+ ln -s /usr/share/clickhouse-test/ci/stress.py /usr/bin/stress + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /stress_tests.lib ++ OK='\tOK\t\N\t' ++ FAIL='\tFAIL\t\N\t' ++ FAILURE_CONTEXT_LINES=100 ++ FAILURE_CONTEXT_MAX_LINE_WIDTH=300 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + install_packages package_folder + dpkg -i package_folder/clickhouse-common-static_24.8.14.10546.altinitytest+tsan_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48696 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10546.altinitytest+tsan_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10546.altinitytest+tsan) ... Setting up clickhouse-common-static (24.8.14.10546.altinitytest+tsan) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10546.altinitytest+tsan_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48723 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10546.altinitytest+tsan_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10546.altinitytest+tsan) ... Setting up clickhouse-common-static-dbg (24.8.14.10546.altinitytest+tsan) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10546.altinitytest+tsan_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48730 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10546.altinitytest+tsan_amd64.deb ... Unpacking clickhouse-server (24.8.14.10546.altinitytest+tsan) ... Setting up clickhouse-server (24.8.14.10546.altinitytest+tsan) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10546.altinitytest+tsan_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48747 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10546.altinitytest+tsan_amd64.deb ... Unpacking clickhouse-client (24.8.14.10546.altinitytest+tsan) ... Setting up clickhouse-client (24.8.14.10546.altinitytest+tsan) ... + export THREAD_FUZZER_CPU_TIME_PERIOD_US=1000 + THREAD_FUZZER_CPU_TIME_PERIOD_US=1000 + export THREAD_FUZZER_SLEEP_PROBABILITY=0.1 + THREAD_FUZZER_SLEEP_PROBABILITY=0.1 + export THREAD_FUZZER_SLEEP_TIME_US_MAX=100000 + THREAD_FUZZER_SLEEP_TIME_US_MAX=100000 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY=1 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY=1 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY=0.001 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY=0.001 + export THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX=10000 + THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX=10000 + export THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY=0.01 + THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY=0.01 + export THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY=0.01 + THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY=0.01 + export ZOOKEEPER_FAULT_INJECTION=1 + ZOOKEEPER_FAULT_INJECTION=1 + configure + export USE_DATABASE_ORDINARY=1 + USE_DATABASE_ORDINARY=1 + export EXPORT_S3_STORAGE_POLICIES=1 + EXPORT_S3_STORAGE_POLICIES=1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + rm -f /etc/clickhouse-server/config.d/zookeeper.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_fault_injection.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=0 + sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml + value=7794688 + sed --follow-symlinks -i 's|[[:digit:]]\+|7794688|' /etc/clickhouse-server/config.d/keeper_port.xml + value=10792960 + sed --follow-symlinks -i 's|[[:digit:]]\+|10792960|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/users.d/database_ordinary.xml /etc/clickhouse-server/users.d/ + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|100000|10000|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value filtered_list keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value multi_read keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value check_not_exists keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value create_if_not_exists keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + sudo chown clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + sudo chgrp clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value use_compression zookeeper_fault_injection + value=1 + sudo cat /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml.tmp /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + randomize_config_boolean_value enable_block_number_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + randomize_config_boolean_value enable_block_offset_column block_number + value=0 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + echo 'ASAN_OPTIONS='\''malloc_context_size=10 verbosity=1 allocator_release_to_os_interval_ms=10000'\''' + export 'ASAN_OPTIONS=malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + ASAN_OPTIONS='malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + sudo chown root: /var/lib/clickhouse + local total_mem ++ awk '/MemTotal/ { print $(NF-1) }' /proc/meminfo + total_mem=32080796 + total_mem=32850735104 + max_server_memory_usage_to_ram_ratio=0.5 Setting max_server_memory_usage_to_ram_ratio to 0.5 + echo 'Setting max_server_memory_usage_to_ram_ratio to 0.5' + cat + local max_users_mem + max_users_mem=9855220531 + echo 'Setting max_memory_usage_for_user=9855220531 and max_memory_usage for queries to 10G' + cat Setting max_memory_usage_for_user=9855220531 and max_memory_usage for queries to 10G + cat + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + ./minio server --address :11111 ./minio_data + curl --silent --verbose http://localhost:11111 + grep AccessDenied + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio Azurite Blob service is starting on 0.0.0.0:10000 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. Azurite Blob service successfully listens on http://0.0.0.0:10000 MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:46699 http://127.0.0.1:46699 Docs: https://min.io/docs/minio/linux/index.html + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./18ADA760095931457dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 281 root 8u IPv6 38993 0t0 TCP *:11111 (LISTEN) minio 281 root 9u IPv4 38992 0t0 TCP localhost:11111 (LISTEN) minio 281 root 10u IPv6 38994 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 101.35 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + export CLICKHOUSE_MAX_THREADS=8 + CLICKHOUSE_MAX_THREADS=8 + export CLICKHOUSE_MAX_CONCURRENT_QUERIES=4 + CLICKHOUSE_MAX_CONCURRENT_QUERIES=4 + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "PUT /devstoreaccount1/cont/tosnfiiknsgcaaixlpohrnofempstlwm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "GET /devstoreaccount1/cont/tosnfiiknsgcaaixlpohrnofempstlwm HTTP/1.1" 206 4 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "GET /devstoreaccount1/cont/tosnfiiknsgcaaixlpohrnofempstlwm HTTP/1.1" 206 2 127.0.0.1 - - [08/May/2026:17:31:09 +0000] "DELETE /devstoreaccount1/cont/tosnfiiknsgcaaixlpohrnofempstlwm HTTP/1.1" 202 - + counter=4 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 414 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + clickhouse-client --query 'CREATE DATABASE datasets' + clickhouse-client --multiquery + clickhouse-client --query 'SHOW TABLES FROM datasets' hits_v1 visits_v1 + clickhouse-client --query 'CREATE DATABASE IF NOT EXISTS test' + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=414 + clickhouse stop --max-tries 90 --do-not-kill /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Sent terminate signal to process with pid 414. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 414. The process with pid = 414 is running. Waiting for server to stop Now there is no clickhouse-server process. Server stopped + return + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.initial.log Using cache policy: SLRU + cache_policy= + '[' 1 -eq 1 ']' + cache_policy=SLRU + echo 'Using cache policy: SLRU' + '[' SLRU = SLRU ']' + sudo cat /etc/clickhouse-server/config.d/storage_conf.xml + sed 's|LRU|SLRU|' + mv /etc/clickhouse-server/config.d/storage_conf.xml.tmp /etc/clickhouse-server/config.d/storage_conf.xml + sudo cat /etc/clickhouse-server/users.d/stress_tests_overrides.xml cat: /etc/clickhouse-server/users.d/stress_tests_overrides.xml: No such file or directory + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' script.gdb:13: Error in sourced command file: No stack. Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [08/May/2026:17:31:41 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - 127.0.0.1 - - [08/May/2026:17:31:41 +0000] "PUT /devstoreaccount1/cont/cpzftztfpgrzzfgwjzhnwbfhdxzmgbgj HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:31:41 +0000] "GET /devstoreaccount1/cont/cpzftztfpgrzzfgwjzhnwbfhdxzmgbgj HTTP/1.1" 206 4 127.0.0.1 - - [08/May/2026:17:31:41 +0000] "GET /devstoreaccount1/cont/cpzftztfpgrzzfgwjzhnwbfhdxzmgbgj HTTP/1.1" 206 2 127.0.0.1 - - [08/May/2026:17:31:41 +0000] "DELETE /devstoreaccount1/cont/cpzftztfpgrzzfgwjzhnwbfhdxzmgbgj HTTP/1.1" 202 - + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 1270 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + clickhouse-client --query 'SHOW TABLES FROM datasets' hits_v1 visits_v1 + clickhouse-client --query 'SHOW TABLES FROM test' + [[ '' == \1 ]] + [[ '' == \1 ]] + TEMP_POLICY=default + clickhouse-client --query 'CREATE TABLE test.hits_s3 (WatchID UInt64, JavaEnable UInt8, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RegionID UInt32, UserID UInt64, CounterClass Int8, OS UInt8, UserAgent UInt8, URL String, Referer String, URLDomain String, RefererDomain String, Refresh UInt8, IsRobot UInt8, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), ResolutionWidth UInt16, ResolutionHeight UInt16, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, FlashMinor2 String, NetMajor UInt8, NetMinor UInt8, UserAgentMajor UInt16, UserAgentMinor FixedString(2), CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, MobilePhone UInt8, MobilePhoneModel String, Params String, IPNetworkID UInt32, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, IsArtifical UInt8, WindowClientWidth UInt16, WindowClientHeight UInt16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 UInt8, SilverlightVersion2 UInt8, SilverlightVersion3 UInt32, SilverlightVersion4 UInt16, PageCharset String, CodeVersion UInt32, IsLink UInt8, IsDownload UInt8, IsNotBounce UInt8, FUniqID UInt64, HID UInt32, IsOldCounter UInt8, IsEvent UInt8, IsParameter UInt8, DontCountHits UInt8, WithHash UInt8, HitColor FixedString(1), UTCEventTime DateTime, Age UInt8, Sex UInt8, Income UInt8, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), RemoteIP UInt32, RemoteIP6 FixedString(16), WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage FixedString(2), BrowserCountry FixedString(2), SocialNetwork String, SocialAction String, HTTPError UInt16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, RedirectTiming Int32, DOMInteractiveTiming Int32, DOMContentLoadedTiming Int32, DOMCompleteTiming Int32, LoadEventStartTiming Int32, LoadEventEndTiming Int32, NSToDOMContentLoadedTiming Int32, FirstPaintTiming Int32, RedirectCount Int8, SocialSourceNetworkID UInt8, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency FixedString(3), ParamCurrencyID