_local_in_bug: [ OK ] 0.27 sec.
2026-02-05 15:54:46 00927_asof_joins: [ OK ] 0.22 sec.
2026-02-05 15:54:46 02283_array_norm: [ OK ] 0.32 sec.
2026-02-05 15:54:46 03006_join_on_inequal_expression_3: [ OK ] 0.37 sec.
2026-02-05 15:54:46 00442_filter_by_nullable: [ OK ] 0.17 sec.
2026-02-05 15:54:46 00534_functions_bad_arguments12: [ OK ] 5.75 sec.
2026-02-05 15:54:46 00548_slice_of_nested: [ OK ] 0.22 sec.
2026-02-05 15:54:46 01497_alias_on_default_array: [ OK ] 0.22 sec.
2026-02-05 15:54:46 01351_parse_date_time_best_effort_us: [ OK ] 0.17 sec.
2026-02-05 15:54:46 02844_subquery_timeout_with_break: [ OK ] 0.27 sec.
2026-02-05 15:54:46 01676_round_int_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:54:47 00538_datediff_plural_units: [ OK ] 0.22 sec.
2026-02-05 15:54:47 01018_ddl_dictionaries_select: [ OK ] 0.42 sec.
2026-02-05 15:54:47 03290_limit_by_segv: [ OK ] 0.17 sec.
2026-02-05 15:54:47 00871_t64_codec_signed: [ OK ] 0.97 sec.
2026-02-05 15:54:47 02116_tuple_element_analyzer: [ OK ] 0.37 sec.
2026-02-05 15:54:47 01644_distributed_async_insert_fsync_smoke: [ OK ] 0.33 sec.
2026-02-05 15:54:47 02354_vector_search_index_creation_negative: [ OK ] 0.52 sec.
2026-02-05 15:54:48 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.27 sec.
2026-02-05 15:54:48 02813_func_today_and_alias: [ OK ] 0.17 sec.
2026-02-05 15:54:48 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.22 sec.
2026-02-05 15:54:48 01781_map_op_ubsan: [ OK ] 0.17 sec.
2026-02-05 15:54:48 01774_ip_address_in_range: [ OK ] 0.37 sec.
2026-02-05 15:54:48 02922_server_exit_code: [ OK ] 0.62 sec.
2026-02-05 15:54:48 02377_extend_protocol_with_query_parameters: [ OK ] 2.13 sec.
2026-02-05 15:54:48 01757_optimize_skip_unused_shards_limit: [ OK ] 0.22 sec.
2026-02-05 15:54:48 00757_enum_defaults_const: [ OK ] 0.17 sec.
2026-02-05 15:54:48 02232_partition_pruner_single_point: [ OK ] 0.18 sec.
2026-02-05 15:54:49 02474_unhex_in_fix_string: [ OK ] 0.17 sec.
2026-02-05 15:54:49 00700_to_decimal_or_something: [ OK ] 0.37 sec.
2026-02-05 15:54:49 02353_ascii: [ OK ] 0.17 sec.
2026-02-05 15:54:49 02147_arrow_duplicate_columns: [ OK ] 0.82 sec.
2026-02-05 15:54:49 01710_normal_projection_format: [ OK ] 0.17 sec.
2026-02-05 15:54:49 01010_pmj_skip_blocks: [ OK ] 0.62 sec.
2026-02-05 15:54:50 01321_monotonous_functions_in_order_by_bug: [ OK ] 0.17 sec.
2026-02-05 15:54:50 01015_array_split: [ OK ] 0.22 sec.
2026-02-05 15:54:50 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 1.87 sec.
2026-02-05 15:54:50 02968_adaptive_async_insert_timeout: [ OK ] 0.72 sec.
2026-02-05 15:54:50 01890_jit_aggregation_function_sum_long: [ OK ] 0.67 sec.
2026-02-05 15:54:51 01914_index_bgranvea: [ OK ] 0.23 sec.
2026-02-05 15:54:51 00042_set: [ OK ] 0.27 sec.
2026-02-05 15:54:51 01825_type_json_4: [ OK ] 1.53 sec.
2026-02-05 15:54:51 00825_protobuf_format_table_default: [ OK ] 1.18 sec.
2026-02-05 15:54:51 03006_parallel_replicas_prewhere: [ OK ] 0.22 sec.
2026-02-05 15:54:51 01414_bloom_filter_index_with_const_column: [ OK ] 0.22 sec.
2026-02-05 15:54:51 00203_full_join: [ OK ] 0.32 sec.
2026-02-05 15:54:51 01155_old_mutation_parts_to_do: [ OK ] 13.08 sec.
2026-02-05 15:54:51 02478_window_frame_type_groups: [ OK ] 0.17 sec.
2026-02-05 15:54:51 01568_window_functions_distributed: [ OK ] 0.37 sec.
2026-02-05 15:54:52 01913_join_push_down_bug: [ OK ] 0.22 sec.
2026-02-05 15:54:52 00717_merge_and_distributed: [ OK ] 0.83 sec.
2026-02-05 15:54:52 01537_fuzz_count_equal: [ OK ] 0.17 sec.
2026-02-05 15:54:52 00467_qualified_names: [ OK ] 0.28 sec.
2026-02-05 15:54:52 01861_explain_pipeline: [ OK ] 0.22 sec.
2026-02-05 15:54:53 01473_system_events_zeroes: [ OK ] 0.19 sec.
2026-02-05 15:54:53 02354_with_statement_non_exist_column: [ OK ] 0.23 sec.
2026-02-05 15:54:53 01814_distributed_push_down_limit: [ OK ] 2.03 sec.
2026-02-05 15:54:53 02241_join_rocksdb_bs: [ OK ] 2.49 sec.
2026-02-05 15:54:54 01324_settings_documentation: [ OK ] 0.22 sec.
2026-02-05 15:54:54 03036_dynamic_read_subcolumns_compact_merge_tree: [ OK ] 2.28 sec.
2026-02-05 15:54:54 01099_operators_date_and_timestamp: [ OK ] 0.62 sec.
2026-02-05 15:54:54 02862_uuid_reinterpret_as_numeric: [ OK ] 0.22 sec.
2026-02-05 15:54:54 00825_protobuf_format_enum_mapping: [ OK ] 1.28 sec.
2026-02-05 15:54:54 02971_functions_to_subcolumns_column_names: [ OK ] 0.22 sec.
2026-02-05 15:54:54 02514_analyzer_drop_join_on: [ OK ] 0.27 sec.
2026-02-05 15:54:54 00712_prewhere_with_alias_bug: [ OK ] 0.18 sec.
2026-02-05 15:54:54 01560_mann_whitney: [ OK ] 0.27 sec.
2026-02-05 15:54:55 01040_h3_get_resolution: [ OK ] 0.22 sec.
2026-02-05 15:54:55 02541_empty_function_support_ip: [ OK ] 0.22 sec.
2026-02-05 15:54:55 02940_variant_text_deserialization: [ OK ] 1.14 sec.
2026-02-05 15:54:55 02497_remote_disk_fat_column: [ OK ] 20.24 sec.
2026-02-05 15:54:55 02203_shebang: [ OK ] 0.52 sec.
2026-02-05 15:54:55 00757_enum_defaults_const_analyzer: [ OK ] 0.17 sec.
2026-02-05 15:54:55 02222_allow_experimental_projection_optimization__enable_global_with_statement: [ OK ] 0.22 sec.
2026-02-05 15:54:55 02400_memory_accounting_on_error: [ OK ] 0.42 sec.
2026-02-05 15:54:56 00115_shard_in_incomplete_result: [ OK ] 4.69 sec.
2026-02-05 15:54:56 02354_vector_search_queries: [ OK ] 0.28 sec.
2026-02-05 15:54:56 02841_tuple_modulo: [ OK ] 0.17 sec.
2026-02-05 15:54:56 01033_quota_dcl: [ OK ] 0.17 sec.
2026-02-05 15:54:56 02541_analyzer_grouping_sets_crash_fix: [ OK ] 0.17 sec.
2026-02-05 15:54:56 01078_bloom_filter_operator_not_has: [ OK ] 0.27 sec.
2026-02-05 15:54:56 00220_shard_with_totals_in_subquery_remote_and_limit: [ OK ] 0.17 sec.
2026-02-05 15:54:56 02864_profile_event_part_lock: [ OK ] 0.22 sec.
2026-02-05 15:54:56 01189_create_as_table_as_table_function: [ OK ] 0.17 sec.
2026-02-05 15:54:56 01312_skip_empty_params: [ OK ] 0.42 sec.
2026-02-05 15:54:56 01515_mv_and_array_join_optimisation_bag: [ OK ] 0.22 sec.
2026-02-05 15:54:56 03199_fix_auc_tie_handling: [ OK ] 0.17 sec.
2026-02-05 15:54:56 02782_values_null_to_lc_nullable: [ OK ] 0.12 sec.
2026-02-05 15:54:57 02252_reset_non_existing_setting: [ OK ] 0.17 sec.
2026-02-05 15:54:57 00939_test_null_in: [ OK ] 0.22 sec.
2026-02-05 15:54:57 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 2.03 sec.
2026-02-05 15:54:57 02457_morton_coding_with_mask: [ OK ] 0.82 sec.
2026-02-05 15:54:57 00978_table_function_values_alias: [ OK ] 0.17 sec.
2026-02-05 15:54:57 00979_set_index_not: [ OK ] 0.17 sec.
2026-02-05 15:54:57 02021_prewhere_always_true_where: [ OK ] 0.17 sec.
2026-02-05 15:54:57 00938_basename: [ OK ] 0.17 sec.
2026-02-05 15:54:57 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 1.32 sec.
2026-02-05 15:54:59 01701_parallel_parsing_infinite_segmentation: [ OK ] 1.77 sec.
2026-02-05 15:54:59 01818_move_partition_simple: [ OK ] 0.32 sec.
2026-02-05 15:54:59 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.32 sec.
2026-02-05 15:54:59 02843_backup_use_same_password_for_base_backup: [ OK ] 2.38 sec.
2026-02-05 15:55:00 01328_bad_peephole_optimization: [ OK ] 0.17 sec.
2026-02-05 15:55:01 00719_insert_block_without_column: [ OK ] 0.92 sec.
2026-02-05 15:55:01 01294_lazy_database_concurrent_recreate_reattach_and_show_tables_long: [ OK ] 22.60 sec.
2026-02-05 15:55:01 03149_numbers_max_block_size_zero: [ OK ] 0.57 sec.
2026-02-05 15:55:01 02165_h3_exact_edge_length_m: [ OK ] 0.22 sec.
2026-02-05 15:55:02 02346_to_hour_monotonicity_fix: [ OK ] 0.22 sec.
2026-02-05 15:55:02 02020_cast_integer_overflow: [ OK ] 0.17 sec.
2026-02-05 15:55:03 01475_read_subcolumns_storages: [ OK ] 3.58 sec.
2026-02-05 15:55:03 02125_transform_decimal_bug: [ OK ] 0.17 sec.
2026-02-05 15:55:03 02597_column_delete_and_replication: [ OK ] 1.28 sec.
2026-02-05 15:55:03 00178_function_replicate: [ OK ] 0.22 sec.
2026-02-05 15:55:03 00618_nullable_in: [ OK ] 0.22 sec.
2026-02-05 15:55:03 01453_normalize_query_alias_uuid: [ OK ] 0.17 sec.
2026-02-05 15:55:04 01675_distributed_bytes_to_delay_insert: [ OK ] 6.99 sec.
2026-02-05 15:55:04 01333_select_abc_asterisk: [ OK ] 0.22 sec.
2026-02-05 15:55:04 01413_if_array_uuid: [ OK ] 0.12 sec.
2026-02-05 15:55:04 00855_join_with_array_join: [ OK ] 0.27 sec.
2026-02-05 15:55:04 02503_mysql_compat_utc_timestamp: [ OK ] 0.17 sec.
2026-02-05 15:55:04 03040_alias_column_join: [ OK ] 0.17 sec.
2026-02-05 15:55:04 02903_client_insert_in_background: [ OK ] 0.82 sec.
2026-02-05 15:55:04 02932_query_settings_max_size_drop: [ OK ] 0.27 sec.
2026-02-05 15:55:05 00726_modulo_for_date: [ OK ] 0.22 sec.
2026-02-05 15:55:05 01660_join_or_subqueries: [ OK ] 0.27 sec.
2026-02-05 15:55:05 01780_column_sparse_full: [ OK ] 0.67 sec.
2026-02-05 15:55:06 01894_jit_aggregation_function_max_long: [ OK ] 0.82 sec.
2026-02-05 15:55:07 01582_distinct_optimization: [ OK ] 0.93 sec.
2026-02-05 15:55:07 02751_multiquery_with_argument: [ OK ] 1.78 sec.
2026-02-05 15:55:07 01256_negative_generate_random: [ OK ] 0.12 sec.
2026-02-05 15:55:07 00563_shard_insert_into_remote: [ OK ] 0.22 sec.
2026-02-05 15:55:07 00700_decimal_casts: [ OK ] 0.67 sec.
2026-02-05 15:55:08 00956_http_prepared_statements: [ OK ] 0.52 sec.
2026-02-05 15:55:08 02788_fix_logical_error_in_sorting: [ OK ] 0.33 sec.
2026-02-05 15:55:08 02995_index_7: [ OK ] 3.73 sec.
2026-02-05 15:55:08 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.27 sec.
2026-02-05 15:55:08 01834_alias_columns_laziness_filimonov: [ OK ] 0.97 sec.
2026-02-05 15:55:09 01500_StorageFile_write_to_fd: [ OK ] 0.47 sec.
2026-02-05 15:55:09 00834_date_datetime_cmp: [ OK ] 0.17 sec.
2026-02-05 15:55:09 01041_create_dictionary_if_not_exists: [ OK ] 0.22 sec.
2026-02-05 15:55:10 01050_engine_join_view_crash: [ OK ] 0.27 sec.
2026-02-05 15:55:10 00850_global_join_dups: [ OK ] 0.32 sec.
2026-02-05 15:55:10 01766_todatetime64_no_timezone_arg: [ OK ] 0.17 sec.
2026-02-05 15:55:10 01825_type_json_from_map: [ OK ] 2.22 sec.
2026-02-05 15:55:10 01277_convert_field_to_type_logical_error: [ OK ] 0.12 sec.
2026-02-05 15:55:10 01803_untuple_subquery: [ OK ] 0.17 sec.
2026-02-05 15:55:11 02025_nested_func_for_if_combinator: [ OK ] 0.22 sec.
2026-02-05 15:55:11 01579_date_datetime_index_comparison: [ OK ] 0.22 sec.
2026-02-05 15:55:11 00954_resample_combinator: [ OK ] 0.17 sec.
2026-02-05 15:55:11 02205_postgresql_functions: [ OK ] 0.37 sec.
2026-02-05 15:55:11 02047_log_family_complex_structs_data_file_dumps: [ OK ] 3.19 sec.
2026-02-05 15:55:12 02002_global_subqueries_subquery_or_table_name: [ OK ] 0.17 sec.
2026-02-05 15:55:12 01098_sum: [ OK ] 0.22 sec.
2026-02-05 15:55:12 01070_to_decimal_or_null_exception: [ OK ] 0.22 sec.
2026-02-05 15:55:12 00674_join_on_syntax: [ OK ] 0.57 sec.
2026-02-05 15:55:12 02400_create_table_on_cluster_normalization: [ OK ] 0.37 sec.
2026-02-05 15:55:12 02840_grace_hash_join_structure_mismatch: [ OK ] 0.17 sec.
2026-02-05 15:55:13 02798_explain_settings_not_applied_bug: [ OK ] 0.22 sec.
2026-02-05 15:55:13 01927_query_views_log_matview_exceptions: [ OK ] 2.58 sec.
2026-02-05 15:55:13 00378_json_quote_64bit_integers: [ OK ] 0.17 sec.
2026-02-05 15:55:13 01073_blockSerializedSize: [ OK ] 0.62 sec.
2026-02-05 15:55:13 01906_bigint_accurate_cast_ubsan: [ OK ] 0.32 sec.
2026-02-05 15:55:13 02188_table_function_format: [ OK ] 0.22 sec.
2026-02-05 15:55:13 00009_array_join_subquery: [ OK ] 0.17 sec.
2026-02-05 15:55:13 02677_grace_hash_limit_race: [ OK ] 0.27 sec.
2026-02-05 15:55:14 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.12 sec.
2026-02-05 15:55:14 00800_low_cardinality_empty_array: [ OK ] 0.22 sec.
2026-02-05 15:55:14 02293_ilike_on_fixed_strings: [ OK ] 0.22 sec.
2026-02-05 15:55:14 02132_empty_mutation_livelock: [ OK ] 0.22 sec.
2026-02-05 15:55:14 01600_min_max_compress_block_size: [ OK ] 0.17 sec.
2026-02-05 15:55:14 01715_table_function_view_fix: [ OK ] 0.17 sec.
2026-02-05 15:55:14 00957_coalesce_const_nullable_crash: [ OK ] 0.17 sec.
2026-02-05 15:55:14 03145_non_loaded_projection_backup: [ OK ] 1.57 sec.
2026-02-05 15:55:15 02206_array_starts_ends_with: [ OK ] 0.22 sec.
2026-02-05 15:55:15 01761_round_year_bounds: [ OK ] 0.17 sec.
2026-02-05 15:55:15 01825_type_json_schema_race_long: [ OK ] 13.76 sec.
2026-02-05 15:55:15 00936_crc_functions: [ OK ] 0.22 sec.
2026-02-05 15:55:15 03036_udf_user_defined_directory_in_client: [ OK ] 0.82 sec.
2026-02-05 15:55:15 02907_fromDaysSinceYearZero: [ OK ] 0.32 sec.
2026-02-05 15:55:15 01852_jit_if: [ OK ] 0.22 sec.
2026-02-05 15:55:16 02231_bloom_filter_sizing: [ OK ] 0.22 sec.
2026-02-05 15:55:16 02992_settings_overflow: [ OK ] 0.17 sec.
2026-02-05 15:55:16 03247_object_column_copy: [ OK ] 0.22 sec.
2026-02-05 15:55:16 02416_row_policy_always_false_index: [ OK ] 0.17 sec.
2026-02-05 15:55:16 00150_with_totals_and_join: [ OK ] 0.17 sec.
2026-02-05 15:55:16 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 1.32 sec.
2026-02-05 15:55:16 02381_analyzer_join_final: [ OK ] 0.22 sec.
2026-02-05 15:55:16 01943_query_id_check: [ OK ] 0.47 sec.
2026-02-05 15:55:17 03203_drop_detached_partition_all: [ OK ] 0.17 sec.
2026-02-05 15:55:17 01902_table_function_merge_db_params: [ OK ] 0.22 sec.
2026-02-05 15:55:17 02931_file_cluster: [ OK ] 0.57 sec.
2026-02-05 15:55:17 00520_http_nullable: [ OK ] 0.47 sec.
2026-02-05 15:55:17 03049_unknown_identifier_materialized_column: [ OK ] 0.17 sec.
2026-02-05 15:55:17 02835_fuzz_remove_redundant_sorting: [ OK ] 0.22 sec.
2026-02-05 15:55:18 02785_text_with_whitespace_tab_field_delimiter: [ OK ] 1.48 sec.
2026-02-05 15:55:18 01671_ddl_hang_timeout_long: [ OK ] 21.54 sec.
2026-02-05 15:55:18 00183_skip_unavailable_shards: [ OK ] 24.20 sec.
2026-02-05 15:55:18 03225_alter_to_json_not_supported: [ OK ] 0.17 sec.
2026-02-05 15:55:19 02190_format_regexp_cr_in_the_middle: [ OK ] 0.52 sec.
2026-02-05 15:55:19 02985_shard_query_start_time: [ OK ] 0.32 sec.
2026-02-05 15:55:19 03205_parallel_window_finctions_and_column_sparse_bug: [ OK ] 0.22 sec.
2026-02-05 15:55:19 00578_merge_table_and_table_virtual_column: [ OK ] 0.32 sec.
2026-02-05 15:55:19 02302_clash_const_aggegate_join: [ OK ] 0.22 sec.
2026-02-05 15:55:19 01326_fixed_string_comparison_denny_crane: [ OK ] 0.17 sec.
2026-02-05 15:55:19 01713_table_ttl_old_syntax_zookeeper: [ OK ] 0.17 sec.
2026-02-05 15:55:19 02422_read_numbers_as_strings: [ OK ] 0.17 sec.
2026-02-05 15:55:19 02568_and_consistency: [ OK ] 0.22 sec.
2026-02-05 15:55:19 03169_display_column_names_in_footer: [ OK ] 0.22 sec.
2026-02-05 15:55:19 00067_replicate_segfault: [ OK ] 0.12 sec.
2026-02-05 15:55:20 01891_jit_aggregation_function_any_long: [ OK ] 0.67 sec.
2026-02-05 15:55:20 01787_arena_assert_column_nothing: [ OK ] 0.12 sec.
2026-02-05 15:55:20 02962_analyzer_constant_set: [ OK ] 0.22 sec.
2026-02-05 15:55:20 02178_column_function_insert_from: [ OK ] 0.17 sec.
2026-02-05 15:55:20 00700_decimal_aggregates: [ OK ] 0.57 sec.
2026-02-05 15:55:20 01592_long_window_functions1: [ OK ] 0.82 sec.
2026-02-05 15:55:20 00051_any_inner_join: [ OK ] 0.22 sec.
2026-02-05 15:55:21 02813_seriesDecomposeSTL: [ OK ] 0.38 sec.
2026-02-05 15:55:21 00846_join_using_tuple_crash: [ OK ] 0.33 sec.
2026-02-05 15:55:21 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.17 sec.
2026-02-05 15:55:21 00314_sample_factor_virtual_column: [ OK ] 1.33 sec.
2026-02-05 15:55:22 01560_crash_in_agg_empty_arglist: [ OK ] 0.22 sec.
2026-02-05 15:55:22 00512_fractional_time_zones: [ OK ] 1.10 sec.
2026-02-05 15:55:22 01122_totals_rollup_having_block_header: [ OK ] 0.23 sec.
2026-02-05 15:55:22 02474_analyzer_subqueries_table_expression_modifiers: [ OK ] 0.17 sec.
2026-02-05 15:55:22 02685_bson2: [ OK ] 0.17 sec.
2026-02-05 15:55:22 03151_analyzer_view_read_only_necessary_columns: [ OK ] 0.17 sec.
2026-02-05 15:55:22 01586_columns_pruning: [ OK ] 0.32 sec.
2026-02-05 15:55:23 01825_new_type_json_ephemeral: [ OK ] 0.17 sec.
2026-02-05 15:55:23 00953_indices_alter_exceptions: [ OK ] 0.88 sec.
2026-02-05 15:55:23 02813_func_now_and_alias: [ OK ] 0.17 sec.
2026-02-05 15:55:23 00900_orc_arrays_load: [ OK ] 1.23 sec.
2026-02-05 15:55:23 00132_sets: [ OK ] 0.22 sec.
2026-02-05 15:55:23
2026-02-05 15:55:23 807 tests passed. 0 tests skipped. 1050.10 s elapsed (Process-4).
2026-02-05 15:55:23 02782_inconsistent_formatting_and_constant_folding: [ OK ] 0.22 sec.
2026-02-05 15:55:23
2026-02-05 15:55:23 Having 1 errors! 937 tests passed. 0 tests skipped. 1050.20 s elapsed (Process-9).
2026-02-05 15:55:23 02962_analyzer_const_in_count_distinct: [ OK ] 0.17 sec.
2026-02-05 15:55:23
2026-02-05 15:55:23 876 tests passed. 0 tests skipped. 1050.23 s elapsed (Process-8).
2026-02-05 15:55:23 00731_long_merge_tree_select_opened_files: [ OK ] 5.94 sec.
2026-02-05 15:55:23
2026-02-05 15:55:23 Having 1 errors! 739 tests passed. 0 tests skipped. 1050.24 s elapsed (Process-10).
2026-02-05 15:55:24 01602_max_distributed_connections: [ OK ] 7.15 sec.
2026-02-05 15:55:24
2026-02-05 15:55:24 839 tests passed. 1 tests skipped. 1051.67 s elapsed (Process-6).
2026-02-05 15:55:55 02530_dictionaries_update_field: [ OK ] 58.11 sec.
2026-02-05 15:55:55
2026-02-05 15:55:55 737 tests passed. 1 tests skipped. 1082.60 s elapsed (Process-3).
2026-02-05 15:56:20 02481_async_insert_dedup: [ OK ] 95.90 sec.
2026-02-05 15:56:20
2026-02-05 15:56:20 Having 1 errors! 887 tests passed. 1 tests skipped. 1107.28 s elapsed (Process-7).
2026-02-05 15:56:28 03207_json_read_subcolumns_2_compact_merge_tree: [ OK ] 73.92 sec.
2026-02-05 15:56:28
2026-02-05 15:56:28 Having 1 errors! 680 tests passed. 0 tests skipped. 1115.19 s elapsed (Process-5).
2026-02-05 15:56:35 Running 571 stateless tests (MainProcess).
2026-02-05 15:56:41 03276_parquet_output_compression_level: [ OK ] 6.04 sec.
2026-02-05 15:56:59 03254_session_expire_in_use_in_http_interface: [ OK ] 18.49 sec.
2026-02-05 15:57:01 03231_restore_user_with_existing_role: [ OK ] 2.28 sec.
2026-02-05 15:57:07 03206_replication_lag_metric: [ OK ] 5.19 sec.
2026-02-05 15:57:07 03198_table_function_directory_path: [ OK ] 0.22 sec.
2026-02-05 15:57:07 03198_dynamic_read_subcolumns: [ OK ] 0.32 sec.
2026-02-05 15:57:08 03174_exact_rows_before_aggregation: [ OK ] 0.42 sec.
2026-02-05 15:57:08 03168_loop_engine_with_parallel_replicas: [ OK ] 0.17 sec.
2026-02-05 15:57:08 03164_orc_signedness: [ OK ] 0.32 sec.
2026-02-05 15:57:09 03164_s3_settings_for_queries_and_merges: [ OK ] 0.98 sec.
2026-02-05 15:57:11 03154_lazy_token_iterator: [ OK ] 2.03 sec.
2026-02-05 15:57:24 03151_unload_index_race: [ OK ] 12.61 sec.
2026-02-05 15:57:35 03147_system_columns_access_checks: [ OK ] 9.84 sec.
2026-02-05 15:57:35 03147_parquet_memory_tracking: [ OK ] 0.82 sec.
2026-02-05 15:57:36 03147_table_function_loop: [ OK ] 0.22 sec.
2026-02-05 15:58:03 03144_parallel_alter_add_drop_column_zookeeper_on_steroids: [ OK ] 27.27 sec.
2026-02-05 15:58:04 03141_fetches_errors_stress: [ OK ] 0.72 sec.
2026-02-05 15:58:06 03128_system_unload_primary_key: [ OK ] 2.23 sec.
2026-02-05 15:58:07 03101_analyzer_identifiers_3: [ OK ] 0.32 sec.
2026-02-05 15:58:08 03096_http_interface_role_query_param: [ OK ] 0.97 sec.
2026-02-05 15:58:08 03033_index_definition_sql_udf_bug: [ OK ] 0.17 sec.
2026-02-05 15:58:10 03032_dynamically_resize_filesystem_cache_2: [ OK ] 1.67 sec.
2026-02-05 15:58:47 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 37.26 sec.
2026-02-05 15:58:49 03008_s3_plain_rewritable_fault: [ OK ] 2.43 sec.
2026-02-05 15:59:15 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 25.41 sec.
2026-02-05 15:59:51 03008_deduplication_several_mv_into_one_table_replicated: [ OK ] 36.69 sec.
2026-02-05 16:00:18 03008_deduplication_mv_generates_several_blocks_nonreplicated: [ OK ] 27.02 sec.
2026-02-05 16:00:42 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 23.80 sec.
2026-02-05 16:01:18 03008_deduplication_insert_several_blocks_replicated: [ OK ] 35.64 sec.
2026-02-05 16:01:19 03002_part_log_rmt_fetch_merge_error: [ OK ] 1.32 sec.
2026-02-05 16:01:24 03002_part_log_rmt_fetch_mutate_error: [ OK ] 4.58 sec.
2026-02-05 16:01:24 03000_traverse_shadow_system_data_paths: [ OK ] 0.42 sec.
2026-02-05 16:01:25 02990_rmt_replica_path_uuid: [ OK ] 0.27 sec.
2026-02-05 16:01:25 02989_system_tables_metadata_version: [ OK ] 0.32 sec.
2026-02-05 16:01:25 02983_const_sharding_key: [ OK ] 0.27 sec.
2026-02-05 16:01:28 02980_dist_insert_readonly_replica: [ OK ] 2.48 sec.
2026-02-05 16:01:28 02977_csv_format_support_tuple: [ OK ] 0.17 sec.
2026-02-05 16:01:29 02976_system_zookeeper_filters: [ OK ] 0.88 sec.
2026-02-05 16:01:29 02975_system_zookeeper_retries: [ OK ] 0.32 sec.
2026-02-05 16:01:31 02973_backup_of_in_memory_compressed: [ OK ] 1.37 sec.
2026-02-05 16:02:07 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 36.19 sec.
2026-02-05 16:02:07 02961_drop_tables: [ OK ] 0.32 sec.
2026-02-05 16:02:08 02961_storage_config_volume_priority: [ OK ] 0.87 sec.
2026-02-05 16:02:08 02960_partition_by_udf: [ OK ] 0.22 sec.
2026-02-05 16:02:09 02960_validate_database_engines: [ OK ] 0.12 sec.
2026-02-05 16:02:09 02951_parallel_parsing_json_compact_each_row: [ OK ] 0.82 sec.
2026-02-05 16:02:10 02950_dictionary_short_circuit: [ OK ] 0.92 sec.
2026-02-05 16:02:12 02950_distributed_initial_query_event: [ OK ] 1.63 sec.
2026-02-05 16:02:13 02947_non_post_request_should_be_readonly: [ OK ] 0.47 sec.
2026-02-05 16:02:16 02944_dynamically_change_filesystem_cache_size: [ OK ] 3.08 sec.
2026-02-05 16:02:18 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 1.92 sec.
2026-02-05 16:02:19 02940_system_stacktrace_optimizations: [ OK ] 1.68 sec.
2026-02-05 16:02:22 02933_change_cache_setting_without_restart: [ OK ] 2.43 sec.
2026-02-05 16:02:22 02931_max_num_to_warn: [ OK ] 0.42 sec.
2026-02-05 16:02:24 02919_insert_meet_eternal_hardware_error: [ OK ] 1.28 sec.
2026-02-05 16:02:24 02918_fuzzjson_table_function: [ OK ] 0.82 sec.
2026-02-05 16:02:28 02916_move_partition_inactive_replica: [ OK ] 3.63 sec.
2026-02-05 16:02:31 02915_move_partition_inactive_replica: [ OK ] 2.83 sec.
2026-02-05 16:02:31 02911_row_policy_on_cluster: [ OK ] 0.52 sec.
2026-02-05 16:02:32 02911_support_alias_column_in_indices: [ OK ] 0.22 sec.
2026-02-05 16:02:32 02910_prefetch_unexpceted_exception: [ OK ] 0.17 sec.
2026-02-05 16:02:32 02908_empty_named_collection: [ OK ] 0.17 sec.
2026-02-05 16:02:35 02908_many_requests_to_system_replicas: [ OK ] 2.08 sec.
2026-02-05 16:02:39 02907_suggestions_readonly_user: [ OK ] 4.59 sec.
2026-02-05 16:02:40 02906_orc_tuple_field_prune: [ OK ] 0.32 sec.
2026-02-05 16:02:40 02895_npy_output_format: [ OK ] 0.87 sec.
2026-02-05 16:02:42 02892_orc_filter_pushdown: [ OK ] 1.22 sec.
2026-02-05 16:02:43 02888_replicated_merge_tree_creation: [ OK ] 1.83 sec.
2026-02-05 16:02:44 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.32 sec.
2026-02-05 16:02:45 02884_async_insert_native_protocol_1: [ OK ] 1.02 sec.
2026-02-05 16:02:45 02884_async_insert_skip_settings: [ OK ] 0.42 sec.
2026-02-05 16:02:50 02884_authentication_quota: [ OK ] 4.79 sec.
2026-02-05 16:02:51 02884_async_insert_native_protocol_3: [ OK ] 1.18 sec.
2026-02-05 16:03:06 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 14.27 sec.
2026-02-05 16:03:10 02871_peak_threads_usage: [ OK ] 4.84 sec.
2026-02-05 16:03:11 02867_create_user_ssh: [ OK ] 0.17 sec.
2026-02-05 16:03:11 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.27 sec.
2026-02-05 16:03:12 02845_threads_count_in_distributed_queries: [ OK ] 1.18 sec.
2026-02-05 16:03:13 02843_insertion_table_schema_infer: [ OK ] 0.52 sec.
2026-02-05 16:03:13 02842_truncate_database: [ OK ] 0.37 sec.
2026-02-05 16:03:14 02841_parquet_filter_pushdown: [ OK ] 1.33 sec.
2026-02-05 16:03:15 02833_multiprewhere_extra_column: [ OK ] 0.27 sec.
2026-02-05 16:03:18 02832_alter_max_sessions_for_user: [ OK ] 3.63 sec.
2026-02-05 16:03:19 02813_avro_union_with_one_type: [ OK ] 0.62 sec.
2026-02-05 16:03:21 02808_filesystem_cache_drop_query: [ OK ] 1.83 sec.
2026-02-05 16:03:23 02796_calculate_text_stack_trace: [ OK ] 2.23 sec.
2026-02-05 16:03:27 02789_filesystem_cache_alignment: [ OK ] 3.78 sec.
2026-02-05 16:03:28 02789_table_functions_errors: [ OK ] 0.82 sec.
2026-02-05 16:03:48 02782_uniq_exact_parallel_merging_bug: [ OK ] 19.58 sec.
2026-02-05 16:03:48 02775_show_columns_called_from_mysql: [ OK ] 0.57 sec.
2026-02-05 16:03:48 02775_show_columns_called_from_clickhouse: [ OK ] 0.17 sec.
2026-02-05 16:03:49 02771_multidirectory_globs_storage_file: [ OK ] 1.07 sec.
2026-02-05 16:03:50 02762_replicated_database_no_args: [ OK ] 0.17 sec.
2026-02-05 16:03:50 02751_ip_types_aggregate_functions_states: [ OK ] 0.37 sec.
2026-02-05 16:03:51 02736_reading_and_writing_structure_fields: [ OK ] 0.98 sec.
2026-02-05 16:03:52 02735_capnp_case_insensitive_names_matching: [ OK ] 0.53 sec.
2026-02-05 16:03:54 02735_parquet_encoder: [ OK ] 1.93 sec.
2026-02-05 16:03:55 02726_async_insert_flush_queue: [ OK ] 1.17 sec.
2026-02-05 16:04:05 02726_async_insert_flush_stress: [ OK ] 10.26 sec.
2026-02-05 16:04:07 02725_database_hdfs: [ OK ] 1.93 sec.
2026-02-05 16:04:08 02725_local_query_parameters: [ OK ] 0.52 sec.
2026-02-05 16:04:08 02725_url_support_virtual_column: [ OK ] 0.22 sec.
2026-02-05 16:04:31 02725_start_stop_fetches: [ OK ] 22.74 sec.
2026-02-05 16:04:32 02724_limit_num_mutations: [ OK ] 1.57 sec.
2026-02-05 16:04:33 02724_show_indexes: [ OK ] 0.42 sec.
2026-02-05 16:04:34 02724_decompress_filename_exception: [ OK ] 1.83 sec.
2026-02-05 16:04:36 02724_database_s3: [ OK ] 1.48 sec.
2026-02-05 16:04:36 02723_parallelize_output_setting: [ OK ] 0.17 sec.
2026-02-05 16:04:40 02722_database_filesystem: [ OK ] 3.58 sec.
2026-02-05 16:04:40 02718_insert_meet_hardware_error: [ OK ] 0.22 sec.
2026-02-05 16:04:44 02713_create_user_substitutions: [ OK ] 4.44 sec.
2026-02-05 16:04:45 02710_default_replicated_parameters: [ OK ] 0.17 sec.
2026-02-05 16:04:45 02710_show_table: [ OK ] 0.17 sec.
2026-02-05 16:04:45 02706_show_columns: [ OK ] 0.42 sec.
2026-02-05 16:04:46 02705_capnp_more_types: [ OK ] 0.77 sec.
2026-02-05 16:05:03 02700_s3_part_INT_MAX: [ OK ] 16.88 sec.
2026-02-05 16:05:04 02686_postgres_protocol_decimal_256: [ OK ] 0.57 sec.
2026-02-05 16:05:07 02597_column_update_tricky_expression_and_replication: [ OK ] 3.03 sec.
2026-02-05 16:05:18 02581_share_big_sets_between_mutation_tasks_long: [ OK ] 11.56 sec.
2026-02-05 16:05:27 02581_share_big_sets_between_multiple_mutations_tasks_long: [ OK ] 8.75 sec.
2026-02-05 16:05:27 02578_parameterized_rename_queries: [ OK ] 0.27 sec.
2026-02-05 16:05:28 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.42 sec.
2026-02-05 16:05:30 02566_ipv4_ipv6_binary_formats: [ OK ] 1.98 sec.
2026-02-05 16:05:30 02563_analyzer_merge: [ OK ] 0.32 sec.
2026-02-05 16:05:31 02561_temporary_table_sessions: [ OK ] 0.57 sec.
2026-02-05 16:05:31 02554_rewrite_count_distinct_if_with_count_distinct_implementation: [ OK ] 0.17 sec.
2026-02-05 16:05:31 02541_arrow_duration_type: [ OK ] 0.62 sec.
2026-02-05 16:05:32 02536_hdfs_cluster_use_structure_from_table: [ OK ] 0.22 sec.
2026-02-05 16:05:40 02535_max_parallel_replicas_custom_key_mt: [ OK ] 7.85 sec.