UInt16, GoalsReached Array(UInt32), OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, RefererHash UInt64, URLHash UInt64, CLID UInt32, YCLID UInt64, ShareService String, ShareURL String, ShareTitle String, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), IslandID FixedString(16), RequestNum UInt32, RequestTry UInt8) ENGINE = MergeTree() PARTITION BY toYYYYMM(EventDate) ORDER BY (CounterID, EventDate, intHash32(UserID)) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'CREATE TABLE test.hits (WatchID UInt64, JavaEnable UInt8, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RegionID UInt32, UserID UInt64, CounterClass Int8, OS UInt8, UserAgent UInt8, URL String, Referer String, URLDomain String, RefererDomain String, Refresh UInt8, IsRobot UInt8, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), ResolutionWidth UInt16, ResolutionHeight UInt16, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, FlashMinor2 String, NetMajor UInt8, NetMinor UInt8, UserAgentMajor UInt16, UserAgentMinor FixedString(2), CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, MobilePhone UInt8, MobilePhoneModel String, Params String, IPNetworkID UInt32, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, IsArtifical UInt8, WindowClientWidth UInt16, WindowClientHeight UInt16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 UInt8, SilverlightVersion2 UInt8, SilverlightVersion3 UInt32, SilverlightVersion4 UInt16, PageCharset String, CodeVersion UInt32, IsLink UInt8, IsDownload UInt8, IsNotBounce UInt8, FUniqID UInt64, HID UInt32, IsOldCounter UInt8, IsEvent UInt8, IsParameter UInt8, DontCountHits UInt8, WithHash UInt8, HitColor FixedString(1), UTCEventTime DateTime, Age UInt8, Sex UInt8, Income UInt8, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), RemoteIP UInt32, RemoteIP6 FixedString(16), WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage FixedString(2), BrowserCountry FixedString(2), SocialNetwork String, SocialAction String, HTTPError UInt16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, RedirectTiming Int32, DOMInteractiveTiming Int32, DOMContentLoadedTiming Int32, DOMCompleteTiming Int32, LoadEventStartTiming Int32, LoadEventEndTiming Int32, NSToDOMContentLoadedTiming Int32, FirstPaintTiming Int32, RedirectCount Int8, SocialSourceNetworkID UInt8, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency FixedString(3), ParamCurrencyID UInt16, GoalsReached Array(UInt32), OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, RefererHash UInt64, URLHash UInt64, CLID UInt32, YCLID UInt64, ShareService String, ShareURL String, ShareTitle String, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), IslandID FixedString(16), RequestNum UInt32, RequestTry UInt8) ENGINE = MergeTree() PARTITION BY toYYYYMM(EventDate) ORDER BY (CounterID, EventDate, intHash32(UserID)) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'CREATE TABLE test.visits (CounterID UInt32, StartDate Date, Sign Int8, IsNew UInt8, VisitID UInt64, UserID UInt64, StartTime DateTime, Duration UInt32, UTCStartTime DateTime, PageViews Int32, Hits Int32, IsBounce UInt8, Referer String, StartURL String, RefererDomain String, StartURLDomain String, EndURL String, LinkURL String, IsDownload UInt8, TraficSourceID Int8, SearchEngineID UInt16, SearchPhrase String, AdvEngineID UInt8, PlaceID Int32, RefererCategories Array(UInt16), URLCategories Array(UInt16), URLRegions Array(UInt32), RefererRegions Array(UInt32), IsYandex UInt8, GoalReachesDepth Int32, GoalReachesURL Int32, GoalReachesAny Int32, SocialSourceNetworkID UInt8, SocialSourcePage String, MobilePhoneModel String, ClientEventTime DateTime, RegionID UInt32, ClientIP UInt32, ClientIP6 FixedString(16), RemoteIP UInt32, RemoteIP6 FixedString(16), IPNetworkID UInt32, SilverlightVersion3 UInt32, CodeVersion UInt32, ResolutionWidth UInt16, ResolutionHeight UInt16, UserAgentMajor UInt16, UserAgentMinor UInt16, WindowClientWidth UInt16, WindowClientHeight UInt16, SilverlightVersion2 UInt8, SilverlightVersion4 UInt16, FlashVersion3 UInt16, FlashVersion4 UInt16, ClientTimeZone Int16, OS UInt8, UserAgent UInt8, ResolutionDepth UInt8, FlashMajor UInt8, FlashMinor UInt8, NetMajor UInt8, NetMinor UInt8, MobilePhone UInt8, SilverlightVersion1 UInt8, Age UInt8, Sex UInt8, Income UInt8, JavaEnable UInt8, CookieEnable UInt8, JavascriptEnable UInt8, IsMobile UInt8, BrowserLanguage UInt16, BrowserCountry UInt16, Interests UInt16, Robotness UInt8, GeneralInterests Array(UInt16), Params Array(String), Goals Nested(ID UInt32, Serial UInt32, EventTime DateTime, Price Int64, OrderID String, CurrencyID UInt32), WatchIDs Array(UInt64), ParamSumPrice Int64, ParamCurrency FixedString(3), ParamCurrencyID UInt16, ClickLogID UInt64, ClickEventID Int32, ClickGoodEvent Int32, ClickEventTime DateTime, ClickPriorityID Int32, ClickPhraseID Int32, ClickPageID Int32, ClickPlaceID Int32, ClickTypeID Int32, ClickResourceID Int32, ClickCost UInt32, ClickClientIP UInt32, ClickDomainID UInt32, ClickURL String, ClickAttempt UInt8, ClickOrderID UInt32, ClickBannerID UInt32, ClickMarketCategoryID UInt32, ClickMarketPP UInt32, ClickMarketCategoryName String, ClickMarketPPName String, ClickAWAPSCampaignName String, ClickPageName String, ClickTargetType UInt16, ClickTargetPhraseID UInt64, ClickContextType UInt8, ClickSelectType Int8, ClickOptions String, ClickGroupBannerID Int32, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID UInt8, FirstVisit DateTime, PredLastVisit Date, LastVisit Date, TotalVisits UInt32, TraficSource Nested(ID Int8, SearchEngineID UInt16, AdvEngineID UInt8, PlaceID UInt16, SocialSourceNetworkID UInt8, Domain String, SearchPhrase String, SocialSourcePage String), Attendance FixedString(16), CLID UInt32, YCLID UInt64, NormalizedRefererHash UInt64, SearchPhraseHash UInt64, RefererDomainHash UInt64, NormalizedStartURLHash UInt64, StartURLDomainHash UInt64, NormalizedEndURLHash UInt64, TopLevelDomain UInt64, URLScheme UInt64, OpenstatServiceNameHash UInt64, OpenstatCampaignIDHash UInt64, OpenstatAdIDHash UInt64, OpenstatSourceIDHash UInt64, UTMSourceHash UInt64, UTMMediumHash UInt64, UTMCampaignHash UInt64, UTMContentHash UInt64, UTMTermHash UInt64, FromHash UInt64, WebVisorEnabled UInt8, WebVisorActivity UInt32, ParsedParams Nested(Key1 String, Key2 String, Key3 String, Key4 String, Key5 String, ValueDouble Float64), Market Nested(Type UInt8, GoalID UInt32, OrderID String, OrderPrice Int64, PP UInt32, DirectPlaceID UInt32, DirectOrderID UInt32, DirectBannerID UInt32, GoodID String, GoodName String, GoodQuantity Int32, GoodPrice Int64), IslandID FixedString(16)) ENGINE = CollapsingMergeTree(Sign) PARTITION BY toYYYYMM(StartDate) ORDER BY (CounterID, StartDate, intHash32(UserID), VisitID) SAMPLE BY intHash32(UserID) SETTINGS index_granularity = 8192, storage_policy='\''default'\''' + clickhouse-client --query 'INSERT INTO test.hits_s3 SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' Received exception from server (version 24.8.14): Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (for user) exceeded: would use 9.18 GiB (attempt to allocate chunk of 1130496 bytes), maximum: 9.18 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.: (while reading column FromTag): (while reading from part store/78e/78ebf6a1-d987-4579-b3ec-00c1a087b1f3/201403_1_1_2/ in table datasets.hits_v1 (78ebf6a1-d987-4579-b3ec-00c1a087b1f3) located on disk __tmp_internal_262634248876485800814430204900764312493 of type web, from mark 224 with max_rows_to_read = 8192): While executing MergeTreeSelect(pool: ReadPool, algorithm: Thread). (MEMORY_LIMIT_EXCEEDED) (query: INSERT INTO test.hits_s3 SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16) + clickhouse-client --query 'INSERT INTO test.hits SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' Received exception from server (version 24.8.14): Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (for user) exceeded: would use 9.18 GiB (attempt to allocate chunk of 1097728 bytes), maximum: 9.18 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.: (while reading column HID): (while reading from part store/78e/78ebf6a1-d987-4579-b3ec-00c1a087b1f3/201403_1_1_2/ in table datasets.hits_v1 (78ebf6a1-d987-4579-b3ec-00c1a087b1f3) located on disk __tmp_internal_262634248876485800814430204900764312493 of type web, from mark 700 with max_rows_to_read = 8192): While executing MergeTreeSelect(pool: ReadPool, algorithm: Thread). (MEMORY_LIMIT_EXCEEDED) (query: INSERT INTO test.hits SELECT * FROM datasets.hits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16) + clickhouse-client --query 'INSERT INTO test.visits SELECT * FROM datasets.visits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16' Received exception from server (version 24.8.14): Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 17.17 GiB (attempt to allocate chunk of 1572864 bytes), maximum: 15.30 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED) (query: INSERT INTO test.visits SELECT * FROM datasets.visits_v1 SETTINGS enable_filesystem_cache_on_write_operations=0, max_insert_threads=16) + clickhouse-client --query 'DROP TABLE datasets.visits_v1 SYNC' + clickhouse-client --query 'DROP TABLE datasets.hits_v1 SYNC' + clickhouse-client --query 'SHOW TABLES FROM test' hits hits_s3 visits + clickhouse-client --query 'SYSTEM STOP THREAD FUZZER' + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=1270 + clickhouse stop --max-tries 90 --do-not-kill script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Sent terminate signal to process with pid 1270. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 1270. The process with pid = 1270 is running. Waiting for server to stop Now there is no clickhouse-server process. Server stopped + return + export RANDOMIZE_OBJECT_KEY_TYPE=1 + RANDOMIZE_OBJECT_KEY_TYPE=1 + export ZOOKEEPER_FAULT_INJECTION=1 + ZOOKEEPER_FAULT_INJECTION=1 + export THREAD_POOL_FAULT_INJECTION=1 + THREAD_POOL_FAULT_INJECTION=1 + configure + export USE_DATABASE_ORDINARY=1 + USE_DATABASE_ORDINARY=1 + export EXPORT_S3_STORAGE_POLICIES=1 + EXPORT_S3_STORAGE_POLICIES=1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + rm -f /etc/clickhouse-server/config.d/zookeeper.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_fault_injection.xml /etc/clickhouse-server/config.d/ + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/cannot_allocate_thread_injection.xml /etc/clickhouse-server/config.d/ + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=43722752 + sed --follow-symlinks -i 's|[[:digit:]]\+|43722752|' /etc/clickhouse-server/config.d/keeper_port.xml + value=34990080 + sed --follow-symlinks -i 's|[[:digit:]]\+|34990080|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n 1 ]] + [[ 1 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/users.d/database_ordinary.xml /etc/clickhouse-server/users.d/ + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|100000|10000|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value filtered_list keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value multi_read keeper_port + value=1 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value check_not_exists keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + randomize_config_boolean_value create_if_not_exists keeper_port + value=0 + sudo cat /etc/clickhouse-server/config.d/keeper_port.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/keeper_port.xml.tmp /etc/clickhouse-server/config.d/keeper_port.xml + sudo chown clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + sudo chgrp clickhouse /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n 1 ]] + [[ 1 -eq 1 ]] + randomize_config_boolean_value use_compression zookeeper_fault_injection + value=0 + sudo cat /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + sed 's|[01]|0|' + sudo mv /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml.tmp /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + randomize_config_boolean_value enable_block_number_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + randomize_config_boolean_value enable_block_offset_column block_number + value=1 + sudo cat /etc/clickhouse-server/config.d/block_number.xml + sed 's|[01]|1|' + sudo mv /etc/clickhouse-server/config.d/block_number.xml.tmp /etc/clickhouse-server/config.d/block_number.xml + echo 'ASAN_OPTIONS='\''malloc_context_size=10 verbosity=1 allocator_release_to_os_interval_ms=10000'\''' + export 'ASAN_OPTIONS=malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + ASAN_OPTIONS='malloc_context_size=10 allocator_release_to_os_interval_ms=10000' + sudo chown root: /var/lib/clickhouse + local total_mem ++ awk '/MemTotal/ { print $(NF-1) }' /proc/meminfo + total_mem=32080796 + total_mem=32850735104 + max_server_memory_usage_to_ram_ratio=0.5 Setting max_server_memory_usage_to_ram_ratio to 0.5 + echo 'Setting max_server_memory_usage_to_ram_ratio to 0.5' + cat + local max_users_mem + max_users_mem=9855220531 + echo 'Setting max_memory_usage_for_user=9855220531 and max_memory_usage for queries to 10G' + cat Setting max_memory_usage_for_user=9855220531 and max_memory_usage for queries to 10G + cat + [[ '' == \1 ]] + [[ '' == \1 ]] + sudo cat /etc/clickhouse-server/config.d/logger_trace.xml + sed 's|trace|test|' + mv /etc/clickhouse-server/config.d/logger_trace.xml.tmp /etc/clickhouse-server/config.d/logger_trace.xml + '[' SLRU = SLRU ']' + sudo cat /etc/clickhouse-server/config.d/storage_conf.xml + sed 's|LRU|SLRU|' + mv /etc/clickhouse-server/config.d/storage_conf.xml.tmp /etc/clickhouse-server/config.d/storage_conf.xml ++ date +%-d + '[' 0 -eq 1 ']' + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [08/May/2026:17:35:51 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - 127.0.0.1 - - [08/May/2026:17:35:51 +0000] "PUT /devstoreaccount1/cont/gjsstlinswfadymocbnphvraxjqznxiy HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:35:51 +0000] "GET /devstoreaccount1/cont/gjsstlinswfadymocbnphvraxjqznxiy HTTP/1.1" 206 4 127.0.0.1 - - [08/May/2026:17:35:51 +0000] "GET /devstoreaccount1/cont/gjsstlinswfadymocbnphvraxjqznxiy HTTP/1.1" 206 2 127.0.0.1 - - [08/May/2026:17:35:51 +0000] "DELETE /devstoreaccount1/cont/gjsstlinswfadymocbnphvraxjqznxiy HTTP/1.1" 202 - + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 7 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=8 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 8 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=9 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: fault injected (threads=1, jobs=1). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=1 ++ sleep 5 ++ '[' 1 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 2637 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + stress --hung-check --drop-databases --output-folder test_output --skip-func-tests '' --global-time-limit 1200 2026-05-08 19:36:09,761 Run func tests '/usr/bin/clickhouse-test --client-option ignore_drop_queries_probability=0.5 enable_parallel_replicas=1 max_parallel_replicas=3 cluster_for_parallel_replicas='parallel_replicas' parallel_replicas_for_non_replicated_merge_tree=1 --global_time_limit=1200 ' 2026-05-08 19:36:10,263 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_1 --client-option join_use_nulls=1 join_algorithm='parallel_hash' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:10,765 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_2', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:11,266 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_3 --client-option join_algorithm='partial_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 ignore_drop_queries_probability=0.5 enable_parallel_replicas=1 max_parallel_replicas=3 cluster_for_parallel_replicas='parallel_replicas' parallel_replicas_for_non_replicated_merge_tree=1 --global_time_limit=1200 ' 2026-05-08 19:36:11,767 Run func tests '/usr/bin/clickhouse-test --order=random --client-option join_use_nulls=1 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:12,269 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_5', 's1', 'r1')" --database=test_5 --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 join_algorithm='full_sorting_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:12,770 Run func tests '/usr/bin/clickhouse-test --order=random --client-option use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:13,272 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_7 --client-option join_use_nulls=1 join_algorithm='grace_hash' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 http_make_head_request=0 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:13,773 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_8', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:14,274 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_9 --client-option join_algorithm='auto' max_rows_in_join=1000 group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:14,776 Run func tests '/usr/bin/clickhouse-test --order=random --client-option join_use_nulls=1 use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:15,277 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_11', 's1', 'r1')" --database=test_11 --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 join_algorithm='parallel_hash' memory_tracker_fault_probability=0.001 merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability=0.05 group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:15,779 Run func tests '/usr/bin/clickhouse-test --order=random --client-option implicit_transaction=1 throw_on_unsupported_query_inside_transaction=0 ignore_drop_queries_probability=0.5 enable_parallel_replicas=1 max_parallel_replicas=3 cluster_for_parallel_replicas='parallel_replicas' parallel_replicas_for_non_replicated_merge_tree=1 --global_time_limit=1200 ' 2026-05-08 19:36:16,280 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_13 --client-option join_use_nulls=1 join_algorithm='partial_merge' use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' group_by_use_nulls=1 http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:16,782 Run func tests '/usr/bin/clickhouse-test --order=random --db-engine="Replicated('/test/db/test_14', 's1', 'r1')" --client-option enable_deflate_qpl_codec=1 enable_zstd_qat_codec=1 use_query_cache=1 query_cache_nondeterministic_function_handling='ignore' query_cache_system_table_handling='ignore' http_make_head_request=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:17,283 Run func tests '/usr/bin/clickhouse-test --order=random --database=test_15 --client-option join_algorithm='full_sorting_merge' group_by_use_nulls=1 ignore_drop_queries_probability=0.5 --global_time_limit=1200 ' 2026-05-08 19:36:17,784 Will wait functests to finish 2026-05-08 19:36:17,784 Finished 6 from 16 processes 2026-05-08 19:36:22,787 Finished 6 from 16 processes 2026-05-08 19:36:27,791 Finished 6 from 16 processes 2026-05-08 19:36:32,795 Finished 6 from 16 processes 2026-05-08 19:36:37,799 Finished 7 from 16 processes 2026-05-08 19:36:42,803 Finished 9 from 16 processes 2026-05-08 19:36:47,807 Finished 10 from 16 processes 2026-05-08 19:36:52,811 Finished 10 from 16 processes 2026-05-08 19:36:57,815 Finished 10 from 16 processes 2026-05-08 19:37:02,819 Finished 10 from 16 processes 2026-05-08 19:37:07,823 Finished 10 from 16 processes 2026-05-08 19:37:12,827 Finished 10 from 16 processes 2026-05-08 19:37:17,831 Finished 10 from 16 processes 2026-05-08 19:37:22,836 Finished 10 from 16 processes 2026-05-08 19:37:27,839 Finished 10 from 16 processes 2026-05-08 19:37:32,844 Finished 10 from 16 processes 2026-05-08 19:37:37,846 Finished 10 from 16 processes 2026-05-08 19:37:42,851 Finished 10 from 16 processes 2026-05-08 19:37:47,855 Finished 10 from 16 processes 2026-05-08 19:37:52,859 Finished 10 from 16 processes 2026-05-08 19:37:57,862 Finished 10 from 16 processes 2026-05-08 19:38:02,867 Finished 10 from 16 processes 2026-05-08 19:38:07,871 Finished 10 from 16 processes 2026-05-08 19:38:12,875 Finished 10 from 16 processes 2026-05-08 19:38:17,879 Finished 10 from 16 processes 2026-05-08 19:38:22,883 Finished 10 from 16 processes 2026-05-08 19:38:27,888 Finished 10 from 16 processes 2026-05-08 19:38:32,891 Finished 10 from 16 processes 2026-05-08 19:38:37,895 Finished 10 from 16 processes 2026-05-08 19:38:42,900 Finished 10 from 16 processes 2026-05-08 19:38:47,903 Finished 10 from 16 processes 2026-05-08 19:38:52,907 Finished 10 from 16 processes 2026-05-08 19:38:57,911 Finished 10 from 16 processes 2026-05-08 19:39:02,916 Finished 10 from 16 processes 2026-05-08 19:39:07,917 Finished 10 from 16 processes 2026-05-08 19:39:12,919 Finished 10 from 16 processes 2026-05-08 19:39:17,923 Finished 10 from 16 processes 2026-05-08 19:39:22,927 Finished 10 from 16 processes 2026-05-08 19:39:27,931 Finished 10 from 16 processes 2026-05-08 19:39:32,935 Finished 10 from 16 processes 2026-05-08 19:39:37,939 Finished 10 from 16 processes 2026-05-08 19:39:42,943 Finished 10 from 16 processes 2026-05-08 19:39:47,947 Finished 10 from 16 processes 2026-05-08 19:39:52,952 Finished 10 from 16 processes 2026-05-08 19:39:57,955 Finished 10 from 16 processes 2026-05-08 19:40:02,960 Finished 10 from 16 processes 2026-05-08 19:40:07,963 Finished 10 from 16 processes 2026-05-08 19:40:12,967 Finished 10 from 16 processes 2026-05-08 19:40:17,971 Finished 10 from 16 processes 2026-05-08 19:40:22,975 Finished 10 from 16 processes 2026-05-08 19:40:27,979 Finished 10 from 16 processes 2026-05-08 19:40:32,984 Finished 10 from 16 processes 2026-05-08 19:40:37,987 Finished 10 from 16 processes 2026-05-08 19:40:42,992 Finished 10 from 16 processes 2026-05-08 19:40:47,995 Finished 10 from 16 processes 2026-05-08 19:40:52,999 Finished 10 from 16 processes 2026-05-08 19:40:58,003 Finished 10 from 16 processes 2026-05-08 19:41:03,008 Finished 10 from 16 processes 2026-05-08 19:41:08,010 Finished 10 from 16 processes 2026-05-08 19:41:13,011 Finished 10 from 16 processes 2026-05-08 19:41:18,015 Finished 10 from 16 processes 2026-05-08 19:41:23,019 Finished 10 from 16 processes 2026-05-08 19:41:28,021 Finished 10 from 16 processes 2026-05-08 19:41:33,024 Finished 10 from 16 processes 2026-05-08 19:41:38,029 Finished 10 from 16 processes 2026-05-08 19:41:43,030 Finished 10 from 