2026-02-05 16:05:48 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 8.10 sec.
2026-02-05 16:05:48 02522_avro_complicate_schema: [ OK ] 0.62 sec.
2026-02-05 16:05:49 02521_avro_union_null_nested: [ OK ] 0.62 sec.
2026-02-05 16:06:00 02515_cleanup_async_insert_block_ids: [ OK ] 11.16 sec.
2026-02-05 16:06:02 02513_insert_without_materialized_columns: [ OK ] 1.52 sec.
2026-02-05 16:06:03 02511_parquet_orc_missing_columns: [ OK ] 1.22 sec.
2026-02-05 16:06:04 02510_orc_map_indexes: [ OK ] 0.62 sec.
2026-02-05 16:06:05 02504_regexp_dictionary_yaml_source: [ OK ] 1.68 sec.
2026-02-05 16:06:06 02503_cache_on_write_with_small_segment_size: [ OK ] 1.12 sec.
2026-02-05 16:06:08 02503_insert_storage_snapshot: [ OK ] 1.98 sec.
2026-02-05 16:06:09 02501_deep_recusion_schema_inference: [ OK ] 0.77 sec.
2026-02-05 16:06:20 02497_trace_events_stress_long: [ OK ] 10.56 sec.
2026-02-05 16:06:20 02496_storage_s3_profile_events: [ OK ] 0.37 sec.
2026-02-05 16:06:21 02495_s3_filter_by_file: [ OK ] 0.32 sec.
2026-02-05 16:06:21 02494_query_cache_user_quotas_after_drop: [ OK ] 0.22 sec.
2026-02-05 16:06:22 02494_query_cache_query_log: [ OK ] 0.82 sec.
2026-02-05 16:06:22 02494_query_cache_min_query_duration: [ OK ] 0.17 sec.
2026-02-05 16:06:22 02494_query_cache_case_agnostic_matching: [ OK ] 0.32 sec.
2026-02-05 16:06:22 02494_query_cache_nondeterministic_functions: [ OK ] 0.22 sec.
2026-02-05 16:06:23 02494_query_cache_secrets: [ OK ] 0.17 sec.
2026-02-05 16:06:24 02494_query_cache_nested_query_bug: [ OK ] 1.63 sec.
2026-02-05 16:06:25 02494_query_cache_compression: [ OK ] 0.22 sec.
2026-02-05 16:06:25 02494_query_cache_tag: [ OK ] 0.22 sec.
2026-02-05 16:06:25 02494_query_cache_totals_extremes: [ OK ] 0.22 sec.
2026-02-05 16:06:25 02494_query_cache_system_tables: [ OK ] 0.27 sec.
2026-02-05 16:06:26 02494_query_cache_sparse_columns: [ OK ] 0.22 sec.
2026-02-05 16:06:26 02494_query_cache_min_query_runs: [ OK ] 0.27 sec.
2026-02-05 16:06:26 02494_query_cache_exception_handling: [ OK ] 0.22 sec.
2026-02-05 16:06:26 02494_query_cache_eligible_queries: [ OK ] 0.27 sec.
2026-02-05 16:06:33 02494_query_cache_ttl_long: [ OK ] 6.20 sec.
2026-02-05 16:06:33 02494_query_cache_explain: [ OK ] 0.17 sec.
2026-02-05 16:06:33 02494_query_cache_events: [ OK ] 0.27 sec.
2026-02-05 16:06:35 02494_trace_log_profile_events: [ OK ] 1.38 sec.
2026-02-05 16:06:35 02494_query_cache_bugs: [ OK ] 0.22 sec.
2026-02-05 16:06:40 02494_query_cache_user_isolation: [ OK ] 5.49 sec.
2026-02-05 16:06:41 02494_query_cache_normalize_ast: [ OK ] 0.37 sec.
2026-02-05 16:06:41 02494_query_cache_drop_cache: [ OK ] 0.22 sec.
2026-02-05 16:06:41 02494_query_cache_squash_partial_results: [ OK ] 0.32 sec.
2026-02-05 16:06:42 02494_query_cache_passive_usage: [ OK ] 0.32 sec.
2026-02-05 16:06:42 02494_query_cache_asynchronous_metrics: [ OK ] 0.17 sec.
2026-02-05 16:06:42 02494_query_cache_key: [ OK ] 0.32 sec.
2026-02-05 16:06:42 02494_query_cache_user_quotas: [ OK ] 0.22 sec.
2026-02-05 16:06:43 02484_substitute_udf_storage_args: [ OK ] 0.22 sec.
2026-02-05 16:06:43 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.17 sec.
2026-02-05 16:06:43 02483_substitute_udf_create: [ OK ] 0.27 sec.
2026-02-05 16:06:44 02483_capnp_decimals: [ OK ] 0.82 sec.
2026-02-05 16:06:44 02483_add_engine_full_column_to_system_databases: [ OK ] 0.22 sec.
2026-02-05 16:06:45 02482_new_json_nested_arrays_with_same_keys: [ OK ] 0.53 sec.
2026-02-05 16:06:46 02482_capnp_list_of_structs: [ OK ] 1.02 sec.
2026-02-05 16:06:46 02482_json_nested_arrays_with_same_keys: [ OK ] 0.57 sec.
2026-02-05 16:06:47 02481_custom_separated_and_template_with_csv_field: [ OK ] 0.92 sec.
2026-02-05 16:06:48 02481_s3_throw_if_mismatch_files: [ OK ] 0.27 sec.
2026-02-05 16:06:48 02480_s3_support_wildcard: [ OK ] 0.62 sec.
2026-02-05 16:06:50 02477_projection_materialize_and_zero_copy: [ OK ] 1.23 sec.
2026-02-05 16:06:50 02473_infile_progress: [ OK ] 0.52 sec.
2026-02-05 16:06:51 02459_glob_for_recursive_directory_traversal: [ OK ] 0.97 sec.
2026-02-05 16:06:51 02458_hdfs_cluster_schema_inference: [ OK ] 0.27 sec.
2026-02-05 16:06:52 02458_use_structure_from_insertion_table: [ OK ] 0.32 sec.
2026-02-05 16:06:52 02458_default_setting: [ OK ] 0.17 sec.
2026-02-05 16:06:58 02455_one_row_from_csv_memory_usage: [ OK ] 6.40 sec.
2026-02-05 16:06:59 02454_json_object_each_row_column_for_object_name: [ OK ] 0.17 sec.
2026-02-05 16:07:39 02447_drop_database_replica: [ OK ] 40.32 sec.
2026-02-05 16:07:42 02440_mutations_finalization: [ OK ] 3.23 sec.
2026-02-05 16:07:42 02422_msgpack_uuid_wrong_column: [ OK ] 0.22 sec.
2026-02-05 16:07:46 02422_allow_implicit_no_password: [ OK ] 3.38 sec.
2026-02-05 16:07:51 02421_record_errors_row_by_input_format: [ OK ] 5.44 sec.
2026-02-05 16:07:54 02417_load_marks_async: [ OK ] 2.18 sec.
2026-02-05 16:07:54 02417_json_object_each_row_format: [ OK ] 0.22 sec.
2026-02-05 16:07:54 02416_input_json_formats: [ OK ] 0.22 sec.
2026-02-05 16:07:55 02416_rename_database_rbac: [ OK ] 0.72 sec.
2026-02-05 16:07:55 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.17 sec.
2026-02-05 16:07:55 02405_avro_read_nested: [ OK ] 0.22 sec.
2026-02-05 16:07:56 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.43 sec.
2026-02-05 16:07:58 02404_memory_bound_merging: [ OK ] 2.73 sec.
2026-02-05 16:08:01 02402_external_disk_mertrics: [ OK ] 2.48 sec.
2026-02-05 16:08:02 02402_capnp_format_segments_overflow: [ OK ] 0.62 sec.
2026-02-05 16:08:02 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec.
2026-02-05 16:08:02 Reason: disabled
2026-02-05 16:08:02 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2026-02-05 16:08:02 Reason: disabled
2026-02-05 16:08:02 02391_recursive_buffer: [ OK ] 0.22 sec.
2026-02-05 16:08:02 02385_profile_events_overflow: [ OK ] 0.27 sec.
2026-02-05 16:08:03 02378_part_log_profile_events_replicated: [ OK ] 0.52 sec.
2026-02-05 16:08:03 02377_quota_key_http: [ OK ] 0.52 sec.
2026-02-05 16:08:04 02377_quota_key: [ OK ] 1.22 sec.
2026-02-05 16:08:05 02376_arrow_dict_with_string: [ OK ] 0.17 sec.
2026-02-05 16:08:05 02375_system_schema_inference_cache: [ OK ] 0.22 sec.
2026-02-05 16:08:05 02373_heap_buffer_overflow_in_avro: [ OK ] 0.57 sec.
2026-02-05 16:08:14 02372_data_race_in_avro: [ OK ] 8.61 sec.
2026-02-05 16:08:15 02364_window_view_segfault: [ OK ] 0.72 sec.
2026-02-05 16:08:15 02360_clickhouse_local_config-option: [ OK ] 0.62 sec.
2026-02-05 16:08:36 02352_rwlock: [ OK ] 20.90 sec.
2026-02-05 16:08:37 02350_views_max_insert_threads: [ OK ] 0.42 sec.
2026-02-05 16:08:37 02346_additional_filters_distr: [ OK ] 0.17 sec.
2026-02-05 16:08:55 02344_insert_profile_events_stress: [ OK ] 18.08 sec.
2026-02-05 16:08:56 02343_read_from_s3_compressed_blocks: [ OK ] 0.42 sec.
2026-02-05 16:08:56 02339_analyzer_matcher_basic: [ OK ] 0.57 sec.
2026-02-05 16:08:57 02337_drop_filesystem_cache_access: [ OK ] 0.92 sec.
2026-02-05 16:08:58 02337_analyzer_columns_basic: [ OK ] 0.42 sec.
2026-02-05 16:09:00 02336_sparse_columns_s3: [ OK ] 1.88 sec.
2026-02-05 16:09:02 02327_capnproto_protobuf_empty_messages: [ OK ] 2.48 sec.
2026-02-05 16:09:02 02323_null_modifier_in_table_function: [ OK ] 0.22 sec.
2026-02-05 16:09:02 02322_sql_insert_format: [ OK ] 0.22 sec.
2026-02-05 16:09:04 02314_avro_null_as_default: [ OK ] 1.02 sec.
2026-02-05 16:09:04 02314_csv_tsv_skip_first_lines: [ OK ] 0.24 sec.
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/rxlpmopjhvbwteheiyzvjckrqbpwllff HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/vdohaxcgqgqmlazpxiwghslwmipshgbg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/lnahxmvxyyxslxyjuonrztgcvvjdpkag HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/vwcbgcowfgdjiynddojxiajyjcmlergy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/vjwonlqnfajialzehdytqgpeyjcingcy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/qizchuigbxdjlvzmdrfnuvulrpcfuxti HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/vmqdwjwhyoeplrqpupdsjieaktvpwnjr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/njzifuorbwnzkcpvbhrkhmynvzchhbju HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "PUT /devstoreaccount1/cont/abzeaabnpmtpwbcbhkskjxvzlzswnzis HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "GET /devstoreaccount1/cont/lnahxmvxyyxslxyjuonrztgcvvjdpkag HTTP/1.1" 206 184
127.0.0.1 - - [05/Feb/2026:19:09:10 +0000] "GET /devstoreaccount1/cont/vdohaxcgqgqmlazpxiwghslwmipshgbg HTTP/1.1" 206 1002058
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/abzeaabnpmtpwbcbhkskjxvzlzswnzis HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/qizchuigbxdjlvzmdrfnuvulrpcfuxti HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/vwcbgcowfgdjiynddojxiajyjcmlergy HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/lnahxmvxyyxslxyjuonrztgcvvjdpkag HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/vdohaxcgqgqmlazpxiwghslwmipshgbg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/vjwonlqnfajialzehdytqgpeyjcingcy HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/njzifuorbwnzkcpvbhrkhmynvzchhbju HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/vmqdwjwhyoeplrqpupdsjieaktvpwnjr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:11 +0000] "DELETE /devstoreaccount1/cont/rxlpmopjhvbwteheiyzvjckrqbpwllff HTTP/1.1" 202 -
2026-02-05 16:09:11 02313_filesystem_cache_seeks: [ OK ] 7.45 sec.
2026-02-05 16:09:12 02313_avro_records_and_maps: [ OK ] 0.22 sec.
2026-02-05 16:09:12 02311_system_zookeeper_insert_priv: [ OK ] 0.67 sec.
2026-02-05 16:09:12 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.17 sec.
2026-02-05 16:09:13 02302_defaults_in_columnar_formats: [ OK ] 0.17 sec.
2026-02-05 16:09:13 02302_s3_file_pruning: [ OK ] 0.52 sec.
2026-02-05 16:09:14 02297_regex_parsing_file_names: [ OK ] 1.02 sec.
2026-02-05 16:09:25 02294_overcommit_overflow: [ OK ] 10.82 sec.
2026-02-05 16:09:25 02294_fp_seconds_profile: [ OK ] 0.17 sec.
2026-02-05 16:09:26 02293_test_zstd_window_log_max: [ OK ] 0.87 sec.
2026-02-05 16:09:26 02293_arrow_dictionary_indexes: [ OK ] 0.17 sec.
2026-02-05 16:09:29 02293_formats_json_columns: [ OK ] 2.98 sec.
2026-02-05 16:09:30 02286_use_file_descriptor_in_table_function_file: [ OK ] 0.97 sec.
127.0.0.1 - - [05/Feb/2026:19:09:35 +0000] "PUT /devstoreaccount1/cont/mikaxwyanduyukvjmbhjhzlnfwljypyc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/kuhjaotntgpsybyghteoclmbkarkslmu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/wfftiokuqxiddrlnmsllgyhnogjicdra HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/ojrwmayxwdfmecfwbkkqlhjcxhjmppuz HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/obobeaorvzfjpmuphvnsitpammwlkawm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/akhahvssgpiegobmbhkppxyscbeizrgw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/cmtxldfprsnskizqiksliccishguupqt HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/qfmhvmjplwgyhehgjajozwkxrpawnvcu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/yiahqgbhqbjkiyvqkbikyvklismfnqfr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "PUT /devstoreaccount1/cont/eqzihbhjxemttfyxhmrzpalbcywihvhu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "GET /devstoreaccount1/cont/wfftiokuqxiddrlnmsllgyhnogjicdra HTTP/1.1" 206 60
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "GET /devstoreaccount1/cont/kuhjaotntgpsybyghteoclmbkarkslmu HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:09:36 +0000] "GET /devstoreaccount1/cont/kuhjaotntgpsybyghteoclmbkarkslmu HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/eqzihbhjxemttfyxhmrzpalbcywihvhu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/cmtxldfprsnskizqiksliccishguupqt HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/obobeaorvzfjpmuphvnsitpammwlkawm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/wfftiokuqxiddrlnmsllgyhnogjicdra HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/kuhjaotntgpsybyghteoclmbkarkslmu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/ojrwmayxwdfmecfwbkkqlhjcxhjmppuz HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/akhahvssgpiegobmbhkppxyscbeizrgw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/yiahqgbhqbjkiyvqkbikyvklismfnqfr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/qfmhvmjplwgyhehgjajozwkxrpawnvcu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:09:37 +0000] "DELETE /devstoreaccount1/cont/mikaxwyanduyukvjmbhjhzlnfwljypyc HTTP/1.1" 202 -
2026-02-05 16:09:38 02286_drop_filesystem_cache: [ OK ] 7.60 sec.
2026-02-05 16:09:49 02286_mysql_dump_input_format: [ OK ] 11.17 sec.
2026-02-05 16:09:50 02270_stdin_with_query_or_infile_data: [ OK ] 1.27 sec.
2026-02-05 16:11:12 02265_test_dns_profile_events: [ OK ] 81.26 sec.
2026-02-05 16:11:12 02265_rename_join_ordinary_to_atomic: [ OK ] 0.17 sec.
2026-02-05 16:11:13 02263_lazy_mark_load: [ OK ] 1.43 sec.
2026-02-05 16:11:14 02262_column_ttl: [ OK ] 1.02 sec.
2026-02-05 16:11:15 02252_jit_profile_events: [ OK ] 0.32 sec.
2026-02-05 16:11:16 02247_names_order_in_json_and_tskv: [ OK ] 1.42 sec.
2026-02-05 16:11:20 02247_written_bytes_quota: [ OK ] 3.53 sec.
2026-02-05 16:11:23 02246_async_insert_quota: [ OK ] 3.48 sec.
2026-02-05 16:11:24 02245_parquet_skip_unknown_type: [ OK ] 0.82 sec.
2026-02-05 16:11:25 02244_hdfs_cluster: [ OK ] 0.57 sec.
2026-02-05 16:11:25 02244_lowcardinality_hash_join: [ OK ] 0.23 sec.
2026-02-05 16:11:25 02244_column_names_in_shcmea_inference: [ OK ] 0.22 sec.
2026-02-05 16:11:36 02243_drop_user_grant_race: [ OK ] 11.11 sec.
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/slkyvfhmchdxlnyenzzhuvtvpfoyhaxb HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/rnmekeqyfqtpnmbrzdrkbawxgkzfgtth HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/meyzrvfjyfhsmwcaphhhldnimswjpjjf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/siywhlacopavywgtrjhnnqpndlxjeevw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/saqtbxhltqxtauwskqcobmgtejfpmbzi HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/ovxxozlpsqdsitejvmitvwajtkzxmnaw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/plwreilzacyqbtpeejufpscjybfbibqo HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/lkuqepwxmsfvrnogqkgausrdmvgwvmdd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/auvedlbjemrfsdiosohzsobaoqfarrng HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "PUT /devstoreaccount1/cont/ysmuenirbdmtwpufmwubyynaqedqclqe HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "GET /devstoreaccount1/cont/meyzrvfjyfhsmwcaphhhldnimswjpjjf HTTP/1.1" 206 520
127.0.0.1 - - [05/Feb/2026:19:11:40 +0000] "GET /devstoreaccount1/cont/rnmekeqyfqtpnmbrzdrkbawxgkzfgtth HTTP/1.1" 206 808111
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/ysmuenirbdmtwpufmwubyynaqedqclqe HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/plwreilzacyqbtpeejufpscjybfbibqo HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/saqtbxhltqxtauwskqcobmgtejfpmbzi HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/rnmekeqyfqtpnmbrzdrkbawxgkzfgtth HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/meyzrvfjyfhsmwcaphhhldnimswjpjjf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/siywhlacopavywgtrjhnnqpndlxjeevw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/ovxxozlpsqdsitejvmitvwajtkzxmnaw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/auvedlbjemrfsdiosohzsobaoqfarrng HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/lkuqepwxmsfvrnogqkgausrdmvgwvmdd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:11:41 +0000] "DELETE /devstoreaccount1/cont/slkyvfhmchdxlnyenzzhuvtvpfoyhaxb HTTP/1.1" 202 -
2026-02-05 16:11:41 02242_system_filesystem_cache_log_table: [ OK ] 4.44 sec.
2026-02-05 16:11:43 02242_arrow_orc_parquet_nullable_schema_inference: [ OK ] 2.18 sec.
2026-02-05 16:11:54 02242_delete_user_race: [ OK ] 10.81 sec.
127.0.0.1 - - [05/Feb/2026:19:12:06 +0000] "PUT /devstoreaccount1/cont/jbdxziuhrszxhvvngvwibupnxuitaxsg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/xveuivyezdgrbyjcvpwetxxsjryzzupf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/mlwvwwegfqgzlqjylppiurzgdyxuaznm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/uklrpgavjvwdcsnngkgbelylbsovpffy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/ccxkudvdttbswnltxjujtjvwuoddssgw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/yohxahxypvbbjqaqqyvhqvtedkclmeit HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/upexhcoydvqgfdvzrbgsqfwopjlqkegt HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/rlrvzxcaygeukykblabmbjbqzfuyzmwh HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:07 +0000] "PUT /devstoreaccount1/cont/mpnwwrcxypbrvbudpveppahhkfuvprkz HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/blzdpzogcutulluigtdhsjifspsnfbee HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/plkktwieopvzihawrwsqbktyrleayzvy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/cnhwyvjomdxmqfnvmyqwrrxkzrefjukf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/taqzeokfzgenjlmiuxzswhtaeaomyszm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/ifjyatjufxkmmpsjimouyzmiadmjmpmp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/lhrbcywqjrauoganpluxxmuzorqgqylw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/onfoyxeigsreajhgsketgqprekvmehax HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:09 +0000] "PUT /devstoreaccount1/cont/dlctkhwjgjymopjubzksrxaswgfgskwp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/zbboonkiujgkeitnlnaahafodyxwyont HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/rgwpkbnsbqsgefbgkjetdfekodbshqat HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/ibfzfyuwnuxcheleomkgyqhjwbysvxuj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/zcjnahciabkqymctyioinaektqafkgri HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/aslbyofigqzrnpwkxwwajkuedcveshoh HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/ytchamnlhxnwmvdsxywlthobyaoqqyfj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/fcijdjucmsdzaopyhiuilwncavqxihfo HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/nsehbxkntqglyovggbnggbfadkbyjymv HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/vvwvasrpmoxtilwqqgewewmrqvbysabi HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/nylntopociutvouuacebcbuimlsyoywd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/fwyzscpcjhghcwjfjnkvrxvbseudluhu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/tksxsczpqtrbcauwesondedhmqxztkdp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/aabgbyvwocbwjyfdukmjnfhyfqceycei HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/oyrizfpgfitqevnfrgoyptfaggribcwh HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/kcvumgkgxzdzqejapxbvkdiaqtukamgr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/bqgbbdfszeqopltghnykrlhiplyzbgbs HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/ybhtdbbytdkogcknlqaqshixjzpcnkkv HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/bzwnokgwbsgkwoyfxzeqgccbbqkuqzfu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/izeedpziaxhbgtxjqqqgwsmlesdnfwmd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/vtlxwjdzpemnqnzwzovetiqhdhvirgdv HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/mjfgkrapdkywyraobkpfekslxmeczpqa HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/fkpeursliwuflxytyugmzyxuldqmtkds HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/jgoejzokarkvsqossldzdydinuvzmonw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/cntcvwkfnrorqvqclbejfixjmpigvrmi HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "GET /devstoreaccount1/cont/rgwpkbnsbqsgefbgkjetdfekodbshqat HTTP/1.1" 206 80
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "GET /devstoreaccount1/cont/xveuivyezdgrbyjcvpwetxxsjryzzupf HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "GET /devstoreaccount1/cont/zbboonkiujgkeitnlnaahafodyxwyont HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/achetusegwtzxnhhomuvsxefdhxqgrry HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/lrjjlkhqebjpekbpejsgxlvypaeatnrl HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/lbspeszgkajqcqrhilrukenjmldvcabf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/kyuswcvcsmnethirmyghhwoeobplgcuv HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/hfsdqztyavbxdzpjqjjrriawihfnwzic HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/knfiwqkufziwmlwwbhjajvvhpipncufw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/oourvoxnozojzkzksaalztsmhujbjfpy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/mwgwxjkmmpkdmcdvmvizxicjbvjvpgkv HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:10 +0000] "PUT /devstoreaccount1/cont/cnykgwvjnfldcgtbeatzghzsibswdeop HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/oexlegbdsyeeyejsdtificshaxrltjvm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/ufwehisooxreobkhojifrfceqnjsnnpz HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/cpjztmhpzdafmnifqhaykndtxnmornym HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/ivmjvatwvbhxnmyawlmumkcrjobxcxik HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/smjscmliimmlvudpwkwxdbsxdyhppabk HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/prunnlumyogsezrjxufbhoczrafisixn HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/vrgshkoqxedhdqzchfsxfcoenstudowb HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/ekatsbbfaiocscputwywsamfbyrxtacc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/pytahvcgjwwjjjysgxhhsvturkbaxoak HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/qakfbklyylfkjnhwypzyjsojnuouikae HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/mprmyhuqmekuuxmooxyjjapwxeomqvnw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/wrugqvjpkjkpqinncbacpyqzhnckalnj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/nechgwbjbdjynxoazeppevsasfjwriky HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/pflzsgmlemyrcpxautehpoetxbgtnudg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/nenyuoxsjhwafqqzhsaskqoddnlqqqqc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/aoeumlirokjhbpcdwfhzeiweypynsths HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/wkvrfbjletnebyjgjvjzjaahiymrknng HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/cbcybtzkhwujuvwnboqpcoflynrjkwgg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/cmwgscoixapgdvhposuwtpemcjhrgfbd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/ekqpkkfxjvokfcghuntnaeiaenygblxm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/zcakrkdeaipuvsvhwizcvwdgvmxabgta HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/qgnpfpktgvvkkctxjznzgtyjlpdskvpr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/zqrozeovizetslweluomintcsqtsiaot HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/dtqawqevawwxlyrwkglebqztlmacajji HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/lyigmgpejxgwgznsbjpvjtlpqmxfwqzp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/tbyrxlnvvyodentootcdpbzhklwnlpfp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/jvtvkkvsrvdpndeeddnhklyfpwplnbiq HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/uzhnlpxwtelffkktonxfpjzchuwigien HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/xhksyebyynvxqjsomslkgtwfwwnlgjyf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/npijzeltjmajtzhixqzhjcbozovcnfob HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/nxayjdvgetzyniwimuqsyyqhixgecmri HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/rkgklxnfggsxtrngfdfvzceaemfmuyvu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/dqdchynvkbjzkybjtzacnvzlhmzejtla HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/gjhcloiabtwdtjbbhavxdhxoqdihkfjk HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:11 +0000] "PUT /devstoreaccount1/cont/ljfkpizykpmlflorfaunxmsupgxqgdpx HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/szypovyehrlpnrflifugulntwnqmjlek HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/hakgvcyehcyvdtrbtvvzcngyzmqnomca HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/vbjipedutpjntoberqmicxabhzmvohct HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/wivovdwkebpycpxzrbathkwqdikzqwqg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/veadlvyfzhssdrsphdjwwztkorncdhkj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/diqozlwuprkkueahpscdvkobbeqrmwqr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/vlhermbknyidffbelblxdvqrsfppzoyc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/akajysjomkcdythtybtjvwwboyyfwucm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/adqbgejxksxsbxyapybztnzidnbbwagt HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/erajzwkaxiqgtmpbpiqfdcqoixiwwvyu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/edkuevafgzxoxphgbbxvbxxtrajnwksa HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/kqljjebshygjmndpbhvvyvbabckvnfst HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/pcrtzwmfhdysejhjercwwxetojnbdxdx HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/ahuxbxqpfymshybbcmkvqwdcemuerher HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/nxojoqwnzaotxthtqajqjpabjwdrdytz HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/kwhtxccbfssjllagdgwruohgaxpgzwym HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/uqrirubkuofiwbzipnhfuwndpeymwqcm HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/mkkapgjdbofztiuzsxourtjegabqsady HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/emdtuuaocxdialhwbtmbjlpvpozsvuzf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/nvzugqulylrhzforsgixwlcrzwmeoegc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/nmkciuedysinjfhinyzprlpvbbnlrptu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/qqkttzyhitjkswouvdcvvsrfyhonheth HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:12 +0000] "PUT /devstoreaccount1/cont/fsvsmiljumzatsqpjbodsolxwgwsvwsq HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/wnmtypvpxdkeprerfbftektwquuukbce HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/nkxboojcxvftfidvjuywjzpwiwmpbibl HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/csnkqstkixyftvzgjfptizbimrxjahyp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/hbfcbgawopsnxavpoofmiamkvtjqmblz HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/peibkxybtvuemtqnbglahelssjkptnfw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/nypchcfqjjlbaamzxycsaysyalvtcquj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/dmdzmzramrinkrznzrqsgagriprnnheu HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/kgoripqdacgsysifbxhbzzegyggzlpbq HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/gwswdqisujoakocduxbnszogufajgmtj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "PUT /devstoreaccount1/cont/fnksdlgxfzlchwsefbotuopfbmfzvlon HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/fnksdlgxfzlchwsefbotuopfbmfzvlon HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/wnmtypvpxdkeprerfbftektwquuukbce HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nypchcfqjjlbaamzxycsaysyalvtcquj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nkxboojcxvftfidvjuywjzpwiwmpbibl HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/dmdzmzramrinkrznzrqsgagriprnnheu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/peibkxybtvuemtqnbglahelssjkptnfw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/csnkqstkixyftvzgjfptizbimrxjahyp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/hbfcbgawopsnxavpoofmiamkvtjqmblz HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/gwswdqisujoakocduxbnszogufajgmtj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/kgoripqdacgsysifbxhbzzegyggzlpbq HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mpnwwrcxypbrvbudpveppahhkfuvprkz HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/yohxahxypvbbjqaqqyvhqvtedkclmeit HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ccxkudvdttbswnltxjujtjvwuoddssgw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/xveuivyezdgrbyjcvpwetxxsjryzzupf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mlwvwwegfqgzlqjylppiurzgdyxuaznm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/uklrpgavjvwdcsnngkgbelylbsovpffy HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/rlrvzxcaygeukykblabmbjbqzfuyzmwh HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/upexhcoydvqgfdvzrbgsqfwopjlqkegt HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mwgwxjkmmpkdmcdvmvizxicjbvjvpgkv HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/hfsdqztyavbxdzpjqjjrriawihfnwzic HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/kyuswcvcsmnethirmyghhwoeobplgcuv HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/achetusegwtzxnhhomuvsxefdhxqgrry HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/lrjjlkhqebjpekbpejsgxlvypaeatnrl HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/lbspeszgkajqcqrhilrukenjmldvcabf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/oourvoxnozojzkzksaalztsmhujbjfpy HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/knfiwqkufziwmlwwbhjajvvhpipncufw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ekatsbbfaiocscputwywsamfbyrxtacc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/smjscmliimmlvudpwkwxdbsxdyhppabk HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ivmjvatwvbhxnmyawlmumkcrjobxcxik HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/oexlegbdsyeeyejsdtificshaxrltjvm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ufwehisooxreobkhojifrfceqnjsnnpz HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cpjztmhpzdafmnifqhaykndtxnmornym HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/vrgshkoqxedhdqzchfsxfcoenstudowb HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/prunnlumyogsezrjxufbhoczrafisixn HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/dlctkhwjgjymopjubzksrxaswgfgskwp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ifjyatjufxkmmpsjimouyzmiadmjmpmp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/taqzeokfzgenjlmiuxzswhtaeaomyszm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/blzdpzogcutulluigtdhsjifspsnfbee HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/plkktwieopvzihawrwsqbktyrleayzvy HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cnhwyvjomdxmqfnvmyqwrrxkzrefjukf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/onfoyxeigsreajhgsketgqprekvmehax HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/lhrbcywqjrauoganpluxxmuzorqgqylw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nsehbxkntqglyovggbnggbfadkbyjymv HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/aslbyofigqzrnpwkxwwajkuedcveshoh HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/zcjnahciabkqymctyioinaektqafkgri HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/zbboonkiujgkeitnlnaahafodyxwyont HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/rgwpkbnsbqsgefbgkjetdfekodbshqat HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ibfzfyuwnuxcheleomkgyqhjwbysvxuj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/fcijdjucmsdzaopyhiuilwncavqxihfo HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ytchamnlhxnwmvdsxywlthobyaoqqyfj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/bqgbbdfszeqopltghnykrlhiplyzbgbs HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/aabgbyvwocbwjyfdukmjnfhyfqceycei HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/tksxsczpqtrbcauwesondedhmqxztkdp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/vvwvasrpmoxtilwqqgewewmrqvbysabi HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nylntopociutvouuacebcbuimlsyoywd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/fwyzscpcjhghcwjfjnkvrxvbseudluhu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/kcvumgkgxzdzqejapxbvkdiaqtukamgr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/oyrizfpgfitqevnfrgoyptfaggribcwh HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cntcvwkfnrorqvqclbejfixjmpigvrmi HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mjfgkrapdkywyraobkpfekslxmeczpqa HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/vtlxwjdzpemnqnzwzovetiqhdhvirgdv HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ybhtdbbytdkogcknlqaqshixjzpcnkkv HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/bzwnokgwbsgkwoyfxzeqgccbbqkuqzfu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/izeedpziaxhbgtxjqqqgwsmlesdnfwmd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/jgoejzokarkvsqossldzdydinuvzmonw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/fkpeursliwuflxytyugmzyxuldqmtkds HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cbcybtzkhwujuvwnboqpcoflynrjkwgg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/pytahvcgjwwjjjysgxhhsvturkbaxoak HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/pflzsgmlemyrcpxautehpoetxbgtnudg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/qakfbklyylfkjnhwypzyjsojnuouikae HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nenyuoxsjhwafqqzhsaskqoddnlqqqqc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nechgwbjbdjynxoazeppevsasfjwriky HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mprmyhuqmekuuxmooxyjjapwxeomqvnw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/wrugqvjpkjkpqinncbacpyqzhnckalnj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/wkvrfbjletnebyjgjvjzjaahiymrknng HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/aoeumlirokjhbpcdwfhzeiweypynsths HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/uzhnlpxwtelffkktonxfpjzchuwigien HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cmwgscoixapgdvhposuwtpemcjhrgfbd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/dtqawqevawwxlyrwkglebqztlmacajji HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ekqpkkfxjvokfcghuntnaeiaenygblxm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/lyigmgpejxgwgznsbjpvjtlpqmxfwqzp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/zqrozeovizetslweluomintcsqtsiaot HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/zcakrkdeaipuvsvhwizcvwdgvmxabgta HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/qgnpfpktgvvkkctxjznzgtyjlpdskvpr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/jvtvkkvsrvdpndeeddnhklyfpwplnbiq HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/tbyrxlnvvyodentootcdpbzhklwnlpfp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/vbjipedutpjntoberqmicxabhzmvohct HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/xhksyebyynvxqjsomslkgtwfwwnlgjyf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/gjhcloiabtwdtjbbhavxdhxoqdihkfjk HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/npijzeltjmajtzhixqzhjcbozovcnfob HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ljfkpizykpmlflorfaunxmsupgxqgdpx HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/dqdchynvkbjzkybjtzacnvzlhmzejtla HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nxayjdvgetzyniwimuqsyyqhixgecmri HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/rkgklxnfggsxtrngfdfvzceaemfmuyvu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/hakgvcyehcyvdtrbtvvzcngyzmqnomca HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/szypovyehrlpnrflifugulntwnqmjlek HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/pcrtzwmfhdysejhjercwwxetojnbdxdx HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/wivovdwkebpycpxzrbathkwqdikzqwqg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/adqbgejxksxsbxyapybztnzidnbbwagt HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/veadlvyfzhssdrsphdjwwztkorncdhkj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/erajzwkaxiqgtmpbpiqfdcqoixiwwvyu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/akajysjomkcdythtybtjvwwboyyfwucm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/diqozlwuprkkueahpscdvkobbeqrmwqr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/vlhermbknyidffbelblxdvqrsfppzoyc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/kqljjebshygjmndpbhvvyvbabckvnfst HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/edkuevafgzxoxphgbbxvbxxtrajnwksa HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/fsvsmiljumzatsqpjbodsolxwgwsvwsq HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/ahuxbxqpfymshybbcmkvqwdcemuerher HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/emdtuuaocxdialhwbtmbjlpvpozsvuzf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nxojoqwnzaotxthtqajqjpabjwdrdytz HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nvzugqulylrhzforsgixwlcrzwmeoegc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/mkkapgjdbofztiuzsxourtjegabqsady HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/kwhtxccbfssjllagdgwruohgaxpgzwym HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/uqrirubkuofiwbzipnhfuwndpeymwqcm HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/qqkttzyhitjkswouvdcvvsrfyhonheth HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/nmkciuedysinjfhinyzprlpvbbnlrptu HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/jbdxziuhrszxhvvngvwibupnxuitaxsg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:13 +0000] "DELETE /devstoreaccount1/cont/cnykgwvjnfldcgtbeatzghzsibswdeop HTTP/1.1" 202 -
2026-02-05 16:12:13 02241_filesystem_cache_on_write_operations: [ OK ] 18.59 sec.
2026-02-05 16:12:13 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.22 sec.
2026-02-05 16:12:14 02240_filesystem_query_cache: [ OK ] 0.22 sec.
127.0.0.1 - - [05/Feb/2026:19:12:18 +0000] "PUT /devstoreaccount1/cont/xwclsbmlergzxylujmrlllrzelkyyqjy HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/xuybgroilmgxcmgcvczcyuuagzpfpkhh HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/hqrrnbsewfanhulefzrwjtsuwefvbyia HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/amocrnnulncpcqsdwadazjbdldtakppc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/coopmzuosxknernlkbjwxkpbczziitgc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/binnvrdaxwbuuxxegkfxqwaxjuuejokj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/ioahgwzabzikwbcwtjjucmarzbngkccd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/ldiqsenujieffvrwbclwmnszxhoqncms HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/zthzabzebwlhchppfpvgsvleqiduzmdj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "PUT /devstoreaccount1/cont/sxwgxjifphotpasxibbaoozsffnezbsi HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "GET /devstoreaccount1/cont/hqrrnbsewfanhulefzrwjtsuwefvbyia HTTP/1.1" 206 80
127.0.0.1 - - [05/Feb/2026:19:12:19 +0000] "GET /devstoreaccount1/cont/xuybgroilmgxcmgcvczcyuuagzpfpkhh HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "GET /devstoreaccount1/cont/hqrrnbsewfanhulefzrwjtsuwefvbyia HTTP/1.1" 206 80
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "GET /devstoreaccount1/cont/xuybgroilmgxcmgcvczcyuuagzpfpkhh HTTP/1.1" 206 746
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/sxwgxjifphotpasxibbaoozsffnezbsi HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/ioahgwzabzikwbcwtjjucmarzbngkccd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/coopmzuosxknernlkbjwxkpbczziitgc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/xuybgroilmgxcmgcvczcyuuagzpfpkhh HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/hqrrnbsewfanhulefzrwjtsuwefvbyia HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/amocrnnulncpcqsdwadazjbdldtakppc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/binnvrdaxwbuuxxegkfxqwaxjuuejokj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/zthzabzebwlhchppfpvgsvleqiduzmdj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/ldiqsenujieffvrwbclwmnszxhoqncms HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:20 +0000] "DELETE /devstoreaccount1/cont/xwclsbmlergzxylujmrlllrzelkyyqjy HTTP/1.1" 202 -
2026-02-05 16:12:20 02240_system_filesystem_cache_table: [ OK ] 6.35 sec.