16 processes 2026-05-08 19:41:48,036 Finished 10 from 16 processes 2026-05-08 19:41:53,038 Finished 10 from 16 processes 2026-05-08 19:41:58,043 Finished 10 from 16 processes 2026-05-08 19:42:03,047 Finished 10 from 16 processes 2026-05-08 19:42:08,051 Finished 10 from 16 processes 2026-05-08 19:42:13,056 Finished 10 from 16 processes 2026-05-08 19:42:18,059 Finished 10 from 16 processes 2026-05-08 19:42:23,063 Finished 10 from 16 processes 2026-05-08 19:42:28,067 Finished 10 from 16 processes 2026-05-08 19:42:33,071 Finished 10 from 16 processes 2026-05-08 19:42:38,075 Finished 10 from 16 processes 2026-05-08 19:42:43,079 Finished 10 from 16 processes 2026-05-08 19:42:48,083 Finished 10 from 16 processes 2026-05-08 19:42:53,087 Finished 10 from 16 processes 2026-05-08 19:42:58,092 Finished 10 from 16 processes 2026-05-08 19:43:03,095 Finished 10 from 16 processes 2026-05-08 19:43:08,095 Finished 10 from 16 processes 2026-05-08 19:43:13,099 Finished 10 from 16 processes 2026-05-08 19:43:18,103 Finished 10 from 16 processes 2026-05-08 19:43:23,107 Finished 10 from 16 processes 2026-05-08 19:43:28,111 Finished 10 from 16 processes 2026-05-08 19:43:33,115 Finished 10 from 16 processes 2026-05-08 19:43:38,119 Finished 10 from 16 processes 2026-05-08 19:43:43,123 Finished 10 from 16 processes 2026-05-08 19:43:48,126 Finished 10 from 16 processes 2026-05-08 19:43:53,131 Finished 10 from 16 processes 2026-05-08 19:43:58,135 Finished 10 from 16 processes 2026-05-08 19:44:03,140 Finished 10 from 16 processes 2026-05-08 19:44:08,144 Finished 10 from 16 processes 2026-05-08 19:44:13,147 Finished 10 from 16 processes 2026-05-08 19:44:18,151 Finished 10 from 16 processes 2026-05-08 19:44:23,153 Finished 10 from 16 processes 2026-05-08 19:44:28,155 Finished 10 from 16 processes 2026-05-08 19:44:33,159 Finished 10 from 16 processes 2026-05-08 19:44:38,163 Finished 10 from 16 processes 2026-05-08 19:44:43,168 Finished 10 from 16 processes 2026-05-08 19:44:48,173 Finished 10 from 16 processes 2026-05-08 19:44:53,175 Finished 10 from 16 processes 2026-05-08 19:44:58,179 Finished 10 from 16 processes 2026-05-08 19:45:03,183 Finished 10 from 16 processes 2026-05-08 19:45:08,187 Finished 10 from 16 processes 2026-05-08 19:45:13,192 Finished 10 from 16 processes 2026-05-08 19:45:18,195 Finished 10 from 16 processes 2026-05-08 19:45:23,199 Finished 10 from 16 processes 2026-05-08 19:45:28,204 Finished 10 from 16 processes 2026-05-08 19:45:33,207 Finished 10 from 16 processes 2026-05-08 19:45:38,213 Finished 10 from 16 processes 2026-05-08 19:45:43,215 Finished 10 from 16 processes 2026-05-08 19:45:48,220 Finished 10 from 16 processes 2026-05-08 19:45:53,226 Finished 10 from 16 processes 2026-05-08 19:45:58,231 Finished 10 from 16 processes 2026-05-08 19:46:03,235 Finished 10 from 16 processes 2026-05-08 19:46:08,240 Finished 10 from 16 processes 2026-05-08 19:46:13,245 Finished 10 from 16 processes 2026-05-08 19:46:18,248 Finished 10 from 16 processes 2026-05-08 19:46:23,253 Finished 10 from 16 processes 2026-05-08 19:46:28,254 Finished 10 from 16 processes 2026-05-08 19:46:33,259 Finished 10 from 16 processes 2026-05-08 19:46:38,263 Finished 10 from 16 processes 2026-05-08 19:46:43,267 Finished 10 from 16 processes 2026-05-08 19:46:48,272 Finished 10 from 16 processes 2026-05-08 19:46:53,275 Finished 10 from 16 processes 2026-05-08 19:46:58,275 Finished 10 from 16 processes 2026-05-08 19:47:03,279 Finished 11 from 16 processes 2026-05-08 19:47:08,284 Finished 11 from 16 processes 2026-05-08 19:47:13,290 Finished 11 from 16 processes 2026-05-08 19:47:18,295 Finished 11 from 16 processes 2026-05-08 19:47:23,299 Finished 12 from 16 processes 2026-05-08 19:47:28,303 Finished 12 from 16 processes 2026-05-08 19:47:33,308 Finished 12 from 16 processes 2026-05-08 19:47:38,313 Finished 12 from 16 processes 2026-05-08 19:47:43,319 Finished 12 from 16 processes 2026-05-08 19:47:48,323 Finished 12 from 16 processes 2026-05-08 19:47:53,328 Finished 12 from 16 processes 2026-05-08 19:47:58,333 Finished 12 from 16 processes 2026-05-08 19:48:03,339 Finished 12 from 16 processes 2026-05-08 19:48:08,342 Finished 12 from 16 processes 2026-05-08 19:48:13,343 Finished 12 from 16 processes 2026-05-08 19:48:18,347 Finished 12 from 16 processes 2026-05-08 19:48:23,352 Finished 12 from 16 processes 2026-05-08 19:48:28,355 Finished 12 from 16 processes 2026-05-08 19:48:33,360 Finished 12 from 16 processes 2026-05-08 19:48:38,363 Finished 12 from 16 processes 2026-05-08 19:48:43,368 Finished 12 from 16 processes 2026-05-08 19:48:48,371 Finished 12 from 16 processes 2026-05-08 19:48:53,376 Finished 12 from 16 processes 2026-05-08 19:48:58,381 Finished 12 from 16 processes 2026-05-08 19:49:03,387 Finished 12 from 16 processes 2026-05-08 19:49:08,392 Finished 12 from 16 processes 2026-05-08 19:49:13,396 Finished 12 from 16 processes 2026-05-08 19:49:18,401 Finished 12 from 16 processes 2026-05-08 19:49:23,403 Finished 12 from 16 processes 2026-05-08 19:49:28,407 Finished 12 from 16 processes 2026-05-08 19:49:33,411 Finished 12 from 16 processes 2026-05-08 19:49:38,415 Finished 12 from 16 processes 2026-05-08 19:49:43,420 Finished 12 from 16 processes 2026-05-08 19:49:48,423 Finished 12 from 16 processes 2026-05-08 19:49:53,427 Finished 12 from 16 processes 2026-05-08 19:49:58,432 Finished 12 from 16 processes 2026-05-08 19:50:03,435 Finished 12 from 16 processes 2026-05-08 19:50:08,438 Finished 12 from 16 processes 2026-05-08 19:50:13,443 Finished 12 from 16 processes 2026-05-08 19:50:18,447 Finished 12 from 16 processes 2026-05-08 19:50:23,452 Finished 12 from 16 processes 2026-05-08 19:50:28,452 Finished 12 from 16 processes 2026-05-08 19:50:33,455 Finished 12 from 16 processes 2026-05-08 19:50:38,460 Finished 12 from 16 processes 2026-05-08 19:50:43,465 Finished 12 from 16 processes 2026-05-08 19:50:48,469 Finished 12 from 16 processes 2026-05-08 19:50:53,474 Finished 12 from 16 processes 2026-05-08 19:50:58,477 Finished 12 from 16 processes 2026-05-08 19:51:03,482 Finished 12 from 16 processes 2026-05-08 19:51:08,488 Finished 12 from 16 processes 2026-05-08 19:51:13,493 Finished 12 from 16 processes 2026-05-08 19:51:18,495 Finished 12 from 16 processes 2026-05-08 19:51:23,497 Finished 12 from 16 processes 2026-05-08 19:51:28,500 Finished 12 from 16 processes 2026-05-08 19:51:33,505 Finished 12 from 16 processes 2026-05-08 19:51:38,508 Finished 12 from 16 processes 2026-05-08 19:51:43,509 Finished 12 from 16 processes 2026-05-08 19:51:48,511 Finished 12 from 16 processes 2026-05-08 19:51:53,516 Finished 12 from 16 processes 2026-05-08 19:51:58,519 Finished 12 from 16 processes 2026-05-08 19:52:03,523 Finished 12 from 16 processes 2026-05-08 19:52:08,528 Finished 12 from 16 processes 2026-05-08 19:52:13,528 Finished 12 from 16 processes 2026-05-08 19:52:18,531 Finished 12 from 16 processes 2026-05-08 19:52:23,535 Finished 12 from 16 processes 2026-05-08 19:52:28,540 Finished 12 from 16 processes 2026-05-08 19:52:33,543 Finished 12 from 16 processes 2026-05-08 19:52:38,547 Finished 12 from 16 processes 2026-05-08 19:52:43,551 Finished 12 from 16 processes 2026-05-08 19:52:48,556 Finished 12 from 16 processes 2026-05-08 19:52:53,561 Finished 12 from 16 processes 2026-05-08 19:52:58,567 Finished 12 from 16 processes 2026-05-08 19:53:03,572 Finished 12 from 16 processes 2026-05-08 19:53:08,577 Finished 12 from 16 processes 2026-05-08 19:53:13,583 Finished 12 from 16 processes 2026-05-08 19:53:18,588 Finished 12 from 16 processes 2026-05-08 19:53:23,591 Finished 12 from 16 processes 2026-05-08 19:53:28,595 Finished 12 from 16 processes 2026-05-08 19:53:33,599 Finished 12 from 16 processes 2026-05-08 19:53:38,604 Finished 12 from 16 processes 2026-05-08 19:53:43,609 Finished 12 from 16 processes 2026-05-08 19:53:48,611 Finished 12 from 16 processes 2026-05-08 19:53:53,615 Finished 12 from 16 processes 2026-05-08 19:53:58,619 Finished 12 from 16 processes 2026-05-08 19:54:03,623 Finished 12 from 16 processes 2026-05-08 19:54:08,627 Finished 12 from 16 processes 2026-05-08 19:54:13,632 Finished 12 from 16 processes 2026-05-08 19:54:18,635 Finished 12 from 16 processes 2026-05-08 19:54:23,639 Finished 12 from 16 processes 2026-05-08 19:54:28,643 Finished 12 from 16 processes 2026-05-08 19:54:33,647 Finished 12 from 16 processes 2026-05-08 19:54:38,651 Finished 12 from 16 processes 2026-05-08 19:54:43,655 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:54:48 +0000] "PUT /devstoreaccount1/cont/ojbmidxtebphfdypmbtbsnwvsclhxron HTTP/1.1" 201 - 2026-05-08 19:54:48,659 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/bikiocyfoslfthcjlymdkzoeyxukydgh HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/jbozojpaugsxhgkeejamwolwjlozelmo HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/vmoiuahimkfzeesftdsdjpadlupegrkn HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/wtrngdkphwmgnwjbihrzayzifiuktvjs HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/rlaoacdwgkaydkjoetstafyfunkgetky HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/fqcrfkdvsstpetcrpmmsynykbpljnynj HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/rthqffymizwrxfopoifrdgazxjffyyei HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:50 +0000] "PUT /devstoreaccount1/cont/ugqofnngohlhzdwzenrwatdeyrncodtc HTTP/1.1" 201 - 2026-05-08 19:54:53,663 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/qvlzgdltymuhemuvusxicvqamkcwnupv HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/gybgesitohsqetcyvbvtsrqhszndogfc HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/idlwicztcrvbtafibwurvrlaunuweung HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/dxwgdazcchbpljjuwxmuhpgqdxjhbokt HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/fkpgfvkqeguaxqfvzssmzpbaougxmste HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/snjqtokcqyxlwaukwnjpdqgyefnxfuga HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/ioiolrtjrwcutblhbdrwkkpszzxdpecq HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:55 +0000] "PUT /devstoreaccount1/cont/mtlhretbyqlmumozhlxjmelonumurzhb HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/znxdqkylrbappuseuoltzvjkyfipewso HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/fuvkigcxgslymgzfxfwuuynaevnjbpwl HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/agtxtdesxvskwfmetvljclhsipyhebtd HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/crjxmgyvexqezmtbzqmzvmncygjcyhtl HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/cgjpwmcnsyoieamcullbuxdnxhmbamtz HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/fjfevirgppxsghyyadylcettinvuzume HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/deghmrozkgeetszefhegnmihuivjrlfy HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:56 +0000] "PUT /devstoreaccount1/cont/hmayjlhadzjlzbiwvrjatezpjoatlzwu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/adhhxxpvohwlqzwebchzsztdiybssxos HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/batnfhjynqzuthqbillgafiwxvhmqqsb HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/xlzpcpkekjrjzhpusjutpbuqhzwlqxyp HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/yyjptpgzfahzzvlvrfhrhgjhmbgbrdtv HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/tjwkiyxfuynofumkwteegwvzyvlenrua HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/gorvacmqctnersqhlrnvivbqcymvgzix HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/gfghjnqkopuutwflmsdshtjvkolspidt HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:57 +0000] "PUT /devstoreaccount1/cont/owmkyauusfvaslcuwlyuphfkhmtvfftz HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/cjmrorzgfluytlqgsgaxhmgpekvukcfn HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/udexpgxrenmxftqqijhtzakvllquiqad HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/ymtdtgtdhblrbaztazdyqhvrdyytkkzc HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/jffkzmylulrjoiytrhraxuybnwfjbytm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/vezascmyqqcaidyycdxssvzwpokpxvgu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/dswidnisfkvxtxlurggixwevmxbealdw HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/iupqvxnxffylyvwauubrahqnsejjhqqc HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:58 +0000] "PUT /devstoreaccount1/cont/gsvmdwozdkcrlewreitvjmfjtcmlbmdc HTTP/1.1" 201 - 2026-05-08 19:54:58,667 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "GET /devstoreaccount1/cont/fuvkigcxgslymgzfxfwuuynaevnjbpwl HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "GET /devstoreaccount1/cont/bikiocyfoslfthcjlymdkzoeyxukydgh HTTP/1.1" 206 746 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "GET /devstoreaccount1/cont/znxdqkylrbappuseuoltzvjkyfipewso HTTP/1.1" 206 746 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/fbdvuwhiaxsndnxgqycjitjpgnldtgqm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/esjpvyaidlmbljibkieiiqilxqjzmdco HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/yndqrydldnyfimmxbmjyggmhjfwefvgp HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/kyzzhqxyuhhiyydanremknlqysdyufjb HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/tbzknqaftyfpgpavhdewnarbpzgfnxxj HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/qgkpmjohgtjtenebdyoibeidbojfnbel HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/cjmthlawsvrdodihnazoroseuoqpcwel HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:54:59 +0000] "PUT /devstoreaccount1/cont/bouljrgxsoizmsllfenwimadcddkewfe HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/rcwfmqohogatcjvsqfytnerixoodurob HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/oclempoqabyivxeewgnrcgrrmaulrlhv HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/igboreahtxxfnqzuhvstyeuoatfsebwk HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/zjtnzglyfbxfnoplkcnkriacumxegcvr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/pkyqvhzqopzirvhvssgkpyihosbxcnrl HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/oekyprhbbguirruhmcomcwdlhpmpvvlu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/nqzekxljgvoinrbbhwqqnhtuitdsnsma HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/upwppkupjzjhbitlwccqgmipeerdfzrt HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:00 +0000] "PUT /devstoreaccount1/cont/cnqekvqybxazskpgjhanimdqlgmazgca HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/aenwtjosfxjxogxvknhkajscfvheojbr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/clxhoxlmnmlvgaorqiwgjgwaqidjihch HTTP/1.1" 201 - 2026-05-08 19:55:03,672 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/ubmafkzqndaqpdmxnccdxnqxsxuaxary HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/blrclmnmhcolxwztxknsvibhwthvkebw HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/nuchdiqluocrmmtijxzjaneesaiimzlx HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/gfsbzzuaaebbhauqnwnzlxmxrienfnth HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/baqqjwyprwikjaetfgpihjecbbzdfvcg HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/pcfbcssjghgynuilzjwkieydppyayobm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/pwdklsqkppaikqskoqnvdgxyksukefwf HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:03 +0000] "PUT /devstoreaccount1/cont/qhznsndiqrumklqdaomtgbakshmldsft HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/rqtdcudpubsbieydshuadvfwaorlafjm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/tddkvqambmqwwlljggztdceclkunnqcu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/yxsvwlxosqvwkfnkoapzlwcfazzxtrrf HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/bjlbvltxrpolizdubnvkdzvvrqjwsjdd HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/bvheztxbltsttejmhqircmbnabkbmhkt HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/ddlwluoemdmwoyuuxpwpsoyxsrlatsqf HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/duyfthncejaozfkkcjjbeojegverytwx HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/rfoyzcblyovschvqipbdsoleosfsceer HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/kozhyhrxdtwibqtrtinlrwweuabtdvqg HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:06 +0000] "PUT /devstoreaccount1/cont/kgnjwcbzhbtmcjvtdbrtklpdwpybqvyt HTTP/1.1" 201 - 2026-05-08 19:55:08,677 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/nhtqkfenvhxgqopwllenxrbvjcqanjna HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/wdtptjlflciokntwmooomfjxlboerisp HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/qeplyskgniwznmllgdobpkrkrdanjnpn HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/qbpwibuhsobfasykyhnrcvjphggviyjw HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/quulvxjgdeixxeoxvvwlepnkilzmhaph HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/eatsvtalpisydqneiinnnvalwfncfcjn HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/nayjbwhswhhifmkooknqeattcydxevdh HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/ceoxhsdunhndseqcqgrrshajvflhvnnk HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/wiynsiarkhhhbtswxaahndiqlktkfycz HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:09 +0000] "PUT /devstoreaccount1/cont/lppvmoxppwblsotmpqianhquykmbpylr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/obnwiksthhojakfzhuvseaxhfcdunrtb HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/nnwztncwbxlwjvyyzjzbtsgnrtufimvr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/davyzqwwgggjqzuxfeummkcmxyfibnzh HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/ubsemccrhkiqbiudurhxsibncbpbweci HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/xklyvmkcobymqmxzwvqtlntlidwejgks HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/irkuanynezyfjvoqobaslgpthaljgxvq HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/mbnadjrdzbhxtzydjllvfalebezzfpvd HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/yhytapyktthysynqftfqdrtfbndrtybq HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/vsegfkyuqjblmptbxfzppyekzdnbcuzm HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:12 +0000] "PUT /devstoreaccount1/cont/ewdkpmbgwpeyfonpaffyydvucblqqrjc HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/votmlcrgfsjfvqauecykirgybevaymoz HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/woeesbcxnlmsunjcznjcwwbvmdwtnhrh HTTP/1.1" 201 - 2026-05-08 19:55:13,679 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/vqohcndbfrljyjpyfsimtentwnwkywhd HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/djhvvbzfxrhqjshgiitiwbktgmixcshb HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/popididmtmelndpeuybxdkeetwyuhjnu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/vzvaqaoogabvirqidrobkjhwheglodde HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/qrhzgtgptofkyuwbpppkgevpyuxtexql HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/zrijjzqfruwtzcwupkixjxkhdwdilcqr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/csxbocxqlfgbxmsefxotaaprbctjuuhu HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:13 +0000] "PUT /devstoreaccount1/cont/oihvnhlccuucekfucluydetezxolfntv HTTP/1.1" 201 - 2026-05-08 19:55:18,683 Finished 12 from 16 processes 2026-05-08 19:55:23,687 Finished 12 from 16 processes 2026-05-08 19:55:28,691 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/siqcpvfamktmildxvavvwpgxjtjljsgk HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/rrrimtwqozloqprulxqqbcdxmuzaapon HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/izhaesgfrchxdjqxsjpovrnpysbcgyxk HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/sudosmirfqmvmxgouwnemygaigibptcr HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/nmeolsmgozzzkktbrpohofkmbyvhrnip HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:33 +0000] "PUT /devstoreaccount1/cont/refbdetwbajkwxwvtoudsdaiwynugvwu HTTP/1.1" 201 - 2026-05-08 19:55:33,695 Finished 12 from 16 processes 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/nodsqujpjhbbuwxufpqnkwqhrtcfoccx HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/hjtrixrpxolpezcrqlkjfpednlryypjd HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/yxlnuqvvrmdseucznigctdzotiypsopt HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/aktitskcurmdoylyihfmyaeclzmoeiws HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/cjyvpvuiahrawwqejqivmavkpeurjbbq HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/mrmxsspemybucqcgcumuzzhiqlmhtaej HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/qvfrdwfwaynmmswutgosrspjevhdgtha HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:55:34 +0000] "PUT /devstoreaccount1/cont/rzsrbbeqgedmtnjtvdckspnuwemjbyuf HTTP/1.1" 201 - 2026-05-08 19:55:38,700 Finished 12 from 16 processes 2026-05-08 19:55:43,706 Finished 12 from 16 processes 2026-05-08 19:55:48,711 Finished 12 from 16 processes 2026-05-08 19:55:53,716 Finished 12 from 16 processes 2026-05-08 19:55:58,719 Finished 12 from 16 processes 2026-05-08 19:56:03,724 Finished 12 from 16 processes 2026-05-08 19:56:08,728 Finished 12 from 16 processes 2026-05-08 19:56:13,731 Finished 12 from 16 processes 2026-05-08 19:56:18,735 Finished 12 from 16 processes 2026-05-08 19:56:23,737 Finished 14 from 16 processes 2026-05-08 19:56:28,739 Finished 14 from 16 processes 2026-05-08 19:56:33,743 Finished 14 from 16 processes 2026-05-08 19:56:38,745 Finished 15 from 16 processes 2026-05-08 19:56:43,746 Finished 15 from 16 processes 2026-05-08 19:56:48,751 Finished 15 from 16 processes 2026-05-08 19:56:53,755 Finished 15 from 16 processes 2026-05-08 19:56:58,757 Finished 15 from 16 processes 2026-05-08 19:57:03,762 Finished 15 from 16 processes 2026-05-08 19:57:08,768 All processes finished 2026-05-08 19:57:08,768 Compressing stress logs 2026-05-08 19:57:08,811 Logs compressed 2026-05-08 19:57:08,811 Will terminate gdb (if any) 2026-05-08 19:57:08,811 Running command: kill -TERM $(pidof gdb) 2026-05-08 19:57:08,819 Running command: timeout 50s tail --pid=$(pidof gdb) -f /dev/null || kill -9 $(pidof gdb) ||: 2026-05-08 19:57:09,836 Running command: kill -CONT $(cat /var/run/clickhouse-server/clickhouse-server.pid) && clickhouse client -q 'SELECT 1 FORMAT Null' 2026-05-08 19:57:10,352 Running command: clickhouse client -q "SYSTEM STOP THREAD FUZZER" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:10,668 Running command: clickhouse client -q "SYSTEM START