2026-02-05 16:12:21 02240_tskv_schema_inference_bug: [ OK ] 0.68 sec.
2026-02-05 16:12:21 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec.
2026-02-05 16:12:21 Reason: disabled
2026-02-05 16:12:22 02227_test_create_empty_sqlite_db: [ OK ] 0.82 sec.
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/gtcbsgvucstneogiplvsitoqurljjvxk HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/cvjngudyfsscbkfbyhcxbnrovwznmbtg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/jgmgbvftczxqqejjvvsfjmjgzbyqhxhn HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/skcefywdieausghikxnamuquzapwzhtb HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/vnagettgpetgqwgddrhthnnminwftshi HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/igvjowyhroiezammqqnmmfkgrvgpzgsd HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/wycoeaujybxvduapgwlamcnfpfnmbbrc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/xgibjdmwfyincspcpcfbttsrurvsfbol HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/lrtpqjbjcmiiqyuwbztyttwitngqbvdl HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "PUT /devstoreaccount1/cont/ucdevfjbhigzcmsjjqshqunoebxvokit HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "GET /devstoreaccount1/cont/jgmgbvftczxqqejjvvsfjmjgzbyqhxhn HTTP/1.1" 206 62
127.0.0.1 - - [05/Feb/2026:19:12:25 +0000] "GET /devstoreaccount1/cont/cvjngudyfsscbkfbyhcxbnrovwznmbtg HTTP/1.1" 206 100252
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/rlhrbleodjjywrdsctskmivncqzlrxpb HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/ebhlcbqgekkeczbkhfdysstddnpppdmw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/aqzxbrimteycnalvfdlidjjswrewvqtj HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/izfqlhngwncniyamzgxaxdccohjdjvwc HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/vzsqvjjrpbdrijidauvulsdzdsvzkgdt HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/ucdevfjbhigzcmsjjqshqunoebxvokit HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/wycoeaujybxvduapgwlamcnfpfnmbbrc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/vnagettgpetgqwgddrhthnnminwftshi HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/jgmgbvftczxqqejjvvsfjmjgzbyqhxhn HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/cvjngudyfsscbkfbyhcxbnrovwznmbtg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/skcefywdieausghikxnamuquzapwzhtb HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/igvjowyhroiezammqqnmmfkgrvgpzgsd HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/lrtpqjbjcmiiqyuwbztyttwitngqbvdl HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/xgibjdmwfyincspcpcfbttsrurvsfbol HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/wcwkmgezfligboivjgqbvfkwwycxjecg HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/frpcdhtftqtmsxzzzwggphzmgufgajup HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/mcmakjunoltnsnvroevtiysnqeakidrf HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/vvapeufjtmwzinlvxttwaualstencezr HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/ocsoraacbjodamqwhuyjlmdinpupbrle HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/cvyolikigvimnzhikxzuriuurycpzlij HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/nhvfgfnxategfigzdjbfbrxuobajfkpp HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/xchidhzzqxpmgrsbmpzqfggdqkmoxvgw HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "PUT /devstoreaccount1/cont/oeutssqhcwalyttzwpbbusewqibdcdmn HTTP/1.1" 201 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/vzsqvjjrpbdrijidauvulsdzdsvzkgdt HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/ebhlcbqgekkeczbkhfdysstddnpppdmw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/rlhrbleodjjywrdsctskmivncqzlrxpb HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/wfmkvdvazdvsuvoinqvwybsdjunsysvd HTTP/1.1" 404 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/awlphyndyaxanfncfdpkqhsvdwmpwlva HTTP/1.1" 404 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/xgdjjfdkgryzbbreasnztmeuqqoedjre HTTP/1.1" 404 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/izfqlhngwncniyamzgxaxdccohjdjvwc HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/aqzxbrimteycnalvfdlidjjswrewvqtj HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/oeutssqhcwalyttzwpbbusewqibdcdmn HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/cvyolikigvimnzhikxzuriuurycpzlij HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/vvapeufjtmwzinlvxttwaualstencezr HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/frpcdhtftqtmsxzzzwggphzmgufgajup HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/wcwkmgezfligboivjgqbvfkwwycxjecg HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/mcmakjunoltnsnvroevtiysnqeakidrf HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/ocsoraacbjodamqwhuyjlmdinpupbrle HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/xchidhzzqxpmgrsbmpzqfggdqkmoxvgw HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/nhvfgfnxategfigzdjbfbrxuobajfkpp HTTP/1.1" 202 -
127.0.0.1 - - [05/Feb/2026:19:12:26 +0000] "DELETE /devstoreaccount1/cont/gtcbsgvucstneogiplvsitoqurljjvxk HTTP/1.1" 202 -
2026-02-05 16:12:26 02226_filesystem_cache_profile_events: [ OK ] 4.53 sec.
2026-02-05 16:12:27 02225_unwinder_dwarf_version: [ OK ] 0.67 sec.
2026-02-05 16:12:29 02222_create_table_without_columns_metadata: [ OK ] 2.03 sec.
2026-02-05 16:12:30 02211_shcema_inference_from_stdin: [ OK ] 0.92 sec.
2026-02-05 16:12:30 02211_jsonl_format_extension: [ OK ] 0.17 sec.
2026-02-05 16:12:34 02207_allow_plaintext_and_no_password: [ OK ] 3.48 sec.
2026-02-05 16:12:35 02187_msg_pack_uuid: [ OK ] 1.48 sec.
2026-02-05 16:12:36 02185_values_schema_inference: [ OK ] 1.12 sec.
2026-02-05 16:12:37 02184_ipv6_parsing: [ OK ] 0.67 sec.
2026-02-05 16:12:39 02184_table_engine_access: [ OK ] 1.58 sec.
2026-02-05 16:12:39 02182_format_and_schema_from_stdin: [ OK ] 0.82 sec.
2026-02-05 16:12:40 02182_json_each_row_schema_inference: [ OK ] 0.67 sec.
2026-02-05 16:12:41 02181_format_from_file_extension_local: [ OK ] 0.67 sec.
2026-02-05 16:12:42 02181_detect_output_format_by_file_extension: [ OK ] 0.93 sec.
2026-02-05 16:12:42 02179_dict_reload_on_cluster: [ OK ] 0.37 sec.
2026-02-05 16:12:43 02177_temporary_table_current_database_http_session: [ OK ] 0.58 sec.
2026-02-05 16:12:43 02168_avro_bug: [ OK ] 0.22 sec.
2026-02-05 16:12:44 02166_arrow_dictionary_inference: [ OK ] 0.72 sec.
2026-02-05 16:12:44 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.32 sec.
2026-02-05 16:12:45 02152_bool_type_parsing: [ OK ] 1.02 sec.
2026-02-05 16:12:45 02148_sql_user_defined_function_subquery: [ OK ] 0.22 sec.
2026-02-05 16:12:47 02127_plus_before_float: [ OK ] 1.58 sec.
2026-02-05 16:12:47 02126_identity_user_defined_function: [ OK ] 0.17 sec.
2026-02-05 16:12:47 02125_recursive_sql_user_defined_functions: [ OK ] 0.27 sec.
2026-02-05 16:13:09 02125_many_mutations_2: [ OK ] 21.85 sec.
2026-02-05 16:13:10 02125_tskv_proper_names_reading: [ OK ] 0.57 sec.
2026-02-05 16:13:10 02115_rewrite_local_join_right_distribute_table: [ OK ] 0.32 sec.
2026-02-05 16:13:11 02111_modify_table_comment: [ OK ] 0.22 sec.
2026-02-05 16:13:11 02105_table_function_file_partiotion_by: [ OK ] 0.97 sec.
2026-02-05 16:13:12 02104_json_strings_nullable_string: [ OK ] 0.67 sec.
2026-02-05 16:13:12 02103_sql_user_defined_functions_composition: [ OK ] 0.17 sec.
2026-02-05 16:13:17 02103_tsv_csv_custom_null_representation: [ OK ] 4.99 sec.
2026-02-05 16:13:18 02102_sql_user_defined_functions_create_if_not_exists: [ OK ] 0.22 sec.
2026-02-05 16:13:18 02101_sql_user_defined_functions_create_or_replace: [ OK ] 0.17 sec.
2026-02-05 16:13:18 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.27 sec.
2026-02-05 16:13:18 02099_sql_user_defined_functions_lambda: [ OK ] 0.17 sec.
2026-02-05 16:13:18 02098_sql_user_defined_functions_aliases: [ OK ] 0.17 sec.
2026-02-05 16:13:19 02097_default_dict_get_add_database: [ OK ] 0.22 sec.
2026-02-05 16:13:19 02096_sql_user_defined_function_alias: [ OK ] 0.17 sec.
2026-02-05 16:13:19 02096_rename_atomic_hang: [ OK ] 0.27 sec.
2026-02-05 16:13:20 02051_symlinks_to_user_files: [ OK ] 0.88 sec.
2026-02-05 16:13:22 02051_read_settings: [ OK ] 1.68 sec.
2026-02-05 16:13:22 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.57 sec.
2026-02-05 16:13:28 02026_storage_filelog_largefile: [ OK ] 5.34 sec.
2026-02-05 16:13:28 02025_dictionary_view_different_db: [ OK ] 0.27 sec.
2026-02-05 16:13:28 02024_merge_regexp_assert: [ OK ] 0.17 sec.
2026-02-05 16:13:29 02015_column_default_dict_get_identifier: [ OK ] 0.27 sec.
2026-02-05 16:13:30 02015_global_in_threads: [ OK ] 1.12 sec.
2026-02-05 16:13:32 02014_query_parameters: [ OK ] 1.83 sec.
2026-02-05 16:13:32 02011_dictionary_empty_attribute_list: [ OK ] 0.22 sec.
2026-02-05 16:13:32 02008_complex_key_range_hashed_dictionary: [ OK ] 0.47 sec.
2026-02-05 16:13:32 02001_add_default_database_to_system_users: [ OK ] 0.17 sec.
2026-02-05 16:13:33 01999_grant_with_replace: [ OK ] 0.27 sec.
2026-02-05 16:13:33 01948_dictionary_quoted_database_name: [ OK ] 0.22 sec.
2026-02-05 16:14:06 01946_test_wrong_host_name_access: [ OK ] 32.89 sec.
2026-02-05 16:14:07 01946_test_zstd_decompression_with_escape_sequence_at_the_end_of_buffer: [ OK ] 0.92 sec.
2026-02-05 16:14:08 01939_user_with_default_database: [ OK ] 1.53 sec.
2026-02-05 16:14:09 01925_test_storage_merge_aliases: [ OK ] 0.32 sec.
2026-02-05 16:14:09 01925_test_storage_merge_aliases_analyzer: [ OK ] 0.27 sec.
2026-02-05 16:14:20 01923_network_receive_time_metric_insert: [ OK ] 10.71 sec.
2026-02-05 16:14:46 01921_concurrent_ttl_and_normal_merges_zookeeper_long: [ OK ] 25.66 sec.
2026-02-05 16:14:46 01915_create_or_replace_dictionary: [ OK ] 0.32 sec.
2026-02-05 16:14:46 01914_exchange_dictionaries: [ OK ] 0.27 sec.
2026-02-05 16:14:47 01913_exact_rows_before_limit_full: [ OK ] 0.32 sec.
2026-02-05 16:14:47 01913_replace_dictionary: [ OK ] 0.27 sec.
2026-02-05 16:14:47 01913_exact_rows_before_limit: [ OK ] 0.37 sec.
2026-02-05 16:14:47 01910_view_dictionary: [ OK ] 0.27 sec.
2026-02-05 16:14:48 01904_dictionary_default_nullable_type: [ OK ] 0.62 sec.
2026-02-05 16:14:49 01904_ssd_cache_dictionary_default_nullable_type: [ OK ] 0.62 sec.
2026-02-05 16:14:49 01903_ssd_cache_dictionary_array_type: [ OK ] 0.62 sec.
2026-02-05 16:14:50 01902_table_function_merge_db_repr: [ OK ] 0.42 sec.
2026-02-05 16:14:50 01902_dictionary_array_type: [ OK ] 0.57 sec.
2026-02-05 16:14:52 01901_test_attach_partition_from: [ OK ] 1.17 sec.
2026-02-05 16:14:52 01889_postgresql_protocol_null_fields: [ OK ] 0.62 sec.
2026-02-05 16:14:57 01889_sqlite_read_write: [ OK ] 4.69 sec.
2026-02-05 16:14:58 01875_ssd_cache_dictionary_decimal256_type: [ OK ] 0.57 sec.
2026-02-05 16:14:58 01870_buffer_flush: [ OK ] 0.22 sec.
2026-02-05 16:14:58 01856_create_function: [ OK ] 0.27 sec.
2026-02-05 16:14:58 01854_dictionary_range_hashed_min_max_attr: [ OK ] 0.12 sec.
2026-02-05 16:14:59 01853_dictionary_cache_duplicates: [ OK ] 0.97 sec.
2026-02-05 16:15:00 01852_dictionary_found_rate_long: [ OK ] 0.92 sec.
2026-02-05 16:15:01 01850_dist_INSERT_preserve_error: [ OK ] 0.27 sec.
2026-02-05 16:15:01 01837_database_memory_ddl_dictionaries: [ OK ] 0.17 sec.
2026-02-05 16:15:01 01825_type_json_17: [ OK ] 0.37 sec.
2026-02-05 16:15:01 01824_prefer_global_in_and_join: [ OK ] 0.32 sec.
2026-02-05 16:15:02 01821_dictionary_primary_key_wrong_order: [ OK ] 0.22 sec.
2026-02-05 16:15:02 01821_table_comment: [ OK ] 0.32 sec.
2026-02-05 16:15:02 01804_dictionary_decimal256_type: [ OK ] 0.37 sec.
2026-02-05 16:15:04 01802_test_postgresql_protocol_with_row_policy: [ OK ] 1.17 sec.
2026-02-05 16:15:04 01785_dictionary_element_count: [ OK ] 0.37 sec.
2026-02-05 16:15:04 01780_clickhouse_dictionary_source_loop: [ OK ] 0.27 sec.
2026-02-05 16:15:05 01778_hierarchical_dictionaries: [ OK ] 0.37 sec.
2026-02-05 16:15:05 01778_mmap_cache_infra: [ OK ] 0.17 sec.
2026-02-05 16:15:06 01771_bloom_filter_not_has: [ OK ] 0.72 sec.
2026-02-05 16:15:06 01766_hashed_dictionary_complex_key: [ OK ] 0.42 sec.
2026-02-05 16:15:07 01765_hashed_dictionary_simple_key: [ OK ] 0.67 sec.
2026-02-05 16:15:07 01760_polygon_dictionaries: [ OK ] 0.47 sec.
2026-02-05 16:15:08 01760_system_dictionaries: [ OK ] 0.37 sec.
2026-02-05 16:15:08 01759_dictionary_unique_attribute_names: [ OK ] 0.27 sec.
2026-02-05 16:15:09 01754_direct_dictionary_complex_key: [ OK ] 0.52 sec.
2026-02-05 16:15:09 01753_direct_dictionary_simple_key: [ OK ] 0.57 sec.
2026-02-05 16:15:09 01748_dictionary_table_dot: [ OK ] 0.22 sec.
2026-02-05 16:15:10 01747_join_view_filter_dictionary: [ OK ] 0.32 sec.
2026-02-05 16:15:27 01747_system_session_log_long: [ OK ] 17.69 sec.
2026-02-05 16:15:29 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.88 sec.
2026-02-05 16:15:31 01746_executable_pool_dictionary: [ OK ] 1.83 sec.
2026-02-05 16:15:34 01737_clickhouse_server_wait_server_pool_long: [ OK ] 3.29 sec.
2026-02-05 16:15:37 01722_long_brotli_http_compression_json_format: [ OK ] 2.73 sec.
2026-02-05 16:15:37 01721_engine_file_truncate_on_insert: [ OK ] 0.22 sec.
2026-02-05 16:15:38 01721_dictionary_decimal_p_s: [ OK ] 0.32 sec.
2026-02-05 16:15:38 01720_dictionary_create_source_with_functions: [ OK ] 0.17 sec.
2026-02-05 16:15:43 01710_projection_vertical_merges: [ OK ] 4.64 sec.
2026-02-05 16:15:43 01705_normalize_create_alter_function_names: [ OK ] 0.27 sec.
2026-02-05 16:15:44 01702_system_query_log: [ OK ] 0.57 sec.
2026-02-05 16:15:44 01684_ssd_cache_dictionary_simple_key: [ OK ] 0.92 sec.
2026-02-05 16:15:45 01683_flat_dictionary: [ OK ] 0.42 sec.
2026-02-05 16:15:45 01682_cache_dictionary_complex_key: [ OK ] 0.37 sec.
2026-02-05 16:15:46 01681_cache_dictionary_simple_key: [ OK ] 0.42 sec.
2026-02-05 16:15:46 01676_dictget_in_default_expression: [ OK ] 0.32 sec.
2026-02-05 16:15:50 01674_executable_dictionary_implicit_key: [ OK ] 3.53 sec.
2026-02-05 16:15:50 01670_dictionary_create_key_expression: [ OK ] 0.27 sec.
2026-02-05 16:15:53 01658_read_file_to_stringcolumn: [ OK ] 2.98 sec.
2026-02-05 16:15:54 01656_test_query_log_factories_info: [ OK ] 0.87 sec.
2026-02-05 16:15:54 01646_system_restart_replicas_smoke: [ OK ] 0.27 sec.
2026-02-05 16:15:55 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.28 sec.
2026-02-05 16:15:56 01625_constraints_index_append: [ OK ] 0.22 sec.
2026-02-05 16:15:56 01615_random_one_shard_insertion: [ OK ] 0.37 sec.
2026-02-05 16:15:56 01603_rename_overwrite_bug: [ OK ] 0.32 sec.
2026-02-05 16:15:57 01602_show_create_view: [ OK ] 0.27 sec.
2026-02-05 16:15:57 01601_detach_permanently: [ OK ] 0.67 sec.
2026-02-05 16:16:01 01600_log_queries_with_extensive_info: [ OK ] 3.13 sec.
2026-02-05 16:16:19 01600_detach_permanently: [ OK ] 18.19 sec.
2026-02-05 16:16:20 01600_parts_states_metrics_long: [ OK ] 0.78 sec.
2026-02-05 16:16:20 01598_memory_limit_zeros: [ OK ] 0.12 sec.
2026-02-05 16:16:46 01593_concurrent_alter_mutations_kill: [ OK ] 26.28 sec.
2026-02-05 16:17:25 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 39.16 sec.
2026-02-05 16:17:25 01575_disable_detach_table_of_dictionary: [ OK ] 0.22 sec.
2026-02-05 16:17:27 01563_distributed_query_finish: [ OK ] 1.18 sec.
2026-02-05 16:17:28 01545_system_errors: [ OK ] 1.22 sec.
2026-02-05 16:17:29 01543_avro_deserialization_with_lc: [ OK ] 1.58 sec.
2026-02-05 16:17:41 01542_dictionary_load_exception_race: [ OK ] 11.67 sec.
2026-02-05 16:18:02 01541_max_memory_usage_for_user_long: [ OK ] 20.90 sec.
2026-02-05 16:18:03 01533_multiple_nested: [ OK ] 1.12 sec.
2026-02-05 16:18:21 01532_execute_merges_on_single_replica_long: [ OK ] 18.15 sec.
2026-02-05 16:18:22 01530_drop_database_atomic_sync: [ OK ] 0.47 sec.
2026-02-05 16:18:23 01527_clickhouse_local_optimize: [ OK ] 0.67 sec.
2026-02-05 16:18:23 01527_dist_sharding_key_dictGet_reload: [ OK ] 0.37 sec.
2026-02-05 16:18:23 01526_complex_key_dict_direct_layout: [ OK ] 0.22 sec.
2026-02-05 16:18:24 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.72 sec.
2026-02-05 16:18:24 01517_drop_mv_with_inner_table: [ OK ] 0.32 sec.
2026-02-05 16:18:25 01516_create_table_primary_key: [ OK ] 0.32 sec.
2026-02-05 16:18:27 01507_clickhouse_server_start_with_embedded_config: [ OK ] 2.13 sec.
2026-02-05 16:18:58 01502_long_log_tinylog_deadlock_race: [ OK ] 30.77 sec.
2026-02-05 16:18:58 01501_cache_dictionary_all_fields: [ OK ] 0.72 sec.
2026-02-05 16:18:59 01494_storage_join_persistency: [ OK ] 0.22 sec.
2026-02-05 16:18:59 01493_storage_set_persistency: [ OK ] 0.32 sec.
2026-02-05 16:19:00 01475_read_subcolumns: [ OK ] 0.73 sec.
2026-02-05 16:19:03 01474_executable_dictionary: [ OK ] 3.28 sec.
2026-02-05 16:19:03 01471_calculate_ttl_during_merge: [ OK ] 0.27 sec.
2026-02-05 16:19:04 01470_show_databases_like: [ OK ] 0.17 sec.
2026-02-05 16:19:04 01465_ttl_recompression: [ OK ] 0.32 sec.
2026-02-05 16:19:20 01459_manual_write_to_replicas_quorum: [ OK ] 15.97 sec.
2026-02-05 16:19:28 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 8.05 sec.
2026-02-05 16:19:47 01459_manual_write_to_replicas: [ OK ] 18.93 sec.
2026-02-05 16:19:47 01457_create_as_table_function_structure: [ OK ] 0.27 sec.
2026-02-05 16:19:47 01455_rank_correlation_spearman: [ OK ] 0.22 sec.
2026-02-05 16:20:08 01454_storagememory_data_race_challenge: [ OK ] 20.34 sec.
2026-02-05 16:20:10 01417_freeze_partition_verbose_zookeeper: [ OK ] 2.03 sec.
2026-02-05 16:20:13 01417_freeze_partition_verbose: [ OK ] 3.03 sec.
2026-02-05 16:20:13 01415_inconsistent_merge_tree_settings: [ OK ] 0.17 sec.
2026-02-05 16:20:13 01415_overlimiting_threads_for_repica_bug: [ OK ] 0.37 sec.
2026-02-05 16:20:56 01414_mutations_and_errors_zookeeper: [ OK ] 42.88 sec.
2026-02-05 16:21:17 01412_cache_dictionary_race: [ OK ] 20.79 sec.
2026-02-05 16:21:19 01410_nullable_key_more_tests: [ OK ] 1.38 sec.
2026-02-05 16:21:19 01383_remote_ambiguous_column_shard: [ OK ] 0.17 sec.
2026-02-05 16:21:19 01376_GROUP_BY_injective_elimination_dictGet: [ OK ] 0.22 sec.
2026-02-05 16:21:19 01375_compact_parts_codecs: [ OK ] 0.32 sec.
2026-02-05 16:21:22 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 2.93 sec.
2026-02-05 16:21:24 01360_materialized_view_with_join_on_query_log: [ OK ] 1.58 sec.
2026-02-05 16:21:24 01358_union_threads_bug: [ OK ] 0.27 sec.
2026-02-05 16:21:25 01356_view_threads: [ OK ] 0.27 sec.
2026-02-05 16:21:35 01320_create_sync_race_condition_zookeeper: [ OK ] 10.21 sec.
2026-02-05 16:21:44 01318_long_unsuccessful_mutation_zookeeper: [ OK ] 9.15 sec.
2026-02-05 16:21:46 01307_multiple_leaders_zookeeper: [ OK ] 2.23 sec.
2026-02-05 16:21:57 01305_replica_create_drop_zookeeper: [ OK ] 10.66 sec.
2026-02-05 16:22:28 01302_aggregate_state_exception_memory_leak: [ OK ] 31.03 sec.
2026-02-05 16:22:59 01301_aggregate_state_exception_memory_leak: [ OK ] 31.29 sec.
2026-02-05 16:23:00 01297_create_quota: [ OK ] 0.52 sec.
2026-02-05 16:23:00 01296_create_row_policy_in_current_database: [ OK ] 0.22 sec.
2026-02-05 16:23:00 01295_create_row_policy: [ OK ] 0.27 sec.
2026-02-05 16:23:01 01294_system_distributed_on_cluster: [ OK ] 0.37 sec.
2026-02-05 16:23:01 01294_create_settings_profile: [ OK ] 0.42 sec.
2026-02-05 16:23:01 01293_system_distribution_queue: [ OK ] 0.22 sec.
2026-02-05 16:23:02 01293_create_role: [ OK ] 0.27 sec.
2026-02-05 16:23:04 01292_create_user: [ OK ] 1.78 sec.
2026-02-05 16:23:04 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.22 sec.
2026-02-05 16:23:08 01281_group_by_limit_memory_tracking: [ OK ] 3.83 sec.
2026-02-05 16:23:08 01280_ttl_where_group_by_negative: [ OK ] 0.17 sec.
2026-02-05 16:23:09 01280_ssd_complex_key_dictionary: [ OK ] 1.48 sec.
2026-02-05 16:23:59 01275_parallel_mv: [ OK ] 49.41 sec.
2026-02-05 16:23:59 01268_dictionary_direct_layout: [ OK ] 0.62 sec.
2026-02-05 16:24:00 01257_dictionary_mismatch_types: [ OK ] 0.32 sec.
2026-02-05 16:24:00 01251_dict_is_in_infinite_loop: [ OK ] 0.37 sec.
2026-02-05 16:24:00 01249_bad_arguments_for_bloom_filter: [ OK ] 0.27 sec.
2026-02-05 16:24:16 01238_http_memory_tracking: [ OK ] 15.73 sec.
2026-02-05 16:24:17 01232_extremes: [ OK ] 0.47 sec.
2026-02-05 16:24:17 01231_distributed_aggregation_memory_efficient_mix_levels: [ OK ] 0.32 sec.
2026-02-05 16:24:17 01225_show_create_table_from_dictionary: [ OK ] 0.22 sec.
2026-02-05 16:24:18 01224_no_superfluous_dict_reload: [ OK ] 0.37 sec.
2026-02-05 16:24:28 01200_mutations_memory_consumption: [ OK ] 10.31 sec.
2026-02-05 16:24:58 01192_rename_database_zookeeper: [ OK ] 29.84 sec.
2026-02-05 16:24:58 01191_rename_dictionary: [ OK ] 0.32 sec.
2026-02-05 16:24:59 01164_alter_memory_database: [ OK ] 0.27 sec.
2026-02-05 16:25:03 01161_all_system_tables: [ OK ] 4.84 sec.
2026-02-05 16:25:04 01155_rename_move_materialized_view: [ OK ] 0.62 sec.
2026-02-05 16:25:53 01154_move_partition_long: [ OK ] 49.30 sec.
2026-02-05 16:25:54 01153_attach_mv_uuid: [ OK ] 0.42 sec.
2026-02-05 16:25:54 01152_cross_replication: [ OK ] 0.52 sec.
2026-02-05 16:26:17 01150_ddl_guard_rwr: [ OK ] 22.15 sec.
2026-02-05 16:26:17 01148_zookeeper_path_macros_unfolding: [ OK ] 0.82 sec.
2026-02-05 16:26:18 01129_dict_get_join_lose_constness: [ OK ] 0.17 sec.
2026-02-05 16:26:18 01119_weird_user_names: [ OK ] 0.22 sec.
2026-02-05 16:31:25 01111_create_drop_replicated_db_stress: [ OK ] 307.26 sec.
2026-02-05 16:31:25 01110_dictionary_layout_without_arguments: [ OK ] 0.22 sec.
2026-02-05 16:31:26 01109_exchange_tables: [ OK ] 0.52 sec.
2026-02-05 16:31:40 01108_restart_replicas_rename_deadlock_zookeeper: [ OK ] 14.42 sec.
2026-02-05 16:32:02 01107_atomic_db_detach_attach: [ OK ] 21.46 sec.
2026-02-05 16:32:02 01103_distributed_product_mode_local_column_renames: [ OK ] 0.37 sec.
2026-02-05 16:32:09 01098_temporary_and_external_tables: [ OK ] 6.75 sec.
2026-02-05 16:32:18 01092_memory_profiler: [ OK ] 9.50 sec.
2026-02-05 16:32:19 01091_num_threads: [ OK ] 0.57 sec.
2026-02-05 16:32:21 01085_max_distributed_connections_http: [ OK ] 1.48 sec.
2026-02-05 16:33:09 01083_expressions_in_engine_arguments: [ OK ] 48.44 sec.
2026-02-05 16:33:10 01082_window_view_watch_limit: [ OK ] 1.07 sec.
2026-02-05 16:33:40 01079_parallel_alter_modify_zookeeper_long: [ OK ] 29.71 sec.
2026-02-05 16:34:08 01079_parallel_alter_add_drop_column_zookeeper: [ OK ] 27.71 sec.
2026-02-05 16:34:28 01079_parallel_alter_detach_table_zookeeper: [ OK ] 20.65 sec.
2026-02-05 16:34:30 01078_window_view_alter_query_watch: [ OK ] 1.98 sec.
2026-02-05 16:34:36 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 5.99 sec.
2026-02-05 16:35:01 01076_parallel_alter_replicated_zookeeper: [ OK ] 25.11 sec.
2026-02-05 16:35:05 01075_window_view_proc_tumble_to_now_populate: [ OK ] 3.88 sec.
2026-02-05 16:35:10 01072_window_view_multiple_columns_groupby: [ OK ] 5.04 sec.
2026-02-05 16:35:11 01070_materialize_ttl: [ OK ] 0.52 sec.
2026-02-05 16:35:11 01070_mutations_with_dependencies: [ OK ] 0.42 sec.
2026-02-05 16:35:12 01070_modify_ttl_recalc_only: [ OK ] 0.62 sec.
2026-02-05 16:35:14 01070_window_view_watch_events: [ OK ] 2.23 sec.
2026-02-05 16:35:15 01070_modify_ttl: [ OK ] 0.52 sec.
2026-02-05 16:35:24 01069_window_view_proc_tumble_watch: [ OK ] 8.65 sec.
2026-02-05 16:35:25 01065_window_view_event_hop_watch_bounded: [ OK ] 1.22 sec.
2026-02-05 16:35:26 01060_shutdown_table_after_detach: [ OK ] 0.87 sec.
2026-02-05 16:35:27 01059_window_view_event_hop_watch_strict_asc: [ OK ] 1.57 sec.
2026-02-05 16:35:32 01056_window_view_proc_hop_watch: [ OK ] 5.14 sec.
2026-02-05 16:35:35 01055_window_view_proc_hop_to: [ OK ] 2.68 sec.
2026-02-05 16:35:45 01054_window_view_proc_tumble_to: [ OK ] 9.86 sec.
2026-02-05 16:35:45 01054_cache_dictionary_overflow_cell: [ OK ] 0.37 sec.
2026-02-05 16:35:50 01053_window_view_proc_hop_to_now: [ OK ] 4.74 sec.
2026-02-05 16:35:52 01053_ssd_dictionary: [ OK ] 1.83 sec.
2026-02-05 16:36:00 01052_window_view_proc_tumble_to_now: [ OK ] 8.05 sec.
2026-02-05 16:36:01 01048_window_view_parser: [ OK ] 0.92 sec.
2026-02-05 16:36:01 01048_exists_query: [ OK ] 0.32 sec.
2026-02-05 16:36:05 01045_zookeeper_system_mutations_with_parts_names: [ OK ] 3.83 sec.
2026-02-05 16:36:11 01038_dictionary_lifetime_min_zero_sec: [ OK ] 5.99 sec.
2026-02-05 16:36:12 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.22 sec.
2026-02-05 16:36:12 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.27 sec.
2026-02-05 16:36:38 01035_concurrent_move_partition_from_table_zookeeper: [ OK ] 26.26 sec.
2026-02-05 16:36:38 01023_materialized_view_query_context: [ OK ] 0.32 sec.
2026-02-05 16:36:39 01018_dictionaries_from_dictionaries: [ OK ] 0.37 sec.
2026-02-05 16:36:50 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 11.07 sec.
2026-02-05 16:36:50 01018_ddl_dictionaries_create: [ OK ] 0.42 sec.
2026-02-05 16:36:52 01018_ddl_dictionaries_bad_queries: [ OK ] 1.53 sec.
2026-02-05 16:37:14 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 22.16 sec.
2026-02-05 16:37:28 01014_lazy_database_basic: [ OK ] 14.03 sec.
2026-02-05 16:37:30 01013_sync_replica_timeout_zookeeper: [ OK ] 1.93 sec.
2026-02-05 16:37:31 01010_pmj_right_table_memory_limits: [ OK ] 0.93 sec.
2026-02-05 16:37:42 01007_r1r2_w_r2r1_deadlock: [ OK ] 11.15 sec.
2026-02-05 16:37:53 01005_rwr_shard_deadlock: [ OK ] 10.81 sec.
2026-02-05 16:38:05 01004_rename_deadlock: [ OK ] 11.97 sec.
2026-02-05 16:38:16 01003_kill_query_race_condition: [ OK ] 10.45 sec.
2026-02-05 16:39:35 00993_system_parts_race_condition_drop_zookeeper: [ OK ] 79.12 sec.
2026-02-05 16:39:50 00992_system_parts_race_condition_zookeeper_long: [ OK ] 14.81 sec.
2026-02-05 16:39:50 00985_merge_stack_overflow: [ OK ] 0.67 sec.
2026-02-05 16:39:51 00971_query_id_in_logs: [ OK ] 0.62 sec.
2026-02-05 16:39:51 00963_achimbab: [ OK ] 0.22 sec.
2026-02-05 16:39:52 00950_dict_get: [ OK ] 0.57 sec.
2026-02-05 16:39:53 00933_test_fix_extra_seek_on_compressed_cache: [ OK ] 1.58 sec.
2026-02-05 16:39:58 00899_long_attach_memory_limit: [ OK ] 4.79 sec.
2026-02-05 16:40:00 00877_memory_limit_for_new_delete: [ OK ] 1.67 sec.
2026-02-05 16:40:30 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 29.77 sec.
2026-02-05 16:40:31 00834_cancel_http_readonly_queries_on_client_close: [ OK ] 1.53 sec.
2026-02-05 16:40:31 00722_inner_join: [ OK ] 0.27 sec.
2026-02-05 16:40:32 00693_max_block_size_system_tables_columns: [ OK ] 0.32 sec.
2026-02-05 16:40:34 00623_truncate_table_throw_exception: [ OK ] 1.98 sec.
2026-02-05 16:40:35 00612_http_max_query_size: [ OK ] 1.02 sec.
2026-02-05 16:40:35 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.57 sec.
2026-02-05 16:40:37 00474_readonly_settings: [ OK ] 1.18 sec.
2026-02-05 16:40:44 00463_long_sessions_in_http_interface: [ OK ] 7.70 sec.
2026-02-05 16:40:45 00332_quantile_timing_memory_leak: [ OK ] 0.17 sec.
2026-02-05 16:40:45 00309_formats_case_insensitive: [ OK ] 0.22 sec.
2026-02-05 16:40:50 00110_external_sort: [ OK ] 5.14 sec.
2026-02-05 16:41:25 00002_log_and_exception_messages_formatting: [ OK ] 35.09 sec.
2026-02-05 16:41:25
2026-02-05 16:41:25 568 tests passed. 3 tests skipped. 2690.59 s elapsed (MainProcess).
2026-02-05 16:41:26 Won't run stateful tests because test data wasn't loaded.
2026-02-05 16:41:26 Checking the hung queries: done
2026-02-05 16:41:26
2026-02-05 16:41:26 No queries hung.
2026-02-05 16:41:26
2026-02-05 16:41:26 Some tests were restarted:
2026-02-05 16:41:26
2026-02-05 16:41:26
2026-02-05 16:41:26 02221_parallel_replicas_bug :
2026-02-05 16:41:26 [ fail ] 1.37 sec.
2026-02-05 16:41:26 Reason: having stderror:
2026-02-05 16:41:26 [c25bb6c9fb40] 2026.02.05 15:50:26.289447 [ 32918 ] {6b978063-9d64-426a-a4df-03dd967b96ba} ConnectionPoolWithFailover: Connection failed at try №1, reason: Code: 210. DB::NetException: Connection refused (127.0.0.3:1234). (NETWORK_ERROR) (version 24.8.14.10502.altinitytest (altinity build))
2026-02-05 16:41:26
2026-02-05 16:41:26 stdout:
2026-02-05 16:41:26
2026-02-05 16:41:26
2026-02-05 16:41:26 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 959954 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 23566069 --max_read_buffer_size 552293 --prefer_localhost_replica 0 --max_block_size 53019 --max_joined_block_size_rows 14884 --max_threads 1 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 33 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 17847066 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method pread_threadpool --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 4 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 864514871 --min_compress_block_size 1580659 --max_compress_block_size 1768651 --merge_tree_compact_parts_min_granules_to_multibuffer_read 56 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 5377171 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone America/Punta_Arenas --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.86 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 0 --max_parsing_threads 0 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1
2026-02-05 16:41:26
2026-02-05 16:41:26 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1491844887 --index_granularity_bytes 19182791 --merge_max_block_size 19763 --index_granularity 52832 --min_bytes_for_wide_part 0 --marks_compress_block_size 88960 --primary_key_compress_block_size 74131 --replace_long_file_name_to_hash 0 --max_file_name_length 126 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 142995992 --compact_parts_max_granules_to_buffer 64 --compact_parts_merge_max_bytes_to_prefetch_part 32830966 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 75 --old_parts_lifetime 10
2026-02-05 16:41:26
2026-02-05 16:41:26 Database: test_vgch3pj8
2026-02-05 16:41:26 All tests have finished.