MERGES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:10,933 Running command: clickhouse client -q "SYSTEM START DISTRIBUTED SENDS" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:11,198 Running command: clickhouse client -q "SYSTEM START TTL MERGES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:11,463 Running command: clickhouse client -q "SYSTEM START MOVES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:11,678 Running command: clickhouse client -q "SYSTEM START FETCHES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:11,943 Running command: clickhouse client -q "SYSTEM START REPLICATED SENDS" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:12,208 Running command: clickhouse client -q "SYSTEM START REPLICATION QUEUES" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:12,473 Running command: clickhouse client -q "SYSTEM DROP MARK CACHE" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:12,739 Running command: clickhouse client -q "KILL QUERY WHERE upper(query) LIKE 'WATCH %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:13,004 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'insert into tableB select %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:13,269 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'SELECT URL, uniq(SearchPhrase) AS u FROM test.hits GROUP BY URL ORDER BY u %'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 2026-05-08 19:57:13,534 Running command: clickhouse client -q "KILL QUERY WHERE query LIKE 'SELECT (SELECT number FROM system.numbers WHERE number = 1000000000000)%'" --max_untracked_memory=1Gi --memory_profiler_step=1Gi --max_memory_usage_for_user=0 --max_memory_usage_in_client=1000000000 Received exception from server (version 24.8.14): Code: 159. DB::Exception: Received from localhost:9000. DB::Exception: Timeout exceeded: elapsed 60.050339305 seconds, maximum: 60. (TIMEOUT_EXCEEDED) (query: SELECT sleepEachRow(( SELECT maxOrDefault(300 - elapsed) + 1 FROM system.processes WHERE query NOT LIKE '%FROM system.processes%' AND elapsed < 300 ) / 300) FROM numbers(300) FORMAT Null SETTINGS function_sleep_max_microseconds_per_block = 0 ) 2026-05-08 19:58:15,040 Checking if some queries hung Using queries from '/usr/share/clickhouse-test/queries' directory Connecting to ClickHouse server... OK Connected to server 24.8.14.10546.altinitytest @ 2066b28944d33461f26e5a27053060c4d5f0613b HEAD Running 1 stateless tests (MainProcess). 00001_select_1: [ OK ] 1 tests passed. 0 tests skipped. 0.43 s elapsed (MainProcess). Won't run stateful tests because test data wasn't loaded. Checking the hung queries: done No queries hung. All tests have finished. Top patterns of log messages: count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 1. 13459 0.047 603.11 KiB 0.009 1 3 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2. 12815 0.045 1.30 MiB 0.021 1 77 ['Trace'] 0.19 Checking existence of path: {} 3. 11952 0.042 509.19 KiB 0.008 1 82 ['Trace'] 1 is disk {} eligible for search: {} 4. 11319 0.04 1.69 MiB 0.027 4318 62 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 5. 10612 0.037 2.18 MiB 0.035 1 63 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 6. 10280 0.036 290.06 KiB 0.005 1 62 ['Debug'] 0.069 Processed in {} sec. 7. 10042 0.035 26.52 MiB 0.422 13 512 ['Error'] 1 Table is in readonly mode (replica path: {}) 8. 8073 0.028 213.78 KiB 0.003 1 92 ['Trace'] 0 Query to stage {}{} 9. 7907 0.028 397.71 KiB 0.006 1 92 ['Trace'] 0 Query from stage {} to stage {}{} 10. 7172 0.025 504.40 KiB 0.008 1 577 ['Trace'] 0.697 Reserved {} on local disk {}, having unreserved {}. 11. 6662 0.023 777.39 KiB 0.012 289 185 ['Trace'] 0.484 Renaming temporary part {} to {} with tid {}. 12. 6569 0.023 455.55 KiB 0.007 292 570 ['Trace'] 0.665 Trying to reserve {} using storage policy from min volume index {} 13. 6395 0.022 299.25 KiB 0.005 1 179 ['Trace'] 0.388 filled checksums {} 14. 5175 0.018 480.40 KiB 0.007 1 48 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 15. 4350 0.015 488.53 KiB 0.008 4350 76 ['Debug'] 0.996 {} Authenticated with global context as user {} 16. 4350 0.015 198.00 KiB 0.003 4350 76 ['Debug'] 0.996 Authenticating user '{}' from {} 17. 4334 0.015 317.43 KiB 0.005 4334 62 ['Debug'] 1 Creating session context with user_id: {} 18. 4329 0.015 380.48 KiB 0.006 4329 76 ['Debug'] 0.996 {} Logout, user_id: {} 19. 4130 0.014 230.12 KiB 0.004 1 85 ['Debug'] 0.416 Peak memory usage{}: {}. 20. 3699 0.013 296.65 KiB 0.005 1 48 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 21. 3622 0.013 118.84 KiB 0.002 1 62 ['Trace'] 1 TCP Request. Address: {} 22. 3611 0.013 330.41 KiB 0.005 1 62 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 23. 3559 0.012 93.84 KiB 0.001 1 62 ['Debug'] 1 Done processing connection. 24. 2719 0.01 156.83 KiB 0.002 2 17 ['Trace'] 0.963 Loading config file '{}'. 25. 2525 0.009 227.72 KiB 0.004 10 514 ['Trace'] 0.916 Insert entry {} to queue with type {} 26. 2482 0.009 142.66 KiB 0.002 15 34 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 27. 2482 0.009 88.41 KiB 0.001 15 34 ['Trace'] 1 Flushed system log up to offset {} 28. 2464 0.009 300.58 KiB 0.005 1 5 ['Trace'] 1 Creating part at path {} 29. 2295 0.008 136.71 KiB 0.002 240 98 ['Debug'] 0.149 There are {} detached tables. Start searching non used tables. 30. 2295 0.008 96.37 KiB 0.001 240 98 ['Debug'] 0.149 Found {} non used tables in detached tables. 31. 2140 0.007 172.93 KiB 0.003 38 117 ['Trace'] 0.873 Part {} is not stored on zero-copy replicated disk, blobs can be removed 32. 2085 0.007 290.32 KiB 0.005 38 488 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 33. 2015 0.007 51.16 KiB 0.001 10 514 ['Debug'] 0.939 Pulled {} entries to queue. 34. 2015 0.007 116.10 KiB 0.002 10 514 ['Debug'] 0.939 Pulling {} entries to queue: {} - {} 35. 1987 0.007 81.57 KiB 0.001 8 32 ['Debug'] 0.373 Committing part {} to zookeeper 36. 1814 0.006 72.59 KiB 0.001 8 32 ['Debug'] 0.409 Part {} committed to zookeeper 37. 1776 0.006 152.02 KiB 0.002 77 496 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 38. 1760 0.006 55.01 KiB 0.001 20 19 ['Debug'] 0 Requested flush up to offset {} 39. 1584 0.006 162.03 KiB 0.003 1 7 ['Trace'] 0.5 Adding file: {}, size: {} 40. 1540 0.005 187.11 KiB 0.003 1 6 ['Trace'] 1 MemoryTracking: was {}, peak {}, free memory in arenas {}, will set to {} (RSS), difference: {} 41. 1524 0.005 44.19 KiB 0.001 1 101 ['Trace'] 0 Aggregation method: {} 42. 1465 0.005 307.39 KiB 0.005 2 36 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 43. 1463 0.005 616.65 KiB 0.01 2 36 ['Trace'] 1 Request URI: {} 44. 1448 0.005 130.87 KiB 0.002 1 103 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 45. 1326 0.005 27.19 KiB 0 2 35 ['Debug'] 0.56 Done processing query 46. 1257 0.004 42.94 KiB 0.001 1 48 ['Debug'] 0 Selected MergeAlgorithm: {} 47. 1257 0.004 101.22 KiB 0.002 1 48 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 48. 1256 0.004 88.01 KiB 0.001 1 456 ['Trace'] 0.678 Rolling back transaction {}{} 49. 1212 0.004 156.78 KiB 0.002 1 49 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 50. 1211 0.004 74.07 KiB 0.001 63 49 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 51. 1181 0.004 59.58 KiB 0.001 85 457 ['Debug'] 0.822 Selected {} parts from {} to {} 52. 1092 0.004 84.25 KiB 0.001 1 47 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 53. 1011 0.004 29.62 KiB 0 77 456 ['Debug'] 0.99 Updating strategy picker state 54. 977 0.003 21.94 KiB 0 1 103 ['Trace'] 0 Merging aggregated data 55. 968 0.003 120.63 KiB 0.002 2 268 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 56. 936 0.003 10.05 KiB 0 1 93 ['Trace'] 0 Aggregating 57. 841 0.003 31.03 KiB 0 176 49 ['Debug'] 0 Key condition: {} 58. 840 0.003 36.91 KiB 0.001 175 49 ['Trace'] 0 Filtering marks by primary and secondary keys 59. 818 0.003 68.67 KiB 0.001 1 29 ['Trace'] 0 Condition {} moved to PREWHERE 60. 810 0.003 92.79 KiB 0.001 172 49 ['Debug'] 0 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 61. 800 0.003 64.54 KiB 0.001 1 89 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 62. 787 0.003 99.20 KiB 0.002 184 114 ['Debug'] 0.996 Removing {} parts from filesystem (serially): Parts: [{}] 63. 742 0.003 18.05 KiB 0 6 17 ['Trace'] 1 Sending part {} 64. 742 0.003 120.15 KiB 0.002 6 16 ['Debug'] 1 Fetched part {} from {}:{}{} 65. 742 0.003 120.87 KiB 0.002 6 16 ['Debug'] 1 Fetching part {} from {}:{} 66. 742 0.003 26.81 KiB 0 6 16 ['Trace'] 1 Checking disk {} with type {} 67. 742 0.003 13.77 KiB 0 6 16 ['Debug'] 1 Downloading files {} 68. 742 0.003 34.72 KiB 0.001 6 16 ['Debug'] 1 Downloading part {} onto disk {}. 69. 742 0.003 41.24 KiB 0.001 6 16 ['Debug'] 1 Download of part {} onto disk {} finished. 70. 742 0.003 63.04 KiB 0.001 6 16 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 71. 742 0.003 63.77 KiB 0.001 6 16 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 72. 732 0.003 37.89 KiB 0.001 148 49 ['Trace'] 0 Spreading mark ranges among streams (default reading) 73. 719 0.003 1.98 MiB 0.032 2 20 ['Error'] 0.983 Setting {} should not be changed 74. 698 0.002 22.55 KiB 0 13 89 ['Trace'] 0 Found {} range {}in {} steps 75. 698 0.002 19.77 KiB 0 13 89 ['Trace'] 0 Found (LEFT) boundary mark: {} 76. 698 0.002 20.59 KiB 0 13 89 ['Trace'] 0 Found (RIGHT) boundary mark: {} 77. 698 0.002 48.88 KiB 0.001 13 89 ['Trace'] 0 Running binary search on index range for part {} ({} marks) 78. 694 0.002 249.33 KiB 0.004 1 29 ['Trace'] 0 PREWHERE condition was split into {} steps: {} 79. 686 0.002 55.52 KiB 0.001 1 7 ['Debug'] 0.481 Merging configuration file '{}'. 80. 678 0.002 112.46 KiB 0.002 1 34 ['Trace'] 0 No query result found for query {} 81. 666 0.002 26.67 KiB 0 16 47 ['Debug'] 0.042 Will use old analyzer to prepare mutation 82. 664 0.002 48.08 KiB 0.001 26 50 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 83. 635 0.002 65.88 KiB 0.001 34 52 ['Debug'] 0.994 Removing {} parts from memory: Parts: [{}] 84. 635 0.002 65.26 KiB 0.001 34 52 ['Trace'] 0.994 Found {} old parts to remove. Parts: [{}] 85. 624 0.002 24.40 KiB 0 1 124 ['Debug'] 0.614 Spawn loader worker #{} in {} 86. 624 0.002 17.69 KiB 0 1 145 ['Debug'] 1 Stop worker in {} 87. 623 0.002 45.29 KiB 0.001 1 124 ['Debug'] 1 Execute load job '{}' in {} 88. 623 0.002 47.12 KiB 0.001 1 30 ['Debug'] 0.124 Schedule load job '{}' into {} 89. 623 0.002 42.84 KiB 0.001 1 124 ['Debug'] 1 Finish load job '{}' with status {} 90. 623 0.002 82.78 KiB 0.001 1 71 ['Debug'] 0 Going to respond to replica {} with {}; mine_marks={}, stolen_by_hash={}, stolen_rest={} 91. 623 0.002 35.24 KiB 0.001 1 71 ['Trace'] 0 Handling request from replica {}, minimal marks size is {} 92. 622 0.002 31.23 KiB 0 1 16 ['Trace'] 0 Mutating part {} to mutation version {} 93. 612 0.002 56.49 KiB 0.001 1 32 ['Debug'] 0.082 Prioritize load job '{}': {} -> {} 94. 601 0.002 40.84 KiB 0.001 591 16 ['Trace'] 1 Executing log entry to mutate part {} to {} 95. 601 0.002 67.33 KiB 0.001 591 16 ['Trace'] 1 Mutating part {} with mutation commands from {} mutations ({}): {} 96. 585 0.002 45.75 KiB 0.001 114 43 ['Trace'] 0 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 97. 553 0.002 22.14 KiB 0 13 85 ['Trace'] 0.002 Sending external_roles with query: [{}] ({}) 98. 548 0.002 2.47 MiB 0.039 39 90 ['Error'] 0.224 Cannot schedule a task: {} (threads={}, jobs={}) 99. 544 0.002 80.45 KiB 0.001 1 27 ['Debug'] 0 Merged partially aggregated blocks for bucket #{}. Got {} rows, {} from {} source rows in {} sec. ({:.3f} rows/sec., {}/sec.) 100. 544 0.002 26.85 KiB 0 1 27 ['Trace'] 0 Merging partially aggregated blocks (bucket = {}). count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string Top messages without format string (fmt::runtime): count pattern runtime_message line 1. 54 CodeDBExceptionReceivedfromDBExc Code: 439. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Cannot schedule a task: fault injected (threads=795, jobs=755). Stack trace: 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x ('/executeQuery.cpp',221) 2. 14 voidDBStorageReplicatedMergeTree void DB::StorageReplicatedMergeTree::mutationsUpdatingTask(): Code: 999. Coordination::Exception: Session expired. (KEEPER_EXCEPTION), Stack trace (when copying this message, always include the lines below): 0. ./contrib/llvm-project/libcxx/include/except ('/Exception.cpp',273) 3. 6 CodeCoordinationExceptionSession Code: 999. Coordination::Exception: Session expired (fault injected on send). (KEEPER_EXCEPTION) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:45988) (comment: 00044_any_left_join_string.sql) (in query: CREATE DATABASE IF NOT EXISTS tes ('/executeQuery.cpp',221) 4. 6 configatindexiscommittedprevconf config at index 1 is committed, prev config log idx 0 ('/LoggerWrapper.h',43) 5. 4 CodeDBExceptionReceivedfromlocal Code: 507. DB::Exception: Received from localhost:9000. DB::Exception: Sharding key sub_key is not used. Stack trace: 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000001e5f29c3 1. ./build_do ('/executeQuery.cpp',221) 6. 3 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43) 7. 3 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43) 8. 3 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10546.altinitytest (revision: 4294967295, git hash: 2066b28944d33461f26e5a27053060c4d5f0613b, build id: FC9F2258905A5EDEA54B3FAC8027B0FF52E4F2D6), PID 414 ('',0) 9. 3 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0 peer 1, DC ID 0, localhost:9234, voting member, 1 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43) 10. 3 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43) 11. 3 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43) 12. 3 Forkedachildprocesstowatch Forked a child process to watch ('',0) 13. 3 skippedconfiglatestconfig skipped config 1, latest config 1 ('/LoggerWrapper.h',43) 14. 3 INITRAFTSERVERcommitindextermele === INIT RAFT SERVER === commit index 0 term 0 election timer allowed log store start 1, end 0 config log idx 0, prev log idx 0 -- ASYNC REPLICATION -- ('/LoggerWrapper.h',43) 15. 3 peerDCIDlocalhostvotingmembermyi peer 1: DC ID 0, localhost:9234, voting member, 1 my id: 1, voting_member num peers: 0 ('/LoggerWrapper.h',43) 16. 3 invalidelectiontimeoutlowerbound invalid election timeout lower bound detected, adjusted to 0 ('/LoggerWrapper.h',43) 17. 3 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43) 18. 3 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43) 19. 3 VOTEINITmyidmyrolecandidateterml [VOTE INIT] my id 1, my role candidate, term 1, log idx 0, log term 0, priority (target 1 / mine 1) ('/LoggerWrapper.h',43) 20. 3 startingup starting up ('',0) 21. 3 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43) 22. 3 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43) 23. 3 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43) 24. 3 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 0, state term 0, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43) 25. 3 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43) 26. 3 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43) 27. 3 parameterselectiontimeoutrangehe parameters: election timeout range 0 - 0, heartbeat 0, leadership expiry 0, max batch 100, backoff 50, snapshot distance 10000, enable randomized snapshot creation NO, log sync stop gap 99999, reserved logs 2147483647, client timeout 10000, auto forwarding ('/LoggerWrapper.h',43) 28. 3 numberofpendingcommitelements number of pending commit elements: 0 ('/LoggerWrapper.h',43) 29. 2 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 27 ('expand'): expand c, d;. Max query size exceeded: 'expand'. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:32928) (comment: 02366_kql_mvexpand.sql) (in query: m ('/executeQuery.cpp',221) 30. 2 detectaconfigurationchangethatis detect a configuration change that is not committed yet at index 1 ('/LoggerWrapper.h',43) Top messages not matching their format strings: message_format_string count() any_message 1. 85 Forked a child process to watch 2. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 19 /var/lib/clickhouse/store/450/45030a7b-46f5-48a0-a126-01c920b7c28e/tmp_merge_202605_1_106_21/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages) 3. Close WriteBufferFromAzureBlobStorage. {}. 6 Close WriteBufferFromAzureBlobStorage. ojbmidxtebphfdypmbtbsnwvsclhxron. (LogSeriesLimiter: on interval from 2026-05-08 19:35:51 to 2026-05-08 19:54:48 accepted series 1 / 1 for the logger WriteBufferFromAzureBlobStorage) 4. (from {}{}{}){}{} {} (stage: {}) 1 (from [::1]:59770) (comment: 01674_unicode_asan.sql) SELECT positionCaseInsensitiveUTF8('иголка.ру', 'иголка.р�\0') AS res; (stage: Complete) Top short messages: c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 1. 22 Cannot TRUNCATE dictionary Code: 62. DB::Exception: Cannot TRUNCATE dictionary. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build) 27 2. 17 {} ThreadFuzzer is enabled. Application will run slowly and unstable. 34 3. 2 Found {} on {} Found changelog_1_100000.bin on LocalLogDisk 18 4. 1 Creating {}: {} Creating table test_9.test: CREATE TABLE IF NOT EXISTS test_9.test UUID 'd5dafc6e-b697-4c2b-827f-f8d5a0e39e83' (`id` Int 1076 Top messages by level: (0.035090416703066306,'Table is in readonly mode (replica path: {})') Error (0.00010483096007687604,'dropAllData: got exception removing parts from disk, removing successfully removed parts from memory.') Warning (0.0016458460732069538,'Have {} tables in drop queue ({} of them are in use), will try drop {} tables') Information (0.03709618240587054,'(from {}{}{}){}{} {} (stage: {})') Debug (0.04703765178649428,'Processing requests batch, size: {}, bytes: {}') Trace 2026-05-08 19:58:31,011 Stress test finished + echo -e 'Test script exit code\tOK\t\N\t' + rg -Fa 'No queries hung' /test_output/test_results.tsv + grep -Fa OK No queries hung OK \N + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=2637 + clickhouse stop --max-tries 90 --do-not-kill /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Sent terminate signal to process with pid 2637. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 2637. The process with pid = 2637 does not exist. Server stopped + return + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.stress.log + unset THREAD_FUZZER_CPU_TIME_PERIOD_US THREAD_FUZZER_EXPLICIT_MEMORY_EXCEPTION_PROBABILITY THREAD_FUZZER_EXPLICIT_SLEEP_PROBABILITY THREAD_FUZZER_SLEEP_PROBABILITY THREAD_FUZZER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_lock_AFTER_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_AFTER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_lock_BEFORE_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_lock_BEFORE_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_unlock_AFTER_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_AFTER_SLEEP_TIME_US_MAX THREAD_FUZZER_pthread_mutex_unlock_BEFORE_MIGRATE_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_PROBABILITY THREAD_FUZZER_pthread_mutex_unlock_BEFORE_SLEEP_TIME_US_MAX THREAD_POOL_FAULT_INJECTION + start_server + counter=0 + max_attempt=120 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 0 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=1 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 1 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=2 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 2 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=3 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 3 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=4 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 4 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [08/May/2026:17:58:41 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - 127.0.0.1 - - [08/May/2026:17:58:41 +0000] "PUT /devstoreaccount1/cont/owvwuzxtsqomiebvdjtbwgbedbjzzimh HTTP/1.1" 201 - 127.0.0.1 - - [08/May/2026:17:58:41 +0000] "GET /devstoreaccount1/cont/owvwuzxtsqomiebvdjtbwgbedbjzzimh HTTP/1.1" 206 4 127.0.0.1 - - [08/May/2026:17:58:41 +0000] "GET /devstoreaccount1/cont/owvwuzxtsqomiebvdjtbwgbedbjzzimh HTTP/1.1" 206 2 127.0.0.1 - - [08/May/2026:17:58:41 +0000] "DELETE /devstoreaccount1/cont/owvwuzxtsqomiebvdjtbwgbedbjzzimh HTTP/1.1" 202 - + counter=5 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 5 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=6 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 6 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=7 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 7 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=8 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 8 -gt 120 ']' + clickhouse start --user root + sleep 0.5 + counter=9 + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + '[' 9 -gt 120 ']' + clickhouse start --user root + sleep 0.5 127.0.0.1 - - [08/May/2026:17:58:45 +0000] "GET /devstoreaccount1/cont/ojbmidxtebphfdypmbtbsnwvsclhxron HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/cjyvpvuiahrawwqejqivmavkpeurjbbq HTTP/1.1" 206 111 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/mrmxsspemybucqcgcumuzzhiqlmhtaej HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/rzsrbbeqgedmtnjtvdckspnuwemjbyuf HTTP/1.1" 206 430 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/refbdetwbajkwxwvtoudsdaiwynugvwu HTTP/1.1" 206 14712 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/aktitskcurmdoylyihfmyaeclzmoeiws HTTP/1.1" 206 7 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/qvfrdwfwaynmmswutgosrspjevhdgtha HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/rcwfmqohogatcjvsqfytnerixoodurob HTTP/1.1" 206 100 + counter=10 + clickhouse-client --query 'SELECT 1' 1 + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ hxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/vezascmyqqcaidyycdxssvzwpokpxvgu HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/dswidnisfkvxtxlurggixwevmxbealdw HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/tjwkiyxfuynofumkwteegwvzyvlenrua HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/qrhzgtgptofkyuwbpppkgevpyuxtexql HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/cgjpwmcnsyoieamcullbuxdnxhmbamtz HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/mbnadjrdzbhxtzydjllvfalebezzfpvd HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/gsvmdwozdkcrlewreitvjmfjtcmlbmdc HTTP/1.1" 206 189 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/duyfthncejaozfkkcjjbeojegverytwx HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/gorvacmqctnersqhlrnvivbqcymvgzix HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/oekyprhbbguirruhmcomcwdlhpmpvvlu HTTP/1.1" 206 111 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/fjfevirgppxsghyyadylcettinvuzume HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/zrijjzqfruwtzcwupkixjxkhdwdilcqr HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/rlaoacdwgkaydkjoetstafyfunkgetky HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/yhytapyktthysynqftfqdrtfbndrtybq HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/fkpgfvkqeguaxqfvzssmzpbaougxmste HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/nayjbwhswhhifmkooknqeattcydxevdh HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/tbzknqaftyfpgpavhdewnarbpzgfnxxj HTTP/1.1" 206 111 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/oihvnhlccuucekfucluydetezxolfntv HTTP/1.1" 206 270 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/ewdkpmbgwpeyfonpaffyydvucblqqrjc HTTP/1.1" 206 270 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/baqqjwyprwikjaetfgpihjecbbzdfvcg HTTP/1.1" 206 65 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/owmkyauusfvaslcuwlyuphfkhmtvfftz HTTP/1.1" 206 187 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/udexpgxrenmxftqqijhtzakvllquiqad HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/rfoyzcblyovschvqipbdsoleosfsceer HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/woeesbcxnlmsunjcznjcwwbvmdwtnhrh HTTP/1.1" 206 1656 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/hmayjlhadzjlzbiwvrjatezpjoatlzwu HTTP/1.1" 206 187 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/fqcrfkdvsstpetcrpmmsynykbpljnynj HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/nnwztncwbxlwjvyyzjzbtsgnrtufimvr HTTP/1.1" 206 3288 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/nqzekxljgvoinrbbhwqqnhtuitdsnsma HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/ceoxhsdunhndseqcqgrrshajvflhvnnk HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/qgkpmjohgtjtenebdyoibeidbojfnbel HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/snjqtokcqyxlwaukwnjpdqgyefnxfuga HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/pcfbcssjghgynuilzjwkieydppyayobm HTTP/1.1" 206 1 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/batnfhjynqzuthqbillgafiwxvhmqqsb HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/jffkzmylulrjoiytrhraxuybnwfjbytm HTTP/1.1" 206 5 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/cnqekvqybxazskpgjhanimdqlgmazgca HTTP/1.1" 206 190 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/fuvkigcxgslymgzfxfwuuynaevnjbpwl HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/bouljrgxsoizmsllfenwimadcddkewfe HTTP/1.1" 206 190 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/yyjptpgzfahzzvlvrfhrhgjhmbgbrdtv HTTP/1.1" 206 3 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/lppvmoxppwblsotmpqianhquykmbpylr HTTP/1.1" 206 270 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/ugqofnngohlhzdwzenrwatdeyrncodtc HTTP/1.1" 206 187 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/qhznsndiqrumklqdaomtgbakshmldsft HTTP/1.1" 206 270 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/igboreahtxxfnqzuhvstyeuoatfsebwk HTTP/1.1" 206 144 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/esjpvyaidlmbljibkieiiqilxqjzmdco HTTP/1.1" 206 144 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/crjxmgyvexqezmtbzqmzvmncygjcyhtl HTTP/1.1" 206 3 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/jbozojpaugsxhgkeejamwolwjlozelmo HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/wdtptjlflciokntwmooomfjxlboerisp HTTP/1.1" 206 3288 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/clxhoxlmnmlvgaorqiwgjgwaqidjihch HTTP/1.1" 206 3288 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/irkuanynezyfjvoqobaslgpthaljgxvq HTTP/1.1" 206 7 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/vzvaqaoogabvirqidrobkjhwheglodde HTTP/1.1" 206 6 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/pkyqvhzqopzirvhvssgkpyihosbxcnrl HTTP/1.1" 206 5 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/kyzzhqxyuhhiyydanremknlqysdyufjb HTTP/1.1" 206 5 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/kgnjwcbzhbtmcjvtdbrtklpdwpybqvyt HTTP/1.1" 206 270 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/wtrngdkphwmgnwjbihrzayzifiuktvjs HTTP/1.1" 206 3 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/eatsvtalpisydqneiinnnvalwfncfcjn HTTP/1.1" 206 7 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/gfsbzzuaaebbhauqnwnzlxmxrienfnth HTTP/1.1" 206 7 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/wiynsiarkhhhbtswxaahndiqlktkfycz HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/gfghjnqkopuutwflmsdshtjvkolspidt HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/csxbocxqlfgbxmsefxotaaprbctjuuhu HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/vsegfkyuqjblmptbxfzppyekzdnbcuzm HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/cjmthlawsvrdodihnazoroseuoqpcwel HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/rthqffymizwrxfopoifrdgazxjffyyei HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/deghmrozkgeetszefhegnmihuivjrlfy HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/upwppkupjzjhbitlwccqgmipeerdfzrt HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/iupqvxnxffylyvwauubrahqnsejjhqqc HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/pwdklsqkppaikqskoqnvdgxyksukefwf HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/tddkvqambmqwwlljggztdceclkunnqcu HTTP/1.1" 206 3288 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/mtlhretbyqlmumozhlxjmelonumurzhb HTTP/1.1" 206 187 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/gybgesitohsqetcyvbvtsrqhszndogfc HTTP/1.1" 206 80 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/ddlwluoemdmwoyuuxpwpsoyxsrlatsqf HTTP/1.1" 206 7 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/dxwgdazcchbpljjuwxmuhpgqdxjhbokt HTTP/1.1" 206 3 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/kozhyhrxdtwibqtrtinlrwweuabtdvqg HTTP/1.1" 206 10 127.0.0.1 - - [08/May/2026:17:58:46 +0000] "GET /devstoreaccount1/cont/ioiolrtjrwcutblhbdrwkkpszzxdpecq HTTP/1.1" 206 10 Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: fault injected (threads=0, jobs=0). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=1 ++ sleep 5 ++ '[' 1 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: failed to start the thread (threads=4, jobs=4). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=2 ++ sleep 5 ++ '[' 2 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: fault injected (threads=12, jobs=12). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=3 ++ sleep 5 ++ '[' 3 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' Received exception from server (version 24.8.14): Code: 439. DB::Exception: Received from localhost:9000. DB::Exception: Cannot schedule a task: failed to start the thread (threads=13, jobs=13). (CANNOT_SCHEDULE_TASK) (query: SELECT count() FROM system.build_options WHERE name = 'CXX_FLAGS' AND position('sanitize=address' IN value)) ++ retry=4 ++ sleep 5 ++ '[' 4 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 31814 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ hxB =~ e ]] + set_e=false + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + false + return + check_server_start + clickhouse-client --query 'SELECT '\''Server successfully started'\'', '\''OK'\'', NULL, '\'''\''' + '[' -s /test_output/application_errors.txt ']' + rm /test_output/application_errors.txt rm: cannot remove '/test_output/application_errors.txt': No such file or directory + stop_server + local max_tries=90 + local check_hang=true + local pid ++ cat /var/run/clickhouse-server/clickhouse-server.pid + pid=31814 + clickhouse stop --max-tries 90 --do-not-kill script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Sent terminate signal to process with pid 31814. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 31814. The process with pid = 31814 is running. Waiting for server to stop Now there is no clickhouse-server process. Server stopped + return + '[' -f /var/log/clickhouse-server/clickhouse-server.log ']' + '[' -f /var/log/clickhouse-server/stderr.log ']' + mv /var/log/clickhouse-server/clickhouse-server.log /var/log/clickhouse-server/clickhouse-server.final.log + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + grep -v a.myext + echo -e 'No lost s3 keys\tOK\t\N\t' + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + grep SharedMergeTreePartCheckThread + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.final.log /var/log/clickhouse-server/clickhouse-server.initial.log /var/log/clickhouse-server/clickhouse-server.stress.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -Faz '########################################' /test_output/gdb.log /test_output/stress_run_logs.tar.zst /test_output/test_results.tsv + rg -Fa ' received signal ' /test_output/gdb.log + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + collect_query_and_trace_logs + for table in query_log trace_log metric_log + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.query_log format TSVWithNamesAndTypes' + zstd --threads=0 Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [08/May/2026:17:59:23 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + for table in query_log trace_log metric_log + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.trace_log format TSVWithNamesAndTypes' + zstd --threads=0 Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [08/May/2026:17:59:33 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + for table in query_log trace_log metric_log + clickhouse-local --config-file=/etc/clickhouse-server/config.xml --only-system-tables -q 'select * from system.metric_log format TSVWithNamesAndTypes' + zstd --threads=0 Logging trace to /var/log/clickhouse-server/clickhouse-server.log Logging errors to /var/log/clickhouse-server/clickhouse-server.err.log 127.0.0.1 - - [08/May/2026:17:59:36 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 200 - + mv /var/log/clickhouse-server/stderr.log /test_output/ + clickhouse-local --structure 'test String, res String, time Nullable(Float32), desc String' -q 'SELECT '\''failure'\'', test FROM table WHERE res != '\''OK'\'' order by (test like '\''%Sanitizer%'\'') DESC, (test like '\''%Killed by signal%'\'') DESC, (test like '\''%gdb.log%'\'') DESC, (test ilike '\''%possible deadlock%'\'') DESC, (test like '\''%start%'\'') DESC, (test like '\''%dmesg%'\'') DESC, (test like '\''%OOM%'\'') DESC, (test like '\''%Signal 9%'\'') DESC, (test like '\''%Fatal message%'\'') DESC, rowNumberInAllBlocks() LIMIT 1' + '[' -s /test_output/check_status.tsv ']' + echo -e 'success\tNo errors found' + rg 'OOM in dmesg|Signal 9' /test_output/check_status.tsv + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core