2026-02-05 16:41:26
2026-02-05 16:41:26 Top patterns of log messages:
2026-02-05 16:41:26
2026-02-05 16:41:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-02-05 16:41:26
2026-02-05 16:41:26 1. 626772 0.078 29.57 MiB 0.034 1 1350 ['Trace'] 1 is disk {} eligible for search: {}
2026-02-05 16:41:26 2. 360030 0.045 76.33 MiB 0.088 1 417 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2026-02-05 16:41:26 3. 359837 0.045 53.90 MiB 0.062 122099 414 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2026-02-05 16:41:26 4. 303475 0.038 13.32 MiB 0.015 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2026-02-05 16:41:26 5. 301213 0.038 8.30 MiB 0.01 1 411 ['Debug'] 0 Processed in {} sec.
2026-02-05 16:41:26 6. 244362 0.03 5.90 MiB 0.007 1 1225 ['Trace'] 0.001 Query to stage {}{}
2026-02-05 16:41:26 7. 241313 0.03 11.39 MiB 0.013 1 1224 ['Trace'] 0.001 Query from stage {} to stage {}{}
2026-02-05 16:41:26 8. 225542 0.028 30.56 MiB 0.035 1 2 ['Trace'] 1 Creating part at path {}
2026-02-05 16:41:26 9. 166962 0.021 13.21 MiB 0.015 1 384 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2026-02-05 16:41:26 10. 150230 0.019 10.32 MiB 0.012 1 2142 ['Trace'] 0.501 Reserved {} on local disk {}, having unreserved {}.
2026-02-05 16:41:26 11. 145312 0.018 6.46 MiB 0.007 1 450 ['Debug'] 0.16 Peak memory usage{}: {}.
2026-02-05 16:41:26 12. 133414 0.017 14.92 MiB 0.017 6049 1863 ['Trace'] 0.362 Renaming temporary part {} to {} with tid {}.
2026-02-05 16:41:26 13. 131253 0.016 8.89 MiB 0.01 6030 2142 ['Trace'] 0.466 Trying to reserve {} using storage policy from min volume index {}
2026-02-05 16:41:26 14. 125109 0.016 5.81 MiB 0.007 125109 765 ['Debug'] 0.997 Authenticating user '{}' from {}
2026-02-05 16:41:26 15. 124767 0.016 13.68 MiB 0.016 124767 765 ['Debug'] 0.997 {} Authenticated with global context as user {}
2026-02-05 16:41:26 16. 124669 0.016 10.70 MiB 0.012 124669 762 ['Debug'] 0.997 {} Logout, user_id: {}
2026-02-05 16:41:26 17. 123143 0.015 8.81 MiB 0.01 123143 415 ['Debug'] 1 Creating session context with user_id: {}
2026-02-05 16:41:26 18. 117735 0.015 3.67 MiB 0.004 1 1585 ['Trace'] 0 Aggregation method: {}
2026-02-05 16:41:26 19. 115531 0.014 10.16 MiB 0.012 735 597 ['Trace'] 0.985 Insert entry {} to queue with type {}
2026-02-05 16:41:26 20. 105036 0.013 4.73 MiB 0.005 1 1850 ['Trace'] 0.122 filled checksums {}
2026-02-05 16:41:26 21. 99781 0.012 3.90 MiB 0.005 439 726 ['Debug'] 0.487 Will use old analyzer to prepare mutation
2026-02-05 16:41:26 22. 98488 0.012 8.87 MiB 0.01 1 1580 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-02-05 16:41:26 23. 93829 0.012 1007.93 KiB 0.001 1 1536 ['Trace'] 0 Aggregating
2026-02-05 16:41:26 24. 89894 0.011 18.61 MiB 0.022 3 331 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2026-02-05 16:41:26 25. 89871 0.011 59.37 MiB 0.069 2 331 ['Trace'] 1 Request URI: {}
2026-02-05 16:41:26 26. 84470 0.011 1.69 MiB 0.002 2 331 ['Debug'] 0.397 Done processing query
2026-02-05 16:41:26 27. 78912 0.01 6.09 MiB 0.007 1223 1917 ['Trace'] 0.936 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2026-02-05 16:41:26 28. 73955 0.009 5.84 MiB 0.007 1 1538 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2026-02-05 16:41:26 29. 73105 0.009 2.33 MiB 0.003 2 414 ['Trace'] 1 TCP Request. Address: {}
2026-02-05 16:41:26 30. 73087 0.009 6.92 MiB 0.008 1 414 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2026-02-05 16:41:26 31. 72856 0.009 1.88 MiB 0.002 1 411 ['Debug'] 1 Done processing connection.
2026-02-05 16:41:26 32. 72684 0.009 5.61 MiB 0.006 3403 470 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2026-02-05 16:41:26 33. 68692 0.009 1.70 MiB 0.002 729 596 ['Debug'] 0.986 Pulled {} entries to queue.
2026-02-05 16:41:26 34. 68692 0.009 3.87 MiB 0.004 729 596 ['Debug'] 0.986 Pulling {} entries to queue: {} - {}
2026-02-05 16:41:26 35. 64302 0.008 6.53 MiB 0.008 1 120 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2026-02-05 16:41:26 36. 58916 0.007 2.26 MiB 0.003 602 222 ['Debug'] 0.634 Committing part {} to zookeeper
2026-02-05 16:41:26 37. 58891 0.007 4.84 MiB 0.006 1553 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2026-02-05 16:41:26 38. 58667 0.007 7.97 MiB 0.009 1119 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2026-02-05 16:41:26 39. 50264 0.006 5.71 MiB 0.007 436 33 ['Debug'] 1 Fetching part {} from {}:{}
2026-02-05 16:41:26 40. 50226 0.006 1.87 MiB 0.002 597 32 ['Debug'] 0.667 Part {} committed to zookeeper
2026-02-05 16:41:26 41. 45303 0.006 1017.55 KiB 0.001 1 1433 ['Trace'] 0 Merging aggregated data
2026-02-05 16:41:26 42. 43888 0.005 4.00 MiB 0.005 1 172 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2026-02-05 16:41:26 43. 42695 0.005 1.36 MiB 0.002 398 237 ['Information'] 0.001 Added mutation: {}{}
2026-02-05 16:41:26 44. 40739 0.005 2.15 MiB 0.002 3812 611 ['Debug'] 0.006 Key condition: {}
2026-02-05 16:41:26 45. 40564 0.005 1.41 MiB 0.002 8 11 ['Trace'] 0.995 Removing mutation: {}
2026-02-05 16:41:26 46. 38363 0.005 1.35 MiB 0.002 435 38 ['Trace'] 1 Checking disk {} with type {}
2026-02-05 16:41:26 47. 38363 0.005 3.22 MiB 0.004 435 38 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2026-02-05 16:41:26 48. 38171 0.005 1.64 MiB 0.002 3805 611 ['Trace'] 0.006 Filtering marks by primary and secondary keys
2026-02-05 16:41:26 49. 37553 0.005 4.20 MiB 0.005 3763 611 ['Debug'] 0.006 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2026-02-05 16:41:26 50. 36339 0.005 2.74 MiB 0.003 1 388 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2026-02-05 16:41:26 51. 33745 0.004 1.71 MiB 0.002 3343 608 ['Trace'] 0.007 Spreading mark ranges among streams (default reading)
2026-02-05 16:41:26 52. 33630 0.004 648.01 KiB 0.001 435 39 ['Debug'] 1 Downloading files {}
2026-02-05 16:41:26 53. 33629 0.004 768.32 KiB 0.001 372 134 ['Trace'] 1 Sending part {}
2026-02-05 16:41:26 54. 33622 0.004 2.79 MiB 0.003 435 39 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2026-02-05 16:41:26 55. 33578 0.004 1.49 MiB 0.002 422 38 ['Debug'] 1 Downloading part {} onto disk {}.
2026-02-05 16:41:26 56. 33504 0.004 3.92 MiB 0.005 433 33 ['Debug'] 1 Fetched part {} from {}:{}{}
2026-02-05 16:41:26 57. 33483 0.004 1.77 MiB 0.002 421 38 ['Debug'] 1 Download of part {} onto disk {} finished.
2026-02-05 16:41:26 58. 31369 0.004 3.65 MiB 0.004 12065 16 ['Trace'] 1 Executing log entry to merge parts {} to {}
2026-02-05 16:41:26 59. 29851 0.004 1.74 MiB 0.002 7259 648 ['Debug'] 0.022 There are {} detached tables. Start searching non used tables.
2026-02-05 16:41:26 60. 29851 0.004 1.22 MiB 0.001 7259 648 ['Debug'] 0.022 Found {} non used tables in detached tables.
2026-02-05 16:41:26 61. 22878 0.003 707.41 KiB 0.001 150 500 ['Information'] 0.966 Will drop empty part {}
2026-02-05 16:41:26 62. 22354 0.003 4.52 MiB 0.005 3790 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it
2026-02-05 16:41:26 63. 22143 0.003 1.34 MiB 0.002 39 381 ['Trace'] 0.998 Will try to insert a log entry to DROP_PART for part {}
2026-02-05 16:41:26 64. 20039 0.002 1.27 MiB 0.001 123 501 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem
2026-02-05 16:41:26 65. 19191 0.002 2.37 MiB 0.003 1 233 ['Trace'] 0 Have {} pending inserts with total {} bytes of data for query '{}'
2026-02-05 16:41:26 66. 18350 0.002 896.27 KiB 0.001 1443 725 ['Debug'] 0.838 Selected {} parts from {} to {}
2026-02-05 16:41:26 67. 17510 0.002 1.26 MiB 0.001 741 1113 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2026-02-05 16:41:26 68. 16809 0.002 2.84 MiB 0.003 13 1384 ['Information','Trace','Error','Warning'] 0.901
2026-02-05 16:41:26 69. 16622 0.002 9.81 MiB 0.011 1 1360 ['Information'] 0.902 {}: {}
2026-02-05 16:41:26 70. 16416 0.002 480.94 KiB 0.001 1549 561 ['Debug'] 0.984 Updating strategy picker state
2026-02-05 16:41:26 71. 16348 0.002 3.20 MiB 0.004 1 1350 ['Information'] 1 Removing metadata {} of dropped table {}
2026-02-05 16:41:26 72. 16321 0.002 1.18 MiB 0.001 1 295 ['Debug'] 0 Waiting for table {} to be finally dropped
2026-02-05 16:41:26 73. 16321 0.002 1.84 MiB 0.002 1 295 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2026-02-05 16:41:26 74. 16220 0.002 491.04 KiB 0.001 1 1350 ['Information'] 0.925 Response status: {}, {}
2026-02-05 16:41:26 75. 16150 0.002 1.26 MiB 0.001 1 1380 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2026-02-05 16:41:26 76. 15884 0.002 3.24 MiB 0.004 1 256 ['Trace'] 0.01 PREWHERE condition was split into {} steps: {}
2026-02-05 16:41:26 77. 15662 0.002 443.56 KiB 0.001 1 1362 ['Debug'] 1 Stop worker in {}
2026-02-05 16:41:26 78. 15662 0.002 1.12 MiB 0.001 1 1329 ['Debug'] 1 Execute load job '{}' in {}
2026-02-05 16:41:26 79. 15662 0.002 1.06 MiB 0.001 1 1329 ['Debug'] 1 Finish load job '{}' with status {}
2026-02-05 16:41:26 80. 15662 0.002 611.80 KiB 0.001 1 1547 ['Debug'] 0.494 Spawn loader worker #{} in {}
2026-02-05 16:41:26 81. 15662 0.002 1.16 MiB 0.001 1 220 ['Debug'] 0 Schedule load job '{}' into {}
2026-02-05 16:41:26 82. 15661 0.002 1.42 MiB 0.002 1 220 ['Debug'] 0 Prioritize load job '{}': {} -> {}
2026-02-05 16:41:26 83. 15526 0.002 1.20 MiB 0.001 1 178 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2026-02-05 16:41:26 84. 15526 0.002 527.43 KiB 0.001 1 178 ['Debug'] 0 Selected MergeAlgorithm: {}
2026-02-05 16:41:26 85. 15303 0.002 1.93 MiB 0.002 1 178 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2026-02-05 16:41:26 86. 15275 0.002 928.09 KiB 0.001 1212 178 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2026-02-05 16:41:26 87. 15246 0.002 506.21 KiB 0.001 1 1539 ['Debug'] 0.5 Change current priority: {} -> {}
2026-02-05 16:41:26 88. 15039 0.002 132.18 KiB 0 2 220 ['Trace'] 0 No tables
2026-02-05 16:41:26 89. 14795 0.002 581.46 KiB 0.001 66 47 ['Trace'] 0.994 Enqueueing {} for check after {}s
2026-02-05 16:41:26 90. 14303 0.002 1.01 MiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2026-02-05 16:41:26 91. 14167 0.002 337.75 KiB 0 110 589 ['Information','Debug'] 0.986 Checking part {}
2026-02-05 16:41:26 92. 13989 0.002 699.74 KiB 0.001 66 521 ['Trace'] 0.999 Part {} in zookeeper: {}, locally: {}
2026-02-05 16:41:26 93. 13561 0.002 992.85 KiB 0.001 1 255 ['Trace'] 0.005 Condition {} moved to PREWHERE
2026-02-05 16:41:26 94. 13530 0.002 769.65 KiB 0.001 59 512 ['Information'] 1 Checking if anyone has a part {} or covering part.
2026-02-05 16:41:26 95. 13444 0.002 2.58 MiB 0.003 1 961 ['Trace'] 0.002 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2026-02-05 16:41:26 96. 12854 0.002 1.56 MiB 0.002 30 512 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now.
2026-02-05 16:41:26 97. 12836 0.002 2.21 MiB 0.003 2505 32 ['Information'] 1 No active replica has part {} or covering part (cannot execute {}: {})
2026-02-05 16:41:26 98. 12548 0.002 441.15 KiB 0 1 155 ['Trace'] 1 Keeper request. Address: {}
2026-02-05 16:41:26 99. 12500 0.002 4.94 MiB 0.006 2 48 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {}
2026-02-05 16:41:26 100. 12323 0.002 903.74 KiB 0.001 1830 32 ['Debug'] 1 Skipping action for part {} because part {} already exists.
2026-02-05 16:41:26
2026-02-05 16:41:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-02-05 16:41:26
2026-02-05 16:41:26
2026-02-05 16:41:26
2026-02-05 16:41:26 Top messages without format string (fmt::runtime):
2026-02-05 16:41:26
2026-02-05 16:41:26 count pattern runtime_message line
2026-02-05 16:41:26
2026-02-05 16:41:26 1. 16220 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2026-02-05 16:41:26 2. 75 Connectiontomysqlfailedtimes Connection to mysql failed 1 times ('',0)
2026-02-05 16:41:26 3. 70 CodeDBExceptionOkwhileexecutingF Code: 395. DB::Exception: Ok: while executing 'FUNCTION throwIf(greater(__table1.number, 10000000_UInt32) :: 1, 'Ok'_String :: 4) -> throwIf(greater(__table1.number, 10000000_UInt32), 'Ok'_String) UInt8 : 3'. (FUNCTION_THROW_IF_VALUE_IS_NON_ZERO) (version ('/executeQuery.cpp',221)
2026-02-05 16:41:26 4. 67 DBExceptionThereisnouserinvalids DB::Exception: There is no user `invalid_session_log_test_user_f1a50f1d237f379c257128260ade4f96_no_password_two_profiles_no_roles` in user directories ('',0)
2026-02-05 16:41:26 5. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('SEECTwrong'): SEECTwrong. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SEL ('/executeQuery.cpp',221)
2026-02-05 16:41:26 6. 47 CodeDBExceptionReceivedfromDBExc Code: 507. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Sharding key modulo(sub_key, 2) is not used. Stack trace:
2026-02-05 16:41:26
2026-02-05 16:41:26 0. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x0000 ('/executeQuery.cpp',221)
2026-02-05 16:41:26 7. 39 DBExceptionsessionlogtestuserfaf DB::Exception: session_log_test_user_f1a50f1d237f379c257128260ade4f96_plaintext_password_no_profiles_no_roles: Authentication failed: password is incorrect, or there is no user with such name. ('',0)
2026-02-05 16:41:26 8. 39 Connectiontosystemasuserinvalids Connection to system@127.0.0.1:9004 as user invalid_session_log_test_user_f1a50f1d237f379c257128260ade4f96_no_password_two_profiles_no_roles failed: mysqlxx::ConnectionFailed: There is no user `invalid_session_log_test_user_f1a50f1d237f379c257128260ade4f96 ('',0)
2026-02-05 16:41:26 9. 27 Connectiontosystemasusersessionl Connection to system@127.0.0.1:9004 as user session_log_test_user_f1a50f1d237f379c257128260ade4f96_plaintext_password_no_profiles_no_roles failed: mysqlxx::ConnectionFailed: session_log_test_user_f1a50f1d237f379c257128260ade4f96_plaintext_password_no_profi ('',0)
2026-02-05 16:41:26 10. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:48282) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221)
2026-02-05 16:41:26 11. 10 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace:
2026-02-05 16:41:26
2026-02-05 16:41:26 0. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::Mess ('/executeQuery.cpp',221)
2026-02-05 16:41:26 12. 8 CodeDBExceptionSyntaxerrorMultis Code: 62. DB::Exception: Syntax error (Multi-statements are not allowed): failed at position 9 (end of query): ; S. . (SYNTAX_ERROR) (version 24.8.14.10502.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:33024) (comment: 00366_multi_statements.sh) ('/executeQuery.cpp',221)
2026-02-05 16:41:26 13. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:46410) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221)
2026-02-05 16:41:26 14. 6 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10502.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:41832) (in query: ), Stack trace (when copying this message, always include the lines below):
2026-02-05 16:41:26
2026-02-05 16:41:26 0. ./build_docker/./src/Commo ('/executeQuery.cpp',221)
2026-02-05 16:41:26 15. 6 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10502.a ('/executeQuery.cpp',221)
2026-02-05 16:41:26 16. 6 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'LINESTRING'' in () (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:40242) (comment: 00534_functions_bad_arguments7.sh) ('/executeQuery.cpp',221)
2026-02-05 16:41:26 17. 6 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'LINESTRING'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',765)
2026-02-05 16:41:26 18. 5 PocoExceptionCodeecodeTimeoutcon Poco::Exception. Code: 1000, e.code() = 0, Timeout: connect timed out: 128.0.0.1:8123 (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:54534) (comment: 02044_url_glob_parallel_connection_refused.sh) (in query: SELECT * FROM url('http://128 ('/executeQuery.cpp',221)
2026-02-05 16:41:26 19. 5 CodeDBExceptionTimeoutconnecttim Code: 1000. DB::Exception: Timeout: connect timed out: 128.0.0.1:8123. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-02-05 16:41:26
2026-02-05 16:41:26 0. ./base/poco/Foundation/src/Exception.cpp:148: Poco::Net::SocketImpl::connect(Poco::Net::So ('/TCPHandler.cpp',765)
2026-02-05 16:41:26 20. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:44910) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2026-02-05 16:41:26 21. 4 createsnapshotidxlogterm create snapshot idx 300000 log_term 1 ('/LoggerWrapper.h',43)
2026-02-05 16:41:26 22. 4 creatingasnapshotforindex creating a snapshot for index 300000 ('/LoggerWrapper.h',43)
2026-02-05 16:41:26 23. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2026-02-05 16:41:26 24. 4 CodeDBExceptionSQLitedatabasefil Code: 481. DB::Exception: SQLite database file path '/etc/passwd' must be inside 'user_files' directory. (PATH_ACCESS_DENIED) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:56002) (comment: 02918_sqlite_path_check.sh) (in query: Select * ('/executeQuery.cpp',221)
2026-02-05 16:41:26 25. 4 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 3 (end of query): . Expected one of: NULL, NOT, DEFAULT, MATERIALIZED, EPHEMERAL, ALIAS, AUTO_INCREMENT, PRIMARY KEY, data type, identifier. (SYNTAX_ERROR) (version 24.8.1 ('/executeQuery.cpp',221)
2026-02-05 16:41:26 26. 4 snapshotidxlogtermcreatedcompact snapshot idx 300000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43)
2026-02-05 16:41:26 27. 4 CodeDBExceptionExpectedguidasarg Code: 395. DB::Exception: Expected guid as argument: while executing 'FUNCTION if(_CAST(1_UInt8, 'UInt8'_String) :: 1, toString(throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected guid as argument'_String)) :: 3, _CAST(NULL_Nullable(Nothing), 'Nullable(Noth ('/executeQuery.cpp',221)
2026-02-05 16:41:26 28. 4 CodeDBExceptionShouldthrowwhilee Code: 395. DB::Exception: Should throw: while executing 'FUNCTION throwIf(equals(__table1.b, 1_UInt8) :: 3, 'Should throw'_String :: 2) -> throwIf(equals(__table1.b, 1_UInt8), 'Should throw'_String) UInt8 : 1': While executing MergeTreeSelect(pool: ReadPoo ('/executeQuery.cpp',221)
2026-02-05 16:41:26 29. 4 createsnapshotidxlogtermdoneusel create snapshot idx 300000 log_term 1 done: 106 us elapsed ('/LoggerWrapper.h',43)
2026-02-05 16:41:28 30. 3 ConnectiontosystemasuserMYSQLUSE Connection to system@127.0.0.1:9004 as user 02833_MYSQL_USER_28535 failed: mysqlxx::ConnectionFailed: 02833_MYSQL_USER_28535: Authentication failed: password is incorrect, or there is no user with such name. ((nullptr):9004) ('',0)
2026-02-05 16:41:28
2026-02-05 16:41:28
2026-02-05 16:41:28
2026-02-05 16:41:28 Top messages not matching their format strings:
2026-02-05 16:41:28
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 1. 16428 Connection to conv_main@127.0.0.1:3456 as user metrika failed: mysqlxx::ConnectionFailed: Can't connect to MySQL server on '127.0.0.1' (115) ((nullptr):0)
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:56138) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2026-02-05 16:41:28
2026-02-05 16:41:28 0. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000d1ddc3b
2026-02-05 16:41:28 1. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x0000000007e1218c
2026-02-05 16:41:28 2. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x00000000088ad60e
2026-02-05 16:41:28 3. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x00000000088ad333
2026-02-05 16:41:28 4. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x00000000088b75bf
2026-02-05 16:41:28 5. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000088b6bad
2026-02-05 16:41:28 6. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007e2a2ba
2026-02-05 16:41:28 7. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891db27
2026-02-05 16:41:28 8. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891e43e
2026-02-05 16:41:28 9. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891f7bd
2026-02-05 16:41:28 10. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x0000000010cb45b9
2026-02-05 16:41:28 11. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x00000000128ddb16
2026-02-05 16:41:28 12. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000d522813
2026-02-05 16:41:28 13. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012659a72
2026-02-05 16:41:28 14. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012674fe7
2026-02-05 16:41:28 15. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x00000000126698b0
2026-02-05 16:41:28 16. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012668d22
2026-02-05 16:41:28 17. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012678aca
2026-02-05 16:41:28 18. ./base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000d2af07f
2026-02-05 16:41:28 19. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000d2b5f1a
2026-02-05 16:41:28 20. ? @ 0x00007f1fd238eac3
2026-02-05 16:41:28 21. ? @ 0x00007f1fd2420850
2026-02-05 16:41:28
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 3. (from {}{}{}){}{} {} (stage: {}) 8 (from [::1]:34358) (comment: 02686_bson3.sql) -- It correctly throws exception about incorrect data:
2026-02-05 16:41:28 SELECT * FROM format(BSONEachRow, 'WatchID Int64, JavaEnable Int16, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID Int32, ClientIP Int32, RegionID Int32, UserID Int64, CounterClass Int16, OS Int16, UserAgent Int16, URL String, Referer String, IsRefresh Int16, RefererCategoryID Int16, RefererRegionID Int32, URLCategoryID Int16, URLRegionID Int32, ResolutionWidth Int16, ResolutionHeight Int16, ResolutionDepth Int16, FlashMajor Int16, FlashMinor Int16, FlashMinor2 String, NetMajor Int16, NetMinor Int16, UserAgentMajor Int16, UserAgentMinor String, CookieEnable Int16, JavascriptEnable Int16, IsMobile Int16, MobilePhone Int16, MobilePhoneModel String, Params String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, SocialSourceNetworkID Int16, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency String, ParamCurrencyID Int16, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int32', $$^ WatchID c*5/ !p~JavaEnable Title GoodEvent EventTime 7�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnabl�sMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime &�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID �F�ӓ2qJavaEnable Title GoodEvent EventTime n$�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime ǘ�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage P�amPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID l!�|�@HJavaEnable Title GoodEvent EventTime �)�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime }�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID �ǐ=ЌWJavaEnable Title GoodEvent EventTime 8*�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime ݞ�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID � WatchID �E&LyJavaEnable Title GoodEvent EventTime J�Q EventDate > CounterID ClientIP �I`RegionID ' UserID q�Jd8CounterClass OS UserAgent URL - http://holodilnik.ru/russia/05jul2013&model=0Referer IsRefresh RefererCategoryID RefererRegionID URLCateParams String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �
2026-02-05 16:41:28 o�eCLID � WatchID �k=�pJavaEnable Title GoodEvent EventTime ��Q EventDate > CounterID Clien�Q9�HRegionID G UserID
�Ks}�CounterClass OS UserAgent URL H http://afisha.mail.ru/catalog/314/women.ru/ency=1&page3/?errovat-pinnikiReferer IsRefresh RefererCategoryID RefererRegionID URLCategoryID 0= URLRegionID � ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor D�CookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4
PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID :�W�mOriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime A�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �
�#�\CLID � Wa⋯
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 4. Close WriteBufferFromAzureBlobStorage. {}. 6 Close WriteBufferFromAzureBlobStorage. jbdxziuhrszxhvvngvwibupnxuitaxsg. (LogSeriesLimiter: on interval from 2026-02-05 16:11:40 to 2026-02-05 16:12:06 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 5. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10502.altinitytest (altinity build)) (from [::1]:58440) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests
2026-02-05 16:41:28 -- Even if the fallback is used, invalid substitutions must throw an exception.
2026-02-05 16:41:28 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below):
2026-02-05 16:41:28
2026-02-05 16:41:28 0. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000d1ddc3b
2026-02-05 16:41:28 1. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x0000000007e1218c
2026-02-05 16:41:28 2. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000c4a278b
2026-02-05 16:41:28 3. DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000c4a6948
2026-02-05 16:41:28 4. DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const (.535e5163d1dcb49a63f83dc276d8eca6) @ 0x000000000c4a3be7
2026-02-05 16:41:28 5. DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007e1108a
2026-02-05 16:41:28 6. DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007e2a31a
2026-02-05 16:41:28 7. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891db07
2026-02-05 16:41:28 8. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891e43e
2026-02-05 16:41:28 9. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000891f7bd
2026-02-05 16:41:28 10. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010ab4751
2026-02-05 16:41:28 11. ./build_docker/./src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010ab331d
2026-02-05 16:41:28 12. ./build_docker/./src/Processors/QueryPlan/ExpressionStep.cpp:32: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x0000000012a3b2b4
2026-02-05 16:41:28 13. ./contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x000000000fe5b405
2026-02-05 16:41:28 14. ./build_docker/./src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x00000000110f9bac
2026-02-05 16:41:28 15. ./contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x00000000110f16a2
2026-02-05 16:41:28 16. ./build_docker/./src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x00000000110eb0b9
2026-02-05 16:41:28 17. ./build_docker/./src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000011434d41
2026-02-05 16:41:28 18. ./build_docker/./src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000001143133a
2026-02-05 16:41:28 19. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x00000000125dd7cb
2026-02-05 16:41:28 20. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x00000000125f9f98
2026-02-05 16:41:28 21. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x00000000153b4a07
2026-02-05 16:41:28 22. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x00000000153b4e99
2026-02-05 16:41:28 23. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x0000000015381e41
2026-02-05 16:41:28 24. ./base/poco/Foundation/include/Poco/SharedPtr.h:231: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000153803fd
2026-02-05 16:41:28 25. ? @ 0x00007f1fd238eac3
2026-02-05 16:41:28 26. ? @ 0x00007f1fd2420850
2026-02-05 16:41:28
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:28 6. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 2 /var/lib/clickhouse/disks/s3_disk/store/c32/c32d858b-ecd6-4438-a6fa-62817db4115b/tmp_insert_all_7_7_0/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 9 similar messages)
2026-02-05 16:41:28 message_format_string count() any_message
2026-02-05 16:41:28
2026-02-05 16:41:29 7. Condition {} moved to PREWHERE 2 Condition equals(address, 'Ӈ�Jl�X��X̊�Y') moved to PREWHERE
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29 Top short messages:
2026-02-05 16:41:29
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 1. 224 {} Code: 243. DB::Exception: Unable to parse fragment %Y from because readNumber4 requires size >= 4: In scope SELECT TO_U 91
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 2. 32 Creating {}: {} Creating table test_1uoyqbdx.test: CREATE TABLE IF NOT EXISTS test_1uoyqbdx.test UUID '8dc04aac-84a1-46de-86d1-26356ecf3 120
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 3. 14 Froze {} parts Froze 1 parts -13
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 4. 6 Database {} does not exist Code: 81. DB::Exception: Database nope does not exist. (UNKNOWN_DATABASE) (version 24.8.14.10502.altinitytest (altinity 28
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 5. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10502.altinitytest (altinity buil 29
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 6. 5 Resetting nice Resetting nice -12
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 7. 4 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10502.altinitytest (al 29
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 8. 4 Illegal HDFS URI: {} Code: 36. DB::Exception: Illegal HDFS URI: //abcd. (BAD_ARGUMENTS) (version 24.8.14.10502.altinitytest (altinity build)) 25
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 9. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10502.altinitytest (altinity buil 29
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 10. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10502.altinitytest (altinity bui 27
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 11. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10502.altinitytest (altinity build) 24
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 12. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10502.altinitytest (altinity build 27
2026-02-05 16:41:29 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-05 16:41:29
2026-02-05 16:41:29 13. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10502.altinitytest (altinity build 25
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29 Top messages by level:
2026-02-05 16:41:29
2026-02-05 16:41:29 (0.0020949018322445885,'') Error
2026-02-05 16:41:29 (0.00010805401205045263,'Not enabled four letter command {}') Warning
2026-02-05 16:41:29 (0.0053210681020692905,'Added mutation: {}{}') Information
2026-02-05 16:41:29 (0.04487045669956685,'(from {}{}{}){}{} {} (stage: {})') Debug
2026-02-05 16:41:29 (0.07811445125823102,'is disk {} eligible for search: {}') Trace
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29 The following functions were not covered by tests:
2026-02-05 16:41:29
2026-02-05 16:41:29 catboostEvaluate
2026-02-05 16:41:29 dynamicElement
2026-02-05 16:41:29 structureToCapnProtoSchema
2026-02-05 16:41:29 structureToProtobufSchema
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29
2026-02-05 16:41:29 The following aggregate functions were not covered by tests:
2026-02-05 16:41:29
2026-02-05 16:41:29 flameGraph
2026-02-05 16:41:29
2026-02-05 16:41:29
+ set -e
+ echo 'Files in current directory'
Files in current directory
+ ls -la ./
total 129668
drwxr-xr-x 1 root root 4096 Feb 5 16:27 .
drwxr-xr-x 1 root root 4096 Feb 5 16:27 ..
-rw-rw-r-- 1 1000 1000 119 Feb 5 15:33 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 9 Feb 5 16:15 a.txt
-rw-r--r-- 1 root root 1541 Feb 5 16:27 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Feb 5 16:12 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2315125 Feb 5 16:41 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Feb 5 16:27 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 5 15:33 broken_tests.json
-rw-r--r-- 1 root root 9 Feb 5 16:15 b.txt
-rw-r--r-- 1 root root 9 Feb 5 16:15 c.txt
drwxr-x--- 4 root root 4096 Feb 5 16:07 data
drwxr-xr-x 14 root root 3860 Feb 5 15:36 dev
drwxr-xr-x 2 root root 4096 Feb 5 16:15 dir
-rwxr-xr-x 1 root root 0 Feb 5 15:36 .dockerenv
drwxr-xr-x 1 root root 4096 Feb 5 15:37 etc
drwxr-x--- 2 root root 4096 Feb 5 16:07 flags
drwxr-x--- 2 root root 4096 Feb 5 16:07 format_schemas
drwxr-xr-x 1 1000 1000 4096 Feb 5 15:37 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Feb 5 16:07 metadata
drwxr-x--- 2 root root 4096 Feb 5 16:07 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Feb 5 15:37 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Feb 5 15:36 package_folder
drwxr-x--- 2 root root 4096 Feb 5 16:15 preprocessed_configs
dr-xr-xr-x 316 root root 0 Feb 5 15:36 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Feb 5 15:40 queries_02352
-rw-r----- 1 root root 1 Feb 5 16:07 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Feb 5 16:07 roles.list
drwx------ 1 root root 4096 Feb 5 16:35 root
-rw-r----- 1 root root 1 Feb 5 16:07 row_policies.list
drwxr-xr-x 1 root root 4096 Feb 5 15:37 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Feb 5 15:37 script.gdb
-rw-r--r-- 1 root root 65505 Feb 5 16:18 server.log
-rw-r----- 1 root root 1 Feb 5 16:07 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 60 Feb 5 16:15 status
drwxr-x--- 4 root root 4096 Feb 5 16:07 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 5 15:36 sys
drwxrwxr-x 2 1000 1000 4096 Feb 5 15:37 test_output
drwxrwxrwt 1 root root 4096 Feb 5 16:41 tmp
drwxr-x--- 2 root root 4096 Feb 5 16:07 user_files
-rw-r----- 1 root root 1 Feb 5 16:12 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Feb 5 16:07 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 129668
drwxr-xr-x 1 root root 4096 Feb 5 16:27 .
drwxr-xr-x 1 root root 4096 Feb 5 16:27 ..
-rw-rw-r-- 1 1000 1000 119 Feb 5 15:33 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 9 Feb 5 16:15 a.txt
-rw-r--r-- 1 root root 1541 Feb 5 16:27 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Feb 5 16:12 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2315125 Feb 5 16:41 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Feb 5 16:27 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 5 15:33 broken_tests.json
-rw-r--r-- 1 root root 9 Feb 5 16:15 b.txt
-rw-r--r-- 1 root root 9 Feb 5 16:15 c.txt
drwxr-x--- 4 root root 4096 Feb 5 16:07 data
drwxr-xr-x 14 root root 3860 Feb 5 15:36 dev
drwxr-xr-x 2 root root 4096 Feb 5 16:15 dir
-rwxr-xr-x 1 root root 0 Feb 5 15:36 .dockerenv
drwxr-xr-x 1 root root 4096 Feb 5 15:37 etc
drwxr-x--- 2 root root 4096 Feb 5 16:07 flags
drwxr-x--- 2 root root 4096 Feb 5 16:07 format_schemas
drwxr-xr-x 1 1000 1000 4096 Feb 5 15:37 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Feb 5 16:07 metadata
drwxr-x--- 2 root root 4096 Feb 5 16:07 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Feb 5 15:37 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Feb 5 15:36 package_folder
drwxr-x--- 2 root root 4096 Feb 5 16:15 preprocessed_configs
dr-xr-xr-x 316 root root 0 Feb 5 15:36 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Feb 5 15:40 queries_02352
-rw-r----- 1 root root 1 Feb 5 16:07 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Feb 5 16:07 roles.list
drwx------ 1 root root 4096 Feb 5 16:35 root
-rw-r----- 1 root root 1 Feb 5 16:07 row_policies.list
drwxr-xr-x 1 root root 4096 Feb 5 15:37 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Feb 5 15:37 script.gdb
-rw-r--r-- 1 root root 65505 Feb 5 16:18 server.log
-rw-r----- 1 root root 1 Feb 5 16:07 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 60 Feb 5 16:15 status
drwxr-x--- 4 root root 4096 Feb 5 16:07 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 5 15:36 sys
drwxrwxr-x 2 1000 1000 4096 Feb 5 15:37 test_output
drwxrwxrwt 1 root root 4096 Feb 5 16:41 tmp
drwxr-x--- 2 root root 4096 Feb 5 16:07 user_files
-rw-r----- 1 root root 1 Feb 5 16:12 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Feb 5 16:07 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2026-02-05 16:41:29,867 File /analyzer_tech_debt.txt with broken tests found
2026-02-05 16:41:29,868 File /broken_tests.json with broken tests found
2026-02-05 16:41:29,868 Broken tests in the list: 4
2026-02-05 16:41:29,869 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log
2026-02-05 16:41:29,922 Is flaky check: False
2026-02-05 16:41:29,922 Result parsed
2026-02-05 16:41:29,943 Result written
+ clickhouse-client -q 'system flush logs'
+ stop_logs_replication
+ echo 'Detach all logs replication'
Detach all logs replication
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Sent terminate signal to process with pid 624.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 624.
The process with pid = 624 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1512
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
API: SYSTEM.config
Time: 19:42:03 UTC 02/05/2026
DeploymentID: 7940cedd-c531-4f73-97d1-38d41e69cedb
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ zstd --threads=0
+ [[ -n '' ]]
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep SharedMergeTreePartCheckThread
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
+ rg -Fa ' received signal ' /test_output/gdb.log
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/database_02416.sql /var/lib/clickhouse/metadata/db1_03101.sql /var/lib/clickhouse/metadata/db2_03101.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_01048.sql /var/lib/clickhouse/metadata/test_avc7rvcs.sql /var/lib/clickhouse/metadata/test_gimi9dzc.sql /var/lib/clickhouse/metadata/test_h3263qz8_1.sql /var/lib/clickhouse/metadata/test_hg0x6lwl.sql /var/lib/clickhouse/metadata/test_iatcr85p_1.sql /var/lib/clickhouse/metadata/test_qn56enq4.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_vgch3pj8.sql /var/lib/clickhouse/metadata/test_xbillcdj_1.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ read -r core
+ find . -type f -maxdepth 1 -name 'core